Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0F034603.454ON44144121730.0
TDEL0F033903.454ON4244099661e-127
SAKL0B06116g3.454ON4314009491e-124
Kpol_1035.93.454ON4274019151e-119
ABL019W3.454ON4314059131e-119
KLTH0E13948g3.454ON4384099111e-119
Skud_7.4153.454ON4524139121e-119
Smik_6.2003.454ON4454099071e-118
KNAG0B009503.454ON4184088991e-117
YGR110W (CLD1)3.454ON4454139001e-117
TPHA0O013103.454ON4383978991e-117
ZYRO0C06270g3.454ON4304068961e-116
KAFR0I019703.454ON4114038931e-116
Suva_7.3953.454ON4514138881e-115
Kwal_27.123173.454ON4354048841e-115
Ecym_24653.454ON4384028791e-114
CAGL0L04686g3.454ON4514278681e-112
NDAI0G010903.454ON4564108431e-108
NCAS0E008603.454ON4404098341e-107
KLLA0B12914g3.454ON4264047724e-98
SAKL0G19074gna 1ON4324104398e-49
KLTH0C01254gna 1ON4344174012e-43
Kwal_14.985na 1ON4354283733e-39
Ecym_5577singletonON4334213312e-33
KAFR0B053808.284ON4113391862e-14
Suva_2.2888.284ON4353411811e-13
Smik_4.3718.284ON4353381783e-13
CAGL0B01969g8.284ON4233361739e-13
Skud_4.3868.284ON4463511721e-12
TDEL0F041008.284ON4343311703e-12
YLR099C (ICT1)8.284ON3943331632e-11
KNAG0G021408.284ON4083721604e-11
Smik_12.1588.284ON3943221595e-11
YDR125C (ECM18)8.284ON4533451588e-11
Skud_12.1678.284ON3943311588e-11
Kpol_543.498.284ON4293421552e-10
KAFR0B028308.284ON3913651542e-10
Suva_10.1838.284ON3943271542e-10
SAKL0H16500g8.284ON4193361524e-10
AGR062C8.284ON3843181524e-10
NCAS0B051208.284ON3963421506e-10
NDAI0J01200singletonON4273361453e-09
Ecym_42858.284ON4053341419e-09
NCAS0B037108.284ON4303281411e-08
Kwal_56.237028.284ON4163381401e-08
NDAI0J012108.284ON4163391382e-08
ZYRO0D06666g8.284ON3803351338e-08
TPHA0A016908.284ON4053531331e-07
CAGL0M11462g8.284ON3863521284e-07
KLLA0F19624g8.284ON4093391275e-07
TBLA0H014008.284ON4211491241e-06
KNAG0H031208.284ON4343451213e-06
TPHA0L016008.524ON3721151115e-05
KLTH0G13178g8.284ON4153261062e-04
NCAS0B022608.524ON3631451052e-04
CAGL0M05467g8.524ON354288930.006
Kwal_27.119758.524ON336224900.013
KNAG0A037708.524ON356115870.033
Skud_2.3318.524ON376122820.15
Kpol_1042.242.487ON311126790.28
TDEL0B032508.524ON348116790.35
SAKL0H10450g8.524ON392116780.47
NCAS0J018104.301ON71050780.51
KLTH0E12188g8.524ON336224760.71
YBR204C (LDH1)8.524ON375265760.72
NDAI0C054308.524ON362115760.86
Smik_2.3458.524ON375123751.0
Kpol_299.68.524ON349115722.3
TBLA0D030801.144ON231238723.3
Suva_6.1431.308ON29994703.6
Kpol_1036.788.340ON1277178714.4
TPHA0C039302.487ON309172695.2
ZYRO0C15070g2.217ON93160696.6
SAKL0D07194g1.308ON29766687.1
KAFR0D032602.487ON308102687.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0F03460
         (441 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0F03460 Chr6 (853280..854605) [1326 bp, 441 aa] {ON}              841   0.0  
TDEL0F03390 Chr6 (624579..625853) [1275 bp, 424 aa] {ON} Anc_3.4...   376   e-127
SAKL0B06116g Chr2 complement(519929..521224) [1296 bp, 431 aa] {...   370   e-124
Kpol_1035.9 s1035 complement(19721..21004) [1284 bp, 427 aa] {ON...   357   e-119
