Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0G005506.65ON31829714050.0
ZYRO0D14190g6.65ON2952046601e-84
Kpol_1042.116.65ON2922066572e-84
NCAS0F003306.65ON2812206154e-78
KAFR0G025006.65ON2892376121e-77
Smik_15.3526.65ON2881996102e-77
KNAG0M010206.65ON2792466023e-76
CAGL0L04620g6.65ON2642205952e-75
YOR174W (MED4)6.65ON2841975946e-75
Skud_15.3366.65ON2862085893e-74
TPHA0F025906.65ON3062055889e-74
AGR270W6.65ON2942285833e-73
SAKL0A08426g6.65ON2991755774e-72
NDAI0J013206.65ON3341895761e-71
Suva_8.2276.65ON2871715712e-71
KLTH0G15444g6.65ON2632395501e-68
KLLA0F20185g6.65ON2852545293e-65
Kwal_56.232426.65ON2561855264e-65
Ecym_31246.65ON2741855092e-62
TDEL0G040606.65ON2201814792e-58
KNAG0M025902.627ON659121770.40
YHR120W (MSH1)2.147ON95970721.7
Smik_10.781.191ON69993721.9
ZYRO0C03014g3.30ON33875693.5
KLLA0D14355g7.125ON58852684.7
KLLA0E15511g5.88ON90594685.2
KNAG0G020208.259ON144477686.4
YER168C (CCA1)8.233ON54696668.9
Smik_8.905.267ON192730669.3
ZYRO0D12122g5.511ON253143659.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0G00550
         (318 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0G00550 Chr7 (115655..116611) [957 bp, 318 aa] {ON} Anc_6.65...   545   0.0  
ZYRO0D14190g Chr4 (1200325..1201212) [888 bp, 295 aa] {ON} simil...   258   1e-84
Kpol_1042.11 s1042 (21260..22138) [879 bp, 292 aa] {ON} (21260.....   257   2e-84
NCAS0F00330 Chr6 (53650..54495) [846 bp, 281 aa] {ON} Anc_6.65 Y...   241   4e-78
KAFR0G02500 Chr7 complement(519629..520498) [870 bp, 289 aa] {ON...   240   1e-77
Smik_15.352 Chr15 (614812..615678) [867 bp, 288 aa] {ON} YOR174W...   239   2e-77
KNAG0M01020 Chr13 complement(180570..181409) [840 bp, 279 aa] {O...   236   3e-76
CAGL0L04620g Chr12 (533791..534585) [795 bp, 264 aa] {ON} simila...   233   2e-75
YOR174W Chr15 (658747..659601) [855 bp, 284 aa] {ON}  MED4Subuni...   233   6e-75
Skud_15.336 Chr15 (607340..608200) [861 bp, 286 aa] {ON} YOR174W...   231   3e-74
TPHA0F02590 Chr6 (565725..566645) [921 bp, 306 aa] {ON} Anc_6.65...   231   9e-74
AGR270W Chr7 (1244264..1245148) [885 bp, 294 aa] {ON} Syntenic h...   229   3e-73
SAKL0A08426g Chr1 complement(746101..747000) [900 bp, 299 aa] {O...   226   4e-72
NDAI0J01320 Chr10 complement(308327..309331) [1005 bp, 334 aa] {...   226   1e-71
Suva_8.227 Chr8 (408722..409585) [864 bp, 287 aa] {ON} YOR174W (...   224   2e-71
KLTH0G15444g Chr7 complement(1353833..1354624) [792 bp, 263 aa] ...   216   1e-68
KLLA0F20185g Chr6 complement(1882094..1882951) [858 bp, 285 aa] ...   208   3e-65
Kwal_56.23242 s56 (459387..460157) [771 bp, 256 aa] {ON} YOR174W...   207   4e-65
Ecym_3124 Chr3 complement(232769..233593) [825 bp, 274 aa] {ON} ...   200   2e-62
TDEL0G04060 Chr7 complement(741796..742458) [663 bp, 220 aa] {ON...   189   2e-58
KNAG0M02590 Chr13 complement(479062..481041) [1980 bp, 659 aa] {...    34   0.40 
YHR120W Chr8 (349574..352453) [2880 bp, 959 aa] {ON}  MSH1DNA-bi...    32   1.7  
Smik_10.78 Chr10 complement(124678..126777) [2100 bp, 699 aa] {O...    32   1.9  
ZYRO0C03014g Chr3 (234770..235786) [1017 bp, 338 aa] {ON} simila...    31   3.5  
KLLA0D14355g Chr4 complement(1219658..1221424) [1767 bp, 588 aa]...    31   4.7  
KLLA0E15511g Chr5 (1388626..1391343) [2718 bp, 905 aa] {ON} simi...    31   5.2  
KNAG0G02020 Chr7 (449115..453449) [4335 bp, 1444 aa] {ON} Anc_8....    31   6.4  
YER168C Chr5 complement(521029..522669) [1641 bp, 546 aa] {ON}  ...    30   8.9  
Smik_8.90 Chr8 (131286..137069) [5784 bp, 1927 aa] {ON} YHR023W ...    30   9.3  
ZYRO0D12122g Chr4 complement(1026137..1026898) [762 bp, 253 aa] ...    30   9.4  

>TBLA0G00550 Chr7 (115655..116611) [957 bp, 318 aa] {ON} Anc_6.65
           YOR174W
          Length = 318

 Score =  545 bits (1405), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 271/297 (91%), Positives = 271/297 (91%)

Query: 1   MSDFHNTLPHHGHHKTLSTSISEGDVLQDNNDKNDELSKIQTYNDLIQYEETLSKLSSSV 60
           MSDFHNTLPHHGHHKTLSTSISEGDVLQDNNDKNDELSKIQTYNDLIQYEETLSKLSSSV
Sbjct: 1   MSDFHNTLPHHGHHKTLSTSISEGDVLQDNNDKNDELSKIQTYNDLIQYEETLSKLSSSV 60

Query: 61  DKYKPDLQYAYDLIDIDRKLYSTLDSFVKYDEISTKLKKLEIDTKALDEKTKSVLDSLND 120
           DKYKPDLQYAYDLIDIDRKLYSTLDSFVKYDEISTKLKKLEIDTKALDEKTKSVLDSLND
Sbjct: 61  DKYKPDLQYAYDLIDIDRKLYSTLDSFVKYDEISTKLKKLEIDTKALDEKTKSVLDSLND 120

Query: 121 CHELLNTLPMLEQVEFEKNTMLKQREKINSKVLLDYATKLAKFTKIPPTFNKNTLGPNNF 180
           CHELLNTLPMLEQVEFEKNTMLKQREKINSKVLLDYATKLAKFTKIPPTFNKNTLGPNNF
Sbjct: 121 CHELLNTLPMLEQVEFEKNTMLKQREKINSKVLLDYATKLAKFTKIPPTFNKNTLGPNNF 180