ABL019W Chr2 (361560..362855) [1296 bp, 431 aa] {ON} Non-synteni...   356   e-119
KLTH0E13948g Chr5 complement(1231122..1232438) [1317 bp, 438 aa]...   355   e-119
Skud_7.415 Chr7 (692655..694013) [1359 bp, 452 aa] {ON} YGR110W ...   355   e-119
Smik_6.200 Chr6 (329969..331306) [1338 bp, 445 aa] {ON} YGR110W ...   353   e-118
KNAG0B00950 Chr2 (173167..174423) [1257 bp, 418 aa] {ON} Anc_3.4...   350   e-117
YGR110W Chr7 (713709..715046) [1338 bp, 445 aa] {ON}  CLD1Mitoch...   351   e-117
TPHA0O01310 Chr15 complement(258745..260061) [1317 bp, 438 aa] {...   350   e-117
ZYRO0C06270g Chr3 (475283..476575) [1293 bp, 430 aa] {ON} simila...   349   e-116
KAFR0I01970 Chr9 (401907..403142) [1236 bp, 411 aa] {ON}              348   e-116
Suva_7.395 Chr7 (684763..686118) [1356 bp, 451 aa] {ON} YGR110W ...   346   e-115
Kwal_27.12317 s27 complement(1173365..1174672) [1308 bp, 435 aa]...   345   e-115
Ecym_2465 Chr2 complement(908173..909489) [1317 bp, 438 aa] {ON}...   343   e-114
CAGL0L04686g Chr12 (539203..540558) [1356 bp, 451 aa] {ON} simil...   338   e-112
NDAI0G01090 Chr7 (230932..232302) [1371 bp, 456 aa] {ON} Anc_3.454    329   e-108
NCAS0E00860 Chr5 (157521..158843) [1323 bp, 440 aa] {ON} Anc_3.454    325   e-107
KLLA0B12914g Chr2 (1126975..1128255) [1281 bp, 426 aa] {ON} simi...   301   4e-98
SAKL0G19074g Chr7 (1646858..1648156) [1299 bp, 432 aa] {ON} cons...   173   8e-49
KLTH0C01254g Chr3 complement(113435..114739) [1305 bp, 434 aa] {...   159   2e-43
Kwal_14.985 s14 complement(142781..144088) [1308 bp, 435 aa] {ON...   148   3e-39
Ecym_5577 Chr5 (1185997..1187298) [1302 bp, 433 aa] {ON} similar...   132   2e-33
KAFR0B05380 Chr2 (1107049..1108284) [1236 bp, 411 aa] {ON} Anc_8...    76   2e-14
Suva_2.288 Chr2 complement(496577..497884) [1308 bp, 435 aa] {ON...    74   1e-13
Smik_4.371 Chr4 complement(662692..663999) [1308 bp, 435 aa] {ON...    73   3e-13
CAGL0B01969g Chr2 complement(181406..182677) [1272 bp, 423 aa] {...    71   9e-13
Skud_4.386 Chr4 complement(673125..674465) [1341 bp, 446 aa] {ON...    71   1e-12
TDEL0F04100 Chr6 complement(756762..758066) [1305 bp, 434 aa] {O...    70   3e-12
YLR099C Chr12 complement(339744..340928) [1185 bp, 394 aa] {ON} ...    67   2e-11
KNAG0G02140 Chr7 complement(484440..485666) [1227 bp, 408 aa] {O...    66   4e-11
Smik_12.158 Chr12 complement(319660..320844) [1185 bp, 394 aa] {...    66   5e-11
YDR125C Chr4 complement(701397..702758) [1362 bp, 453 aa] {ON}  ...    65   8e-11
Skud_12.167 Chr12 complement(322870..324054) [1185 bp, 394 aa] {...    65   8e-11
Kpol_543.49 s543 complement(108945..110234) [1290 bp, 429 aa] {O...    64   2e-10
KAFR0B02830 Chr2 complement(578530..579705) [1176 bp, 391 aa] {O...    64   2e-10
Suva_10.183 Chr10 complement(344549..345733) [1185 bp, 394 aa] {...    64   2e-10
SAKL0H16500g Chr8 (1450828..1452087) [1260 bp, 419 aa] {ON} simi...    63   4e-10
AGR062C Chr7 complement(833212..834366) [1155 bp, 384 aa] {ON} S...    63   4e-10
NCAS0B05120 Chr2 complement(953798..954988) [1191 bp, 396 aa] {O...    62   6e-10
NDAI0J01200 Chr10 (280820..282103) [1284 bp, 427 aa] {ON}              60   3e-09
Ecym_4285 Chr4 (612053..613270) [1218 bp, 405 aa] {ON} similar t...    59   9e-09
NCAS0B03710 Chr2 (664097..665389) [1293 bp, 430 aa] {ON} Anc_8.284     59   1e-08
Kwal_56.23702 s56 complement(668862..670112) [1251 bp, 416 aa] {...    59   1e-08
NDAI0J01210 Chr10 (282384..283634) [1251 bp, 416 aa] {ON} Anc_8....    58   2e-08
ZYRO0D06666g Chr4 (576172..577314) [1143 bp, 380 aa] {ON} simila...    56   8e-08
TPHA0A01690 Chr1 (344521..345738) [1218 bp, 405 aa] {ON} Anc_8.2...    56   1e-07
CAGL0M11462g Chr13 complement(1129244..1130404) [1161 bp, 386 aa...    54   4e-07
KLLA0F19624g Chr6 complement(1817206..1818435) [1230 bp, 409 aa]...    54   5e-07
TBLA0H01400 Chr8 (312727..313992) [1266 bp, 421 aa] {ON} Anc_8.2...    52   1e-06
KNAG0H03120 Chr8 (586146..587450) [1305 bp, 434 aa] {ON} Anc_8.2...    51   3e-06
TPHA0L01600 Chr12 (338450..339568) [1119 bp, 372 aa] {ON} Anc_8....    47   5e-05
KLTH0G13178g Chr7 (1131579..1132826) [1248 bp, 415 aa] {ON} simi...    45   2e-04
NCAS0B02260 Chr2 complement(374788..375879) [1092 bp, 363 aa] {O...    45   2e-04
CAGL0M05467g Chr13 complement(583722..584786) [1065 bp, 354 aa] ...    40   0.006
Kwal_27.11975 s27 (1028242..1029252) [1011 bp, 336 aa] {ON} YBR2...    39   0.013
KNAG0A03770 Chr1 complement(494021..495091) [1071 bp, 356 aa] {O...    38   0.033
Skud_2.331 Chr2 complement(599967..601097) [1131 bp, 376 aa] {ON...    36   0.15 
Kpol_1042.24 s1042 complement(53853..54788) [936 bp, 311 aa] {ON...    35   0.28 
TDEL0B03250 Chr2 complement(575015..576061) [1047 bp, 348 aa] {O...    35   0.35 
SAKL0H10450g Chr8 complement(897598..898776) [1179 bp, 392 aa] {...    35   0.47 
NCAS0J01810 Chr10 (338250..340382) [2133 bp, 710 aa] {ON} Anc_4....    35   0.51 
KLTH0E12188g Chr5 (1082142..1083152) [1011 bp, 336 aa] {ON} simi...    34   0.71 
YBR204C Chr2 complement(632254..633381) [1128 bp, 375 aa] {ON}  ...    34   0.72 
NDAI0C05430 Chr3 (1259106..1260194) [1089 bp, 362 aa] {ON} Anc_8...    34   0.86 
Smik_2.345 Chr2 complement(618817..619944) [1128 bp, 375 aa] {ON...    33   1.0  
Kpol_299.6 s299 (14238..15287) [1050 bp, 349 aa] {ON} (14238..15...    32   2.3  
TBLA0D03080 Chr4 (741949..748887) [6939 bp, 2312 aa] {ON} Anc_1....    32   3.3  
Suva_6.143 Chr6 (237157..238056) [900 bp, 299 aa] {ON} YJL068C (...    32   3.6  
Kpol_1036.78 s1036 (208850..211480,211530..211538,211627..212820...    32   4.4  
TPHA0C03930 Chr3 (843179..844108) [930 bp, 309 aa] {ON} Anc_2.48...    31   5.2  
ZYRO0C15070g Chr3 (1172681..1175476) [2796 bp, 931 aa] {ON} simi...    31   6.6  
SAKL0D07194g Chr4 (591271..592164) [894 bp, 297 aa] {ON} similar...    31   7.1  
KAFR0D03260 Chr4 (640955..641881) [927 bp, 308 aa] {ON} Anc_2.48...    31   7.6  