Query: 181 IWPAEDALRRGMLAVASAHTEELTALPGSVGDEENSKDISQLNADDVTNKDNHMDMDITV 240
           IWPAEDALRRGMLAVASAHTEELTALPGSVGDEENSKDISQLNADDVTNKDNHMDMDITV
Sbjct: 181 IWPAEDALRRGMLAVASAHTEELTALPGSVGDEENSKDISQLNADDVTNKDNHMDMDITV 240

Query: 241 EGQDRFRRGSFTFGSLDASPKRFELXXXXXXXXXXXXXXXXXXXXXXXXXXGAQNGK 297
           EGQDRFRRGSFTFGSLDASPKRFEL                          GAQNGK
Sbjct: 241 EGQDRFRRGSFTFGSLDASPKRFELSNDNAANYNSNNNSNSNNSRTNDPNTGAQNGK 297

>ZYRO0D14190g Chr4 (1200325..1201212) [888 bp, 295 aa] {ON} similar
           to uniprot|Q12343 Saccharomyces cerevisiae YOR174W MED4
           Member of RNA Polymerase II transcriptional regulation
           mediator Stoichiometric member of mediator complex
          Length = 295

 Score =  258 bits (660), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 118/204 (57%), Positives = 162/204 (79%), Gaps = 1/204 (0%)

Query: 11  HGHHKTLSTSISEGDVLQDNNDKNDELSKIQTYNDLIQYEETLSKLSSSVDKYKPDLQYA 70
            GH ++ STS+   D +   N+ +DELSK+Q Y DL QYEE L+ L  SVD +KPD++  
Sbjct: 18  RGHVRSSSTSLI-SDAMSSGNNNDDELSKVQIYADLTQYEEKLAALVESVDNFKPDVKIV 76

Query: 71  YDLIDIDRKLYSTLDSFVKYDEISTKLKKLEIDTKALDEKTKSVLDSLNDCHELLNTLPM 130
           ++LI++D+ LY +LDSF +YD I ++L +L+ ++  LD KTK VL++L++C+E+LN LPM
Sbjct: 77  HELIEVDKSLYKSLDSFAEYDRIDSELNRLDKESNELDRKTKEVLETLSECYEMLNGLPM 136

Query: 131 LEQVEFEKNTMLKQREKINSKVLLDYATKLAKFTKIPPTFNKNTLGPNNFIWPAEDALRR 190
           LEQVEFEK ++LKQR K+NS VLL+YATKL+KFTKIPPTF+K T+GPNNF+WPAEDALRR
Sbjct: 137 LEQVEFEKQSILKQRSKVNSSVLLNYATKLSKFTKIPPTFDKGTIGPNNFVWPAEDALRR 196

Query: 191 GMLAVASAHTEELTALPGSVGDEE 214
           GMLA+AS H++E+T +PG   +EE
Sbjct: 197 GMLAIASLHSKEMTRIPGEPEEEE 220

>Kpol_1042.11 s1042 (21260..22138) [879 bp, 292 aa] {ON}
           (21260..22138) [879 nt, 293 aa]
          Length = 292

 Score =  257 bits (657), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 126/206 (61%), Positives = 166/206 (80%), Gaps = 10/206 (4%)

Query: 12  GHHKTLST---------SISEGDV-LQDNNDKNDELSKIQTYNDLIQYEETLSKLSSSVD 61
           GH K++S+         SIS   + + D N+++++LSK+Q YND+ +YE TL KL  SVD
Sbjct: 7   GHVKSISSVSLMTDNTNSISTNSLNMIDYNNESNDLSKVQIYNDISEYENTLFKLVESVD 66

Query: 62  KYKPDLQYAYDLIDIDRKLYSTLDSFVKYDEISTKLKKLEIDTKALDEKTKSVLDSLNDC 121
           K+KPD++ A+ LID+D +L+ +LDSFV+YD+ISTKL++ + +   LD KTK +L +LN+C
Sbjct: 67  KFKPDVKLAHQLIDVDERLFKSLDSFVEYDKISTKLEECDKEAAELDTKTKEILGTLNEC 126

Query: 122 HELLNTLPMLEQVEFEKNTMLKQREKINSKVLLDYATKLAKFTKIPPTFNKNTLGPNNFI 181
           H LLN+LPMLEQVEFEK+ +LKQR KINSK+LLDYATKL+KFTKIPPTFNK ++GPNNFI
Sbjct: 127 HGLLNSLPMLEQVEFEKDIILKQRSKINSKLLLDYATKLSKFTKIPPTFNKGSIGPNNFI 186

Query: 182 WPAEDALRRGMLAVASAHTEELTALP 207
           WPAEDALRRGMLA+AS H++ELT LP
Sbjct: 187 WPAEDALRRGMLAMASLHSKELTKLP 212

>NCAS0F00330 Chr6 (53650..54495) [846 bp, 281 aa] {ON} Anc_6.65
           YOR174W
          Length = 281

 Score =  241 bits (615), Expect = 4e-78,   Method: Compositional matrix adjust.
 Identities = 125/220 (56%), Positives = 164/220 (74%), Gaps = 7/220 (3%)

Query: 1   MSDFHNTL----PHHGHHKTLSTSI-SEGDVLQDNNDKNDELSKIQTYNDLIQYEETLSK 55
           MS   NTL       GH ++ S S+ +E +    +ND++D +SK+Q Y+DL  YE+ L+ 
Sbjct: 1   MSSQENTLLGSTTSMGHIRSSSVSLLAEVNPNSISNDEDD-ISKVQIYSDLCSYEQKLAN 59

Query: 56  LSSSVDKYKPDLQYAYDLIDIDRKLYSTLDSFVKYDEISTKLKKLEIDTKALDEKTKSVL 115
           L +SVDK+KPD+  A +LI++DR L+ TLDSF +YD+I   LKKL  ++  LD +TK +L
Sbjct: 60  LVNSVDKFKPDMNAARELIEVDRHLFQTLDSFEEYDKIDNSLKKLNAESIELDARTKEIL 119

Query: 116 DSLNDCHELLNTLPMLEQVEFEKNTMLKQREKINSKVLLDYATKLAKFTKIPPTFNKNTL 175
             LN+CH+ LN LPML+QVEFE  T+L+QR KINS VLLDYATKL+KFTKIPPTF+K ++
Sbjct: 120 GILNECHDELNALPMLKQVEFEMETILQQRSKINSSVLLDYATKLSKFTKIPPTFDKGSI 179

Query: 176 GPNNFIWPAEDALRRGMLAVASAHTEELTALPGS-VGDEE 214
           GPNNFIWPAEDALRRGMLA+AS H +ELT  PG+  G+EE
Sbjct: 180 GPNNFIWPAEDALRRGMLALASLHADELTKAPGAHEGEEE 219

>KAFR0G02500 Chr7 complement(519629..520498) [870 bp, 289 aa] {ON}
           Anc_6.65 YOR174W
          Length = 289