>TBLA0F03460 Chr6 (853280..854605) [1326 bp, 441 aa] {ON} 
          Length = 441

 Score =  841 bits (2173), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 412/441 (93%), Positives = 412/441 (93%)

Query: 1   MLHFRGTIGFRKTLGIRRTLTHDXXXXXXXXXXXXXXXXXTLKPSTAPKAASLPQILRNL 60
           MLHFRGTIGFRKTLGIRRTLTHD                 TLKPSTAPKAASLPQILRNL
Sbjct: 1   MLHFRGTIGFRKTLGIRRTLTHDAPSSSSASRLPSASASATLKPSTAPKAASLPQILRNL 60

Query: 61  PRLFPRSMTDSIRDYSQFKTNPEFFQDRLLSQLSFYPSLYXXXXXXXXXXXXPRQGQIIK 120
           PRLFPRSMTDSIRDYSQFKTNPEFFQDRLLSQLSFYPSLY            PRQGQIIK
Sbjct: 61  PRLFPRSMTDSIRDYSQFKTNPEFFQDRLLSQLSFYPSLYNNNSNDTSGNDDPRQGQIIK 120

Query: 121 TYVNENEYINEFQILPNTSTPYDRLKHLILIHGYGAGLGFYINTLQHLSMDNWCIHAVDL 180
           TYVNENEYINEFQILPNTSTPYDRLKHLILIHGYGAGLGFYINTLQHLSMDNWCIHAVDL
Sbjct: 121 TYVNENEYINEFQILPNTSTPYDRLKHLILIHGYGAGLGFYINTLQHLSMDNWCIHAVDL 180

Query: 181 PGYGFSSRLKFPYGTINPRIYSKKDVLDWFQKRLKTWFHKKGLLAHPENNLVTAHSMGAY 240
           PGYGFSSRLKFPYGTINPRIYSKKDVLDWFQKRLKTWFHKKGLLAHPENNLVTAHSMGAY
Sbjct: 181 PGYGFSSRLKFPYGTINPRIYSKKDVLDWFQKRLKTWFHKKGLLAHPENNLVTAHSMGAY 240

Query: 241 IMCHYLNNHPSDFRKIIMCSPAGFYPASNPLTNIPLWYTYLWDRNYSPFSLVRISGPLGS 300
           IMCHYLNNHPSDFRKIIMCSPAGFYPASNPLTNIPLWYTYLWDRNYSPFSLVRISGPLGS
Sbjct: 241 IMCHYLNNHPSDFRKIIMCSPAGFYPASNPLTNIPLWYTYLWDRNYSPFSLVRISGPLGS 300

Query: 301 KLTSGWSYSRFFHSNQTISNELSLALHTYAYSIFNLPGSGEYSLSHILKAGGDPRTPLQE 360
           KLTSGWSYSRFFHSNQTISNELSLALHTYAYSIFNLPGSGEYSLSHILKAGGDPRTPLQE
Sbjct: 301 KLTSGWSYSRFFHSNQTISNELSLALHTYAYSIFNLPGSGEYSLSHILKAGGDPRTPLQE 360

Query: 361 EFFTCQSTTNNGIRRSNVEYSWLYGQSDWINKTGGFKISQFLNSLNKKSNVFIAPNSGHH 420
           EFFTCQSTTNNGIRRSNVEYSWLYGQSDWINKTGGFKISQFLNSLNKKSNVFIAPNSGHH
Sbjct: 361 EFFTCQSTTNNGIRRSNVEYSWLYGQSDWINKTGGFKISQFLNSLNKKSNVFIAPNSGHH 420

Query: 421 LYFDNYMWFNSYLAKEMTLFN 441
           LYFDNYMWFNSYLAKEMTLFN
Sbjct: 421 LYFDNYMWFNSYLAKEMTLFN 441

>TDEL0F03390 Chr6 (624579..625853) [1275 bp, 424 aa] {ON} Anc_3.454
           YGR110W
          Length = 424

 Score =  376 bits (966), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 200/409 (48%), Positives = 257/409 (62%), Gaps = 29/409 (7%)