 Score =  240 bits (612), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 123/237 (51%), Positives = 169/237 (71%), Gaps = 4/237 (1%)

Query: 18  STSISEGDVLQDNNDKNDELSKIQTYNDLIQYEETLSKLSSSVDKYKPDLQYAYDLIDID 77
           STSI+  + +   +  +  ++K+  Y+DL QYEETLS+L  S+D YKPD + A +LIDID
Sbjct: 22  STSITNSNNIDSASGASPAITKVGIYSDLSQYEETLSRLIQSIDTYKPDKKIAQELIDID 81

Query: 78  RKLYSTLDSFVKYDEISTKLKKLEIDTKALDEKTKSVLDSLNDCHELLNTLPMLEQVEFE 137
            KL+++LDSFV+YD IS++LK  E   K    KTK +L++LN+CH  LN LP ++QV FE
Sbjct: 82  SKLFNSLDSFVQYDRISSRLKDFEKQEKESTLKTKEILETLNECHNALNLLPTVDQVHFE 141

Query: 138 KNTMLKQREKINSKVLLDYATKLAKFTKIPPTFNKNTLGPNNFIWPAEDALRRGMLAVAS 197
            NTML+QR+KINS VLLDYATKL+KFTKIPPTF+K ++GPNNF+WPAEDALRRGMLA+A+
Sbjct: 142 MNTMLEQRKKINSSVLLDYATKLSKFTKIPPTFDKGSIGPNNFVWPAEDALRRGMLALAA 201

Query: 198 AHTEELTALPGSVGDEENSKDISQLNADDVTNKDNHMDMDITVEGQDRFRRGSFTFG 254
           +HT+ELT + G    E +  D + +  D++ + D   +  I  +     RRGS+ F 
Sbjct: 202 SHTDELTKIAGV---EMSLSDDNSIALDEIKSVDAG-EGPIPEKKDSSSRRGSYIFA 254

>Smik_15.352 Chr15 (614812..615678) [867 bp, 288 aa] {ON} YOR174W
           (REAL)
          Length = 288

 Score =  239 bits (610), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 115/199 (57%), Positives = 153/199 (76%), Gaps = 6/199 (3%)

Query: 12  GHHKTLSTSISEGDVLQDNNDKN--DELSKIQTYNDLIQYEETLSKLSSSVDKYKPDLQY 69
           GH K+ S S+    V++  ++ N  D+LSK+Q Y DL +YE+TL KL  SVD++KPD+  
Sbjct: 14  GHMKSSSVSL----VVEATSNMNSEDKLSKVQLYEDLCRYEDTLKKLVESVDRFKPDIDV 69

Query: 70  AYDLIDIDRKLYSTLDSFVKYDEISTKLKKLEIDTKALDEKTKSVLDSLNDCHELLNTLP 129
           A DLI ID  L++ +D   +YD I   L+K++ D++ LD KTK +L+ +N+CH+ L  LP
Sbjct: 70  ARDLIKIDESLFNNVDLLSEYDNIDRNLRKIDKDSEELDSKTKRILEIMNECHDELGALP 129

Query: 130 MLEQVEFEKNTMLKQREKINSKVLLDYATKLAKFTKIPPTFNKNTLGPNNFIWPAEDALR 189
           MLEQVEFEKNT+L+QR KINS  LLDYATKL+KFT+IPPTF+K ++GPNNFIWPAEDALR
Sbjct: 130 MLEQVEFEKNTILQQRSKINSTALLDYATKLSKFTRIPPTFDKGSIGPNNFIWPAEDALR 189

Query: 190 RGMLAVASAHTEELTALPG 208
           RGMLA+AS H++ELT +PG
Sbjct: 190 RGMLAMASLHSKELTRVPG 208

>KNAG0M01020 Chr13 complement(180570..181409) [840 bp, 279 aa] {ON}
           Anc_6.65 YOR174W
          Length = 279

 Score =  236 bits (602), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 122/246 (49%), Positives = 168/246 (68%), Gaps = 21/246 (8%)

Query: 12  GHHKTLSTSISEGDVLQDNNDKN---DELSKIQTYNDLIQYEETLSKLSSSVDKYKPDLQ 68
           GH +  S S+     LQ+  D     ++L K++ Y+ +++YE+TL+ L  SVD YKPD+ 
Sbjct: 17  GHKRASSVSL-----LQEGTDAAALAEDLKKVRIYSGIVEYEDTLAALVESVDSYKPDMA 71

Query: 69  YAYDLIDIDRKLYSTLDSFVKYDEISTKLKKLEIDTKALDEKTKSVLDSLNDCHELLNTL 128
            A  L+D D++L+++LD F +YDEIST+L +L+  + ALD KT+ +L+ LN+CH+ LN L
Sbjct: 72  VAQRLVDADKELFASLDKFKEYDEISTRLGELKGKSTALDTKTRDILEKLNECHDELNKL 131

Query: 129 PMLEQVEFEKNTMLKQREKINSKVLLDYATKLAKFTKIPPTFNKNTLGPNNFIWPAEDAL 188
           P LEQV+FE +T+L+QREKINS  LLDYATKL+KFT+IPPTF+K ++GPNNFIWPAEDAL
Sbjct: 132 PYLEQVQFEMDTILEQREKINSSELLDYATKLSKFTRIPPTFDKGSIGPNNFIWPAEDAL 191

Query: 189 RRGMLAVASAHTEELTALPGSVGDEENSKDISQLNADDVTNKDNHMDMDITVEGQDRFRR 248
           R+GMLA+A+ H+ ELT +PG    E+  K   Q    DV          +T E     RR
Sbjct: 192 RKGMLAIAALHSRELTRIPGQDDAEDKKK---QTEKPDVPEP-----APVTEE-----RR 238

Query: 249 GSFTFG 254
            SF FG
Sbjct: 239 SSFVFG 244

>CAGL0L04620g Chr12 (533791..534585) [795 bp, 264 aa] {ON} similar
           to uniprot|Q12343 Saccharomyces cerevisiae YOR174w MED4
          Length = 264

 Score =  233 bits (595), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 120/220 (54%), Positives = 155/220 (70%), Gaps = 4/220 (1%)

Query: 36  ELSKIQTYNDLIQYEETLSKLSSSVDKYKPDLQYAYDLIDIDRKLYSTLDSFVKYDEIST 95
           EL K+Q Y+DL  YEE L+KL  SVD +KP L+    LI+ D+KLYSTLD   +YD + T
Sbjct: 16  ELDKVQLYSDLCLYEEALTKLVDSVDNFKPQLEIGKQLIEADKKLYSTLDLLPQYDSVFT 75