Query: 41  TLKPSTAPKAASLPQILRNLPRLFPRSMTDSIRDYSQF-KTNPEFFQDRLLSQLSFYPSL 99
           +L    AP A  L +I+  LP LFPRS  DS+RDY    +   E FQ  LL+ L FY   
Sbjct: 30  SLDVPAAPTAIPLREIIVKLPSLFPRSFGDSVRDYRDLCRHTDEKFQRDLLATLPFYGE- 88

Query: 100 YXXXXXXXXXXXXPRQGQIIKTYVN-ENEYINEFQILP-NTSTPYDRLKHLILIHGYGAG 157
                         R+ ++I+T V+ E  YINEF I+P N S P DRLKHL+ IHGYGAG
Sbjct: 89  ----------GDLHRRSEVIRTKVDDEGNYINEFYIMPKNASVPRDRLKHLVFIHGYGAG 138

Query: 158 LGFYINTLQHLSMDN--WCIHAVDLPGYGFSSRLKFPYGTINPRIYSKKDVLDWFQKRLK 215
           LGF++   +++ + N  WCIHA+DLPGYGFSSR KFP+      +    DV +WF KRL 
Sbjct: 139 LGFFLKNFENIPLLNNEWCIHAIDLPGYGFSSRCKFPFQYPKDTV---TDVHEWFHKRLN 195

Query: 216 TWFHKKGLLAHPENNLVTAHSMGAYIMCHYLNNHPSDFRKIIMCSPAGFYPASNPLT--- 272
            WF ++ LL +PENN+V AHS+GAY+M  Y + + S F+K++MCSPAG   ++       
Sbjct: 196 RWFAERNLLRNPENNIVMAHSLGAYLMALYASKNSSHFKKLVMCSPAGICESTTTKAIGN 255

Query: 273 -NIPLWYTYLWDRNYSPFSLVRISGPLGSKLTSGWSYSRF---FHSNQTISNELSLALHT 328
              P WY+ LWDRN SPFSLVR+S  LGSKLTSGWSY RF     S    S +   ALH 
Sbjct: 256 RKPPWWYSKLWDRNISPFSLVRVSSRLGSKLTSGWSYKRFGKLLRSKSRKSEQQFEALHK 315

Query: 329 YAYSIFNLPGSGEYSLSHILKAGGDPRTPLQEEFFTCQSTTNNGIRRSNVEYSWLYGQSD 388
           Y YSIFN PG GEY LS  L+ GGDPR PL++  F    T ++GI   N+E+ WLYG+ D
Sbjct: 316 YCYSIFNKPGCGEYLLSFALRCGGDPRIPLEDMLF---KTNDSGIMNGNLEWLWLYGERD 372

Query: 389 WINKTGGFKISQFLNSLNKKSNVFIAPNSGHHLYFDNYMWFNSYLAKEM 437
           W++  GG ++S+ L    +KS V I PN+GHHLYFDNY +FNS + +EM
Sbjct: 373 WMDFNGGKRVSEHLKKSGQKSEVCIVPNAGHHLYFDNYDYFNSLIIREM 421

>SAKL0B06116g Chr2 complement(519929..521224) [1296 bp, 431 aa] {ON}
           similar to uniprot|P53264 Saccharomyces cerevisiae
           YGR110W Hypothetical ORF
          Length = 431

 Score =  370 bits (949), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 201/400 (50%), Positives = 250/400 (62%), Gaps = 28/400 (7%)

Query: 45  STAPKAASLPQILRNLPRLFPRSMTDSIRDYSQFKTNPEFFQDRLLSQLSFYPSLYXXXX 104
           ST P A  L QI   LP LFP S   SIRDYS F+ N E FQ +LLS L FYPS      
Sbjct: 48  STPPTAMPLIQIATQLPNLFPLSFEASIRDYSMFQENAESFQSQLLSTLPFYPS------ 101

Query: 105 XXXXXXXXPRQGQIIKTYVN-ENEYINEFQILPNTSTPYDRLKHLILIHGYGAGLGFYIN 163
                    R  +I+KT V+ E  YINEF I P   +    +KHLI +HGYGAGLGF++ 
Sbjct: 102 -----PANGRSSEILKTPVDDEGNYINEFTIKPMNPSSSSSMKHLIFVHGYGAGLGFFLK 156

Query: 164 TLQHLSM--DNWCIHAVDLPGYGFSSRLKFP--YGTINPRIYSKKDVLDWFQKRLKTWFH 219
             +++ +  +NWCIHA+DLPGYGFSSR KFP  Y   NP +     V DWF +R+K W H
Sbjct: 157 NFENIPLLNNNWCIHAIDLPGYGFSSRPKFPFNYPEHNPIM-----VEDWFHQRIKGWLH 211