Query: 96  KLKKLEIDTKALDEKTKSVLDSLNDCHELLNTLPMLEQVEFEKNTMLKQREKINSKVLLD 155
           +L+ L+ +   +D++TK++L  LN+CH+ LN LP+LE+VEFEK  +LKQREKI S VLL+
Sbjct: 76  RLRTLDDEISKVDQQTKNILSILNECHDDLNALPLLEEVEFEKKMILKQREKIKSNVLLE 135

Query: 156 YATKLAKFTKIPPTFNKNTLGPNNFIWPAEDALRRGMLAVASAHTEELTALPGSVGDEEN 215
           YATKLAKFTKIPPTF+K T+GPNNFIWPAEDALR+GMLA+AS H +ELT LPG    E+ 
Sbjct: 136 YATKLAKFTKIPPTFDKGTIGPNNFIWPAEDALRKGMLAMASLHGKELTKLPGQ---EDG 192

Query: 216 SKDISQLNADDVTNKDNHMDMDITVEGQDRFRRGSFTFGS 255
            +D S  N D    KD     +  +   D+    SF FG+
Sbjct: 193 EEDGSTANEDKNIVKDAE-GAEGEIRQDDKKEDDSFVFGA 231

>YOR174W Chr15 (658747..659601) [855 bp, 284 aa] {ON}  MED4Subunit
           of the RNA polymerase II mediator complex; associates
           with core polymerase subunits to form the RNA polymerase
           II holoenzyme; essential for transcriptional regulation
          Length = 284

 Score =  233 bits (594), Expect = 6e-75,   Method: Compositional matrix adjust.
 Identities = 114/197 (57%), Positives = 147/197 (74%), Gaps = 2/197 (1%)

Query: 12  GHHKTLSTSISEGDVLQDNNDKNDELSKIQTYNDLIQYEETLSKLSSSVDKYKPDLQYAY 71
           GH +  S+S+S       N +  D+LSK+Q Y DL +YE+TLSKL  SVD++KP+L  A 
Sbjct: 14  GHIR--SSSVSLVAEATSNTNSEDKLSKVQLYEDLCRYEDTLSKLVESVDRFKPNLDIAK 71

Query: 72  DLIDIDRKLYSTLDSFVKYDEISTKLKKLEIDTKALDEKTKSVLDSLNDCHELLNTLPML 131
           DLI  D  L+  +    +YD I   L+K++ D++ LD KT+ +L+ LN+CH+ L  LPML
Sbjct: 72  DLIRTDEALFENVKLLAEYDNIYRNLQKIDKDSEELDSKTRKILEILNECHDELKALPML 131

Query: 132 EQVEFEKNTMLKQREKINSKVLLDYATKLAKFTKIPPTFNKNTLGPNNFIWPAEDALRRG 191
           EQVEFEKNT+L+QR KINS  LLDYATKL+KFTKIPPTF+K  +GPNNFIWPAEDALRRG
Sbjct: 132 EQVEFEKNTILQQRSKINSTELLDYATKLSKFTKIPPTFDKGAVGPNNFIWPAEDALRRG 191

Query: 192 MLAVASAHTEELTALPG 208
           MLA+AS H++ELT +PG
Sbjct: 192 MLAMASLHSKELTRIPG 208

>Skud_15.336 Chr15 (607340..608200) [861 bp, 286 aa] {ON} YOR174W
           (REAL)
          Length = 286

 Score =  231 bits (589), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 116/208 (55%), Positives = 153/208 (73%), Gaps = 4/208 (1%)

Query: 12  GHHKTLSTSISEGDVLQDNNDKNDELSKIQTYNDLIQYEETLSKLSSSVDKYKPDLQYAY 71
           GH K  S+S+S       N +  D+LSK+Q Y DL +YE  LSKL  SVD++KPDL  A 
Sbjct: 14  GHIK--SSSVSLVAEAASNMNSEDKLSKVQLYEDLCRYEGVLSKLVESVDRFKPDLDVAR 71

Query: 72  DLIDIDRKLYSTLDSFVKYDEISTKLKKLEIDTKALDEKTKSVLDSLNDCHELLNTLPML 131
           DLI  D  L++ +     YD I   L+K++ D++ LD K++ +L+ LN+CH+ L+ LP L
Sbjct: 72  DLISADESLFNNVKLLADYDNIDRNLQKIDKDSEELDSKSRKILEILNECHDELSGLPTL 131

Query: 132 EQVEFEKNTMLKQREKINSKVLLDYATKLAKFTKIPPTFNKNTLGPNNFIWPAEDALRRG 191
           EQVEFEKNT+L+QR KINS  LLDYATKL+KFTKIPPTF+K T+GPNNFIWPAEDALRRG
Sbjct: 132 EQVEFEKNTILQQRSKINSTALLDYATKLSKFTKIPPTFDKGTVGPNNFIWPAEDALRRG 191

Query: 192 MLAVASAHTEELTALPGSVGDEENSKDI 219
           MLA+AS H++ELT +PG   DE+ ++++
Sbjct: 192 MLAMASLHSKELTRVPGE--DEQETEEV 217

>TPHA0F02590 Chr6 (565725..566645) [921 bp, 306 aa] {ON} Anc_6.65
           YOR174W
          Length = 306

 Score =  231 bits (588), Expect = 9e-74,   Method: Compositional matrix adjust.
 Identities = 110/205 (53%), Positives = 153/205 (74%)

Query: 4   FHNTLPHHGHHKTLSTSISEGDVLQDNNDKNDELSKIQTYNDLIQYEETLSKLSSSVDKY 63
           F++TL      ++ + +IS+G     N    D L+ +  YND+  YE+TL KL SS+D +
Sbjct: 24  FNSTLTPVAVPQSTANNISQGTASNMNTAAVDSLANVAIYNDIKNYEDTLIKLVSSIDNF 83

Query: 64  KPDLQYAYDLIDIDRKLYSTLDSFVKYDEISTKLKKLEIDTKALDEKTKSVLDSLNDCHE 123
           +PD++ A  LI++D++LY  L SF +YDEI TK+ K++ D++ LD +TK +LD LND   
Sbjct: 84  RPDVEVAKTLIEVDKRLYKNLGSFKEYDEIDTKISKIKDDSEKLDLQTKHILDILNDSRN 143

Query: 124 LLNTLPMLEQVEFEKNTMLKQREKINSKVLLDYATKLAKFTKIPPTFNKNTLGPNNFIWP 183
           +LN+LPMLE++ FE++ M ++++KINSK+LLDYATK++KFTKIPPTFNK ++GPNNFIWP
Sbjct: 144 MLNSLPMLEEIYFERDVMHEKQKKINSKILLDYATKISKFTKIPPTFNKGSIGPNNFIWP 203

Query: 184 AEDALRRGMLAVASAHTEELTALPG 208
           AEDALRRGMLAVAS H  ELT LP 
Sbjct: 204 AEDALRRGMLAVASIHRSELTKLPN 228

>AGR270W Chr7 (1244264..1245148) [885 bp, 294 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR174W (MED4)
          Length = 294

 Score =  229 bits (583), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 116/228 (50%), Positives = 160/228 (70%), Gaps = 5/228 (2%)

Query: 33  KNDELSKIQTYNDLIQYEETLSKLSSSVDKYKPDLQYAYDLIDIDRKLYSTLDSFVKYDE 92
           + ++L  +  Y DL QYEE+L +L +SVDK++PDL+ A +LI+ID KLYS L    KYD 
Sbjct: 43  EQNKLHSVAIYEDLCQYEESLQRLVTSVDKFQPDLEAAQELIEIDSKLYSNLAQLPKYDL 102

Query: 93  ISTKLKKLEIDTKALDEKTKSVLDSLNDCHELLNTLPMLEQVEFEKNTMLKQREKINSKV 152
           I ++LKKLE ++K +DE+T  +L  L +C+  LN+LPM+EQVEFE  TM KQ++K+NS V
Sbjct: 103 IDSQLKKLEEESKDIDERTAKILGILGECYNDLNSLPMVEQVEFEMATMKKQKDKVNSSV 162

Query: 153 LLDYATKLAKFTKIPPTFNKNTLGPNNFIWPAEDALRRGMLAVASAHTEELTALPGSVGD 212
           LL+YA KL+KFT++PPTFNK+ +GPNNFIWPAEDA+RRGMLA+AS  ++ELT+LPG   D
Sbjct: 163 LLEYAMKLSKFTRVPPTFNKDAIGPNNFIWPAEDAIRRGMLAMASLKSKELTSLPGQ-SD 221

Query: 213 EENSKDISQLNADDVTNKDNHMDMDITVEGQDRFRRGSFTFGSLDASP 260
           +E  +  +   AD  T       ++    G +  RRGSF F  +   P
Sbjct: 222 QEAEQASAGKEAD--TAGPGVSTLEPANGGHN--RRGSFEFTGIRKPP 265

>SAKL0A08426g Chr1 complement(746101..747000) [900 bp, 299 aa] {ON}
           similar to gnl|GLV|KLLA0F20185g Kluyveromyces lactis
           KLLA0F20185g and weakly similar to YOR174W
           uniprot|Q12343 Saccharomyces cerevisiae YOR174W MED4
           Member of RNA Polymerase II transcriptional regulation
           mediator Stoichiometric member of mediator complex
          Length = 299

 Score =  226 bits (577), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 105/175 (60%), Positives = 137/175 (78%)

Query: 34  NDELSKIQTYNDLIQYEETLSKLSSSVDKYKPDLQYAYDLIDIDRKLYSTLDSFVKYDEI 93
            D LS+++ Y D+ +YEETL KL SSVDK+KPDL+ A +LI+ D+KL+  L+ F KYD+I
Sbjct: 41  QDLLSRVEVYADICEYEETLGKLVSSVDKFKPDLKVAQELIETDKKLFKALEEFPKYDKI 100

Query: 94  STKLKKLEIDTKALDEKTKSVLDSLNDCHELLNTLPMLEQVEFEKNTMLKQREKINSKVL 153
             +L  LE  ++ +D+KT  +L+ LN CH  LN+LP LEQV  E++TMLKQREKI S VL
Sbjct: 101 DGRLNDLEKQSQEVDKKTSKILEVLNGCHAQLNSLPALEQVLLERDTMLKQREKIYSGVL 160

Query: 154 LDYATKLAKFTKIPPTFNKNTLGPNNFIWPAEDALRRGMLAVASAHTEELTALPG 208
           LDYA KLAKFT++PPTF+K  +GPNNFIWPAEDA+RRGMLA+AS  ++ELT +PG
Sbjct: 161 LDYAMKLAKFTRVPPTFDKGMVGPNNFIWPAEDAMRRGMLAMASLKSKELTRIPG 215

>NDAI0J01320 Chr10 complement(308327..309331) [1005 bp, 334 aa] {ON}
           Anc_6.65 YOR174W
          Length = 334

 Score =  226 bits (576), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 109/189 (57%), Positives = 143/189 (75%)

Query: 20  SISEGDVLQDNNDKNDELSKIQTYNDLIQYEETLSKLSSSVDKYKPDLQYAYDLIDIDRK 79
           S SE +   DN+   D LS+++ Y+D+I YE+ LS+L  SVDK+KP+L  A +LI  D+ 
Sbjct: 59  SSSEFNRSYDNDSSKDVLSEVRIYDDIITYEKALSRLIDSVDKFKPNLNIAQELIQADKS 118

Query: 80  LYSTLDSFVKYDEISTKLKKLEIDTKALDEKTKSVLDSLNDCHELLNTLPMLEQVEFEKN 139
           L+ TL+SF++YDEI   LK LE     +DE T+S L +LN+CH+ LN LP L Q+EFE N
Sbjct: 119 LFDTLNSFIQYDEIDLHLKALETKASKIDELTQSTLQTLNECHDDLNKLPTLPQIEFELN 178

Query: 140 TMLKQREKINSKVLLDYATKLAKFTKIPPTFNKNTLGPNNFIWPAEDALRRGMLAVASAH 199
           T+L QR KINS +LLDYATKL+KFTKIPPTF+K ++GPNNFIWPAED+LRRGMLA+AS  
Sbjct: 179 TILNQRTKINSTILLDYATKLSKFTKIPPTFDKGSIGPNNFIWPAEDSLRRGMLAMASLK 238

Query: 200 TEELTALPG 208
            ++LT +PG
Sbjct: 239 ADQLTYIPG 247

>Suva_8.227 Chr8 (408722..409585) [864 bp, 287 aa] {ON} YOR174W
           (REAL)
          Length = 287

 Score =  224 bits (571), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 103/171 (60%), Positives = 135/171 (78%)

Query: 38  SKIQTYNDLIQYEETLSKLSSSVDKYKPDLQYAYDLIDIDRKLYSTLDSFVKYDEISTKL 97
           SK+Q Y DL +YE+ L KL  SVD++KP+L+ A DLI  D  L++ +     YD+I   L
Sbjct: 38  SKVQLYEDLCRYEDILGKLVESVDRFKPNLEIAKDLIKTDESLFNNVKLLADYDKIDLNL 97

Query: 98  KKLEIDTKALDEKTKSVLDSLNDCHELLNTLPMLEQVEFEKNTMLKQREKINSKVLLDYA 157
           +K++ D++ LD KT+ +L+ LN+CH+ L+ LPMLEQVEFEK T+L+QR KINS  LLDYA
Sbjct: 98  RKIDKDSEELDSKTRKILEILNECHDELSALPMLEQVEFEKKTILQQRSKINSTALLDYA 157

Query: 158 TKLAKFTKIPPTFNKNTLGPNNFIWPAEDALRRGMLAVASAHTEELTALPG 208
           TKL+KFT+IPPTF+K T+GPNNFIWPAEDALRRGMLA+AS H++ELT +PG
Sbjct: 158 TKLSKFTRIPPTFDKGTVGPNNFIWPAEDALRRGMLAMASLHSKELTRIPG 208

>KLTH0G15444g Chr7 complement(1353833..1354624) [792 bp, 263 aa]
           {ON} some similarities with uniprot|Q12343 Saccharomyces
           cerevisiae YOR174W MED4 Member of RNA Polymerase II
           transcriptional regulation mediator Stoichiometric
           member of mediator complex
          Length = 263

 Score =  216 bits (550), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 113/239 (47%), Positives = 158/239 (66%), Gaps = 7/239 (2%)

Query: 17  LSTSISEGDVLQDNNDK-NDELSKIQTYNDLIQYEETLSKLSSSVDKYKPDLQYAYDLID 75
           +STS    +   D +D   + LSK+Q YND+ ++E+TL KL +SVD++ PDL+ A  LI+
Sbjct: 1   MSTSTGHRNPGPDRSDSVENPLSKLQVYNDICEFEDTLGKLVASVDRFNPDLELARALIE 60

Query: 76  IDRKLYSTLDSFVKYDEISTKLKKLEIDTKALDEKTKSVLDSLNDCHELLNTLPMLEQVE 135
            D++LY +L+   KYDEI T+ K L+ + +  DEKT  +L++L +C   LN LPMLEQVE
Sbjct: 61  ADKQLYKSLECLPKYDEIDTRAKTLDEEHRDTDEKTIRILETLTECGSDLNALPMLEQVE 120

Query: 136 FEKNTMLKQREKINSKVLLDYATKLAKFTKIPPTFNKNTLGPNNFIWPAEDALRRGMLAV 195
           FE+ TMLKQREK+ + VLLDYA KLAKFT +PPTF+K T+GPNNF+WPAEDA+RRGMLA+
Sbjct: 121 FERETMLKQREKVFTDVLLDYAMKLAKFTHVPPTFDKGTVGPNNFVWPAEDAMRRGMLAI 180

Query: 196 ASAHTEELTALPGSVGDEENSKDISQLNADDVTNKDNHMDM-DITVEGQDRFRRGSFTF 253
           AS     L A  G+   E+ +    + +     N++   D+     + +   RR SF F
Sbjct: 181 AS-----LRASEGANAQEQQASSEQKTSEKSSENEEAQTDIRSPDTKEEPVARRPSFGF 234

>KLLA0F20185g Chr6 complement(1882094..1882951) [858 bp, 285 aa]
           {ON} similar to uniprot|Q12343 Saccharomyces cerevisiae
           YOR174W MED4 Member of RNA Polymerase II transcriptional
           regulation mediator Stoichiometric member of mediator
           complex
          Length = 285

 Score =  208 bits (529), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 117/254 (46%), Positives = 160/254 (62%), Gaps = 18/254 (7%)

Query: 7   TLPHHGHHKTLSTSISEGDVLQDNNDKNDELSKIQTYNDLIQYEETLSKLSSSVDKYKPD 66
           TLP     KT    +SE            EL  +  Y DL +YEET+ +LS SVD +KPD
Sbjct: 15  TLPFSAQDKT-QEQVSE------------ELQSVGIYQDLERYEETIQQLSKSVDTFKPD 61

Query: 67  LQYAYDLIDIDRKLYSTLDSFVKYDEISTKLKKLEIDTKALDEKTKSVLDSLNDCHELLN 126
           L     +I+ D+KLY TL+ F +Y +I  +L +L+ + K +D KT+ +L++LN C+  LN
Sbjct: 62  LSLIDKVIECDKKLYETLEEFDEYYKIEEELSRLDKEQKNIDNKTREILETLNTCYNSLN 121

Query: 127 TLPMLEQVEFEKNTMLKQREKINSKVLLDYATKLAKFTKIPPTFNKNTLGPNNFIWPAED 186
            LPMLEQVEFE+  MLKQREKI+SKV+LDYA KLAKFT+ PPTF+K+ +GPNNFIWPAED
Sbjct: 122 ELPMLEQVEFEQKVMLKQREKIHSKVVLDYAMKLAKFTRFPPTFDKSMIGPNNFIWPAED 181

Query: 187 ALRRGMLAVASAHTEELTALPGSVGDEENSKDISQLNADDVTNKDNHMDM-----DITVE 241
           +LR+GMLA+AS   +EL        +  N  + S+++    TN+D+  D       +   
Sbjct: 182 SLRKGMLAMASLKKKELLLDALDEDNVNNDNNTSKIDEMRNTNEDSVDDRFNNKEQVQDA 241

Query: 242 GQDRFRRGSFTFGS 255
            +D  RRGSF F +
Sbjct: 242 TEDTERRGSFEFTA 255

>Kwal_56.23242 s56 (459387..460157) [771 bp, 256 aa] {ON} YOR174W
           (MED4) - Stoichiometric member of mediator complex
           [contig 183] FULL
          Length = 256

 Score =  207 bits (526), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 96/185 (51%), Positives = 133/185 (71%)

Query: 18  STSISEGDVLQDNNDKNDELSKIQTYNDLIQYEETLSKLSSSVDKYKPDLQYAYDLIDID 77
           ++S+ +   ++   +    LSK Q Y+D+ ++EETL KL +SVDK+ PDL+ A  LI++D
Sbjct: 3   TSSVHKNPEVERPTNAESRLSKAQIYSDICEFEETLGKLVASVDKFNPDLKIAESLIEVD 62

Query: 78  RKLYSTLDSFVKYDEISTKLKKLEIDTKALDEKTKSVLDSLNDCHELLNTLPMLEQVEFE 137
           ++L  TL+S  +YDEI  + K+L+      DE+   +L++L +C   LN LPMLEQVEFE
Sbjct: 63  KRLSKTLESLPRYDEIDLRAKELDQKHLETDERMVRILETLTECSTDLNALPMLEQVEFE 122

Query: 138 KNTMLKQREKINSKVLLDYATKLAKFTKIPPTFNKNTLGPNNFIWPAEDALRRGMLAVAS 197
           + TMLKQREK+ + VLLDYA KLAKFT +PPTF+K  +GPNNF+WPAEDA+RRGMLA+AS
Sbjct: 123 RQTMLKQREKVFTNVLLDYAMKLAKFTHVPPTFDKGAVGPNNFVWPAEDAMRRGMLAIAS 182

Query: 198 AHTEE 202
               E
Sbjct: 183 LQASE 187

>Ecym_3124 Chr3 complement(232769..233593) [825 bp, 274 aa] {ON}
           similar to Ashbya gossypii AGR270W
          Length = 274

 Score =  200 bits (509), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 105/185 (56%), Positives = 137/185 (74%)

Query: 30  NNDKNDELSKIQTYNDLIQYEETLSKLSSSVDKYKPDLQYAYDLIDIDRKLYSTLDSFVK 89
           NND+ + + ++  Y DL Q+EE L KL  SVDK+ PDLQ A DLI+ D KLYSTL+    
Sbjct: 15  NNDELNHVQQVTLYKDLCQFEEDLQKLVVSVDKFSPDLQAAQDLINSDLKLYSTLEQLPL 74

Query: 90  YDEISTKLKKLEIDTKALDEKTKSVLDSLNDCHELLNTLPMLEQVEFEKNTMLKQREKIN 149
           YD I  +LK+L+ +++ +DE+T  +L  L+ C+  LN LPM+EQVEFE   M KQ+EKI 
Sbjct: 75  YDSIDIQLKQLDNESQEIDERTGKILSILDKCYNNLNKLPMVEQVEFEMKMMKKQKEKIK 134

Query: 150 SKVLLDYATKLAKFTKIPPTFNKNTLGPNNFIWPAEDALRRGMLAVASAHTEELTALPGS 209
           S VLL+YA KLAKFT++PPTFNK+ +GPNNFIWPAEDA+RRGMLA+AS  +EELT +P  
Sbjct: 135 SGVLLEYAMKLAKFTRVPPTFNKDAIGPNNFIWPAEDAIRRGMLAMASLKSEELTRIPVE 194

Query: 210 VGDEE 214
           +  EE
Sbjct: 195 LNSEE 199

>TDEL0G04060 Chr7 complement(741796..742458) [663 bp, 220 aa] {ON}
           Anc_6.65 YOR174W
          Length = 220

 Score =  189 bits (479), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 89/181 (49%), Positives = 129/181 (71%), Gaps = 5/181 (2%)

Query: 41  QTYNDLIQYEETLSKLSSSVDKYKPDLQYAYDLIDIDRKLYSTLDSFVKYDEISTKLKKL 100
           Q Y DL +YEE L +L  SVD+++PDL  A +L++ DR L  +LD F  YDE+  +L++L
Sbjct: 3   QVYGDLTRYEEALGRLVESVDQFRPDLSCARELVEADRALGKSLDKFGLYDEVDKELQRL 62

Query: 101 EIDTKALDEKTKSVLDSLNDCHELLNTLPMLEQVEFEKNTMLKQREKINSKVLLDYATKL 160
           + +++ L+  T   L++L++C+  L+ LPMLEQV+FE+  +L+QR ++NS VLL+YATKL
Sbjct: 63  DRESERLNRHTARTLETLDECYRALSALPMLEQVKFEQRKVLEQRGRVNSAVLLEYATKL 122

Query: 161 AKFTKIPPTFNKNTLGPNNFIWPAEDALRRGMLAVASAHTEELTALPGSVGDEENSKDIS 220
           +KFTK P       +GPNNF+WPAEDALRRG LAVA+ H+EE+T   GS G+   S + S
Sbjct: 123 SKFTKAPAGV---AVGPNNFVWPAEDALRRGQLAVAALHSEEITL--GSTGERSGSVESS 177

Query: 221 Q 221
           +
Sbjct: 178 E 178

>KNAG0M02590 Chr13 complement(479062..481041) [1980 bp, 659 aa] {ON}
           Anc_2.627 YMR061W
          Length = 659

 Score = 34.3 bits (77), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 31/121 (25%), Positives = 59/121 (48%), Gaps = 12/121 (9%)

Query: 19  TSISEGDVLQDNNDKNDELSKIQTYNDLIQYEETLSKLSSSVDKYKPDLQYAYDLIDIDR 78
           ++ ++ ++ Q N D   ++ ++QT+ D IQ+E+  +KL+   +  K  + Y Y       
Sbjct: 257 STCNKNNIAQYNEDDIIDVEQLQTWLDWIQWEKE-NKLTLPEETLKERITYVYG----QA 311

Query: 79  KLYSTLDSFVKYDEI-----STKLKKLEIDTKAL--DEKTKSVLDSLNDCHELLNTLPML 131
             Y      + YD +     +    ++ I + AL  +  + S+   L +C+EL N LPML
Sbjct: 312 VQYMVFCPEIWYDYVMYLADAPIEDRIRILSSALLANPSSPSLTFKLGECYELENNLPML 371

Query: 132 E 132
           E
Sbjct: 372 E 372

>YHR120W Chr8 (349574..352453) [2880 bp, 959 aa] {ON}
           MSH1DNA-binding protein of the mitochondria involved in
           repair of mitochondrial DNA, has ATPase activity and
           binds to DNA mismatches; has homology to E. coli MutS;
           transcription is induced during meiosis
          Length = 959

 Score = 32.3 bits (72), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 35/70 (50%), Gaps = 3/70 (4%)

Query: 21  ISEGDVLQDNNDKNDELSKIQTYNDL-IQYEETLSKLSSSVDKYKPDLQYAYDLIDI--D 77
           IS   + + N++K D L  I T N L  Q ++ LS    S     P LQY  DL+D+  D
Sbjct: 36  ISFNKISESNSEKKDNLGSIDTRNCLSTQQDDKLSSTEPSKASLPPSLQYVRDLMDLYKD 95

Query: 78  RKLYSTLDSF 87
             + + + SF
Sbjct: 96  HVVLTQMGSF 105

>Smik_10.78 Chr10 complement(124678..126777) [2100 bp, 699 aa] {ON}
           YJL156C (REAL)
          Length = 699

 Score = 32.3 bits (72), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 26/93 (27%), Positives = 49/93 (52%), Gaps = 2/93 (2%)

Query: 100 LEIDTKALDEKTKSVLDSLNDCHELLNTL--PMLEQVEFEKNTMLKQREKINSKVLLDYA 157
           LE   K+L E  ++++D ++D H+ + ++   ++E +E+ K  +   RE+I  +V ++ +
Sbjct: 170 LEYVQKSLSELEENLVDIMDDIHQDVISISKAVIEAIEYFKEFLPTIRERIPYRVNVEKS 229

Query: 158 TKLAKFTKIPPTFNKNTLGPNNFIWPAEDALRR 190
           + L K  KI   F  N L  + F       LRR
Sbjct: 230 SSLRKINKIVLHFLDNLLVSDAFSNSRSILLRR 262

>ZYRO0C03014g Chr3 (234770..235786) [1017 bp, 338 aa] {ON} similar
           to uniprot|P32453 Saccharomyces cerevisiae YNL315C ATP11
           Molecular chaperone required for the assembly of alpha
           and beta subunits into the F1 sector of mitochondrial
           F1F0 ATP synthase
          Length = 338

 Score = 31.2 bits (69), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 43/75 (57%), Gaps = 8/75 (10%)

Query: 31  NDKNDELSKIQTYNDLIQYEE--TLSKLSSSVDKYKPDLQYAYDLIDIDRKLYSTLDSFV 88
           ++K  EL++I    +L +YE+   +S+ ++ + K K  +  A      +R  Y TLDSF+
Sbjct: 93  DEKKKELTRIDPLKELEEYEQRMMMSQNNAGLTKSKGPVNAA-----AERVPYKTLDSFI 147

Query: 89  KYDEISTKLKKLEID 103
           K D+ S +L K E++
Sbjct: 148 KVDKFS-ELSKQEVE 161

>KLLA0D14355g Chr4 complement(1219658..1221424) [1767 bp, 588 aa]
           {ON} similar to uniprot|Q08977 YPL260W Saccharomyces
           cerevisiae Hypothetical ORF
          Length = 588

 Score = 30.8 bits (68), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 33/52 (63%), Gaps = 3/52 (5%)

Query: 78  RKLYSTLDSFVKYDEISTKLKKLEIDTKALDEKTKSVLDSL-NDCHELLNTL 128
           ++L   L+    + +I+ K K LE D   ++EK ++VL+ L +DCH+L+N L
Sbjct: 279 KQLQEQLEKLESHRDINGKFKSLETD--KVEEKGQNVLNGLLDDCHDLVNDL 328

>KLLA0E15511g Chr5 (1388626..1391343) [2718 bp, 905 aa] {ON} similar
           to uniprot|P50090 Saccharomyces cerevisiae YGR238C KEL2
           Protein that functions in a complex with Kel1p to
           negatively regulate mitotic exit interacts with Tem1p
           and Lte1p localizes to regions of polarized growth
           potential Cdc28p substrate AND similar to YHR158C
           uniprot|P38853 Saccharomyces cerevisiae YHR158C KEL1
           Protein required for proper cell fusion and cell
           morphology functions in a complex with Kel2p to
           negatively regulate mitotic exit interacts with Tem1p
           and Lte1p localizes to regions of polarized growth
           potential Cdc28p substrate
          Length = 905

 Score = 30.8 bits (68), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 28/94 (29%), Positives = 50/94 (53%), Gaps = 21/94 (22%)

Query: 36  ELSKIQTYNDLIQYE-ETLSKLSSSVDKYKPDLQYAYDLIDIDRKLYSTLDSFVKYDEIS 94
           +L+++   ND+I+++ E ++KL S VD               +++ Y  L+S  KY  +S
Sbjct: 667 QLNQLSHLNDMIKHQTEVIAKLQSEVD---------------NKEKYVDLES--KYIVLS 709

Query: 95  TKLKKLEIDTKALDEKTKSVLDSLNDCHELLNTL 128
            K + L   TK LD K + + +++  C E L+TL
Sbjct: 710 EKYESL---TKELDSKKQFINENIKKCSESLDTL 740

>KNAG0G02020 Chr7 (449115..453449) [4335 bp, 1444 aa] {ON} Anc_8.259
           YLR086W
          Length = 1444

 Score = 30.8 bits (68), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 27/77 (35%), Positives = 38/77 (49%), Gaps = 9/77 (11%)

Query: 92  EISTKLKKLEIDTKALDEKTKSVLDSLNDC--------HELLNTLPMLEQVEFEKNTMLK 143
           EI+T+   LE  TK LD+K K    ++           HEL     + E+ E E N + K
Sbjct: 482 EINTQSVSLEETTKNLDQKLKKAKATVESSKSLISKNEHELQEQSQLQEEYEAEVNDLSK 541

Query: 144 QREKINSKVLLDYATKL 160
           QRE +  K+LLD   +L
Sbjct: 542 QRE-VEEKILLDIKLQL 557

>YER168C Chr5 complement(521029..522669) [1641 bp, 546 aa] {ON}
           CCA1ATP (CTP):tRNA-specific tRNA nucleotidyltransferase;
           different forms targeted to the nucleus, cytosol, and
           mitochondrion are generated via the use of multiple
           transcriptional and translational start sites
          Length = 546

 Score = 30.0 bits (66), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 26/96 (27%), Positives = 47/96 (48%), Gaps = 6/96 (6%)

Query: 33  KNDELSKIQTYNDLIQYEETLSKLSSSVDKYKPDLQYAYDLIDIDRK---LYSTLDSFVK 89
           KND     +T + +  YEE L+K +      K ++       + + +     S  D+F+K
Sbjct: 398 KNDAAVIAKTVDSICSYEEILAKFADRSQLKKSEIGIFLRNFNGEWETAHFASLSDAFLK 457

Query: 90  YDEISTKLKKLEIDTKALDEKTKSVLD-SLNDCHEL 124
             ++ T  KK+E+  +  +E    + D +LN+CHEL
Sbjct: 458 IPKLET--KKIELLFQNYNEFYSYIFDNNLNNCHEL 491

>Smik_8.90 Chr8 (131286..137069) [5784 bp, 1927 aa] {ON} YHR023W
           (REAL)
          Length = 1927

 Score = 30.0 bits (66), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 20/30 (66%)

Query: 97  LKKLEIDTKALDEKTKSVLDSLNDCHELLN 126
           L+++E   K L+EK +  +D L D HELLN
Sbjct: 877 LQEMESKKKFLEEKNRKTIDELKDTHELLN 906

>ZYRO0D12122g Chr4 complement(1026137..1026898) [762 bp, 253 aa]
           {ON} similar to uniprot|Q03433 Saccharomyces cerevisiae
           YML041C VPS71 Protein of unknown function component of
           the Swr1p complex that incorporates Htz1p into chromatin
           required for vacuolar protein sorting
          Length = 253

 Score = 29.6 bits (65), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 34/143 (23%), Positives = 63/143 (44%), Gaps = 36/143 (25%)

Query: 55  KLSSSVDKYKPDLQYAYDLIDIDRKLYST--------------------LDSFVKYDEIS 94
           +LSSS++  +   +  Y L D++ KLY+T                    +D F + + I 
Sbjct: 38  RLSSSLNTSRSTKRVNYSLADLETKLYTTKQDDNDNQQDVNANGGNPTVMDKFTQQEIIK 97

Query: 95  TKLKKLEIDTKALDEKTKSVLDSLNDCHELLNTLPMLEQVEFEKN---TMLKQREKINSK 151
           +K + +E+DT+   +        L+D   +L+ L  +++ + E N      K + ++   
Sbjct: 98  SKRRHMELDTENQSD--------LSDVPMMLSALTGIKRDKIESNGGAIRSKNKFEMPKN 149

Query: 152 VLLDYATKLAKFTKIPPTFNKNT 174
           + L Y +     TK PP   KNT
Sbjct: 150 IHLSYRS-----TKPPPPRRKNT 167

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.312    0.130    0.363 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 31,721,096
Number of extensions: 1482147
Number of successful extensions: 7349
Number of sequences better than 10.0: 334
Number of HSP's gapped: 7674
Number of HSP's successfully gapped: 345
Length of query: 318
Length of database: 53,481,399
Length adjustment: 109
Effective length of query: 209
Effective length of database: 40,982,805
Effective search space: 8565406245
Effective search space used: 8565406245
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 66 (30.0 bits)