Query: 220 KKGLLAHPENNLVTAHSMGAYIMCHYLNNHPSDFRKIIMCSPAGFYPASNPLTNIPLWYT 279
           K+GLLA+P+NNL+ AHS+GAYI   Y N  P+ F K+IMCSPAG  P+       P W+ 
Sbjct: 212 KRGLLANPKNNLLVAHSLGAYISALYANKFPNHFSKLIMCSPAGICPSPKLGQAPPQWFV 271

Query: 280 YLWDRNYSPFSLVRISGPLGSKLTSGWSYSRF--FHSNQTISNELSLALHTYAYSIFNLP 337
            LWDRN SPFSLVR S  LGSKLTSGW+Y RF  F        E   A+H Y Y+IFN P
Sbjct: 272 KLWDRNISPFSLVRNSFHLGSKLTSGWTYRRFRQFLREGQRGYEQHKAMHKYTYAIFNKP 331

Query: 338 GSGEYSLSHILKAGGDPRTPLQEEFFTCQSTTNNGIRRSNVEYSWLYGQSDWINKTGGFK 397
           GSGEY LS  LK GGDPR PL++  F   S+      ++N ++ WLYG  DW++  GG +
Sbjct: 332 GSGEYLLSFALKCGGDPRLPLEKRLFDNTSSF-----KANCDWLWLYGDEDWMDLRGGQR 386

Query: 398 ISQFLNSLNKKSNVFIAPNSGHHLYFDNYMWFNSYLAKEM 437
            S+FL  +  KS+V + P++GHHLY DNY  FN+ + KEM
Sbjct: 387 ASEFLKKIGMKSDVKVVPSAGHHLYLDNYKHFNNVVIKEM 426

>Kpol_1035.9 s1035 complement(19721..21004) [1284 bp, 427 aa] {ON}
           complement(19721..21004) [1284 nt, 428 aa]
          Length = 427

 Score =  357 bits (915), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 189/401 (47%), Positives = 251/401 (62%), Gaps = 25/401 (6%)

Query: 46  TAPKAASLPQILRNLPRLFPRSMTDSIRDYSQFKTNPEFFQDRLLSQLSFYPSLYXXXXX 105
            AP A  L +I+  LP LFPR++ +S+ DY  F  + + FQ  LLS L +YP        
Sbjct: 40  AAPAAIPLYEIILKLPNLFPRTLKESLNDYHDFHKDIDKFQTELLSTLPYYP-------- 91

Query: 106 XXXXXXXPRQGQIIKTYVN-ENEYINEFQILPNTSTPYDR-LKHLILIHGYGAGLGFYIN 163
                   ++ ++I T V+ E  YINEF I P  +    R LKHLI IHGYGAGLGF++ 
Sbjct: 92  ---MANDGKKAELITTKVDDEGNYINEFCISPIGAEADQRDLKHLIFIHGYGAGLGFFLK 148

Query: 164 TLQHLSM--DNWCIHAVDLPGYGFSSRLKFPYGTINPRIYSKKDVLDWFQKRLKTWFHKK 221
             +HL +  + WCIHA+DLPGYG+S R +FP+      I    DV DWF KR++TWF  +
Sbjct: 149 NFEHLPLLDNKWCIHAIDLPGYGYSKRCEFPFKYPEHDI---SDVQDWFHKRIRTWFKAR 205

Query: 222 GLLAHPENNLVTAHSMGAYIMCHYLNNHPSDFRKIIMCSPAGFYPA--SNPLTNI--PLW 277
            LL  PENN++ AHS+GAY+M  Y++  P+DF+KI+MCSPAG   +  S  + NI  P W
Sbjct: 206 SLLTTPENNMIMAHSLGAYLMALYIDKFPNDFKKIVMCSPAGICQSSTSEEIGNIKTPWW 265

Query: 278 YTYLWDRNYSPFSLVRISGPLGSKLTSGWSYSRFFHSNQTISNELSLALHTYAYSIFNLP 337
           +  LWD+N SPF+LVR +  LGSKLTSGWSY RF    Q+        LH YAYSIFN  
Sbjct: 266 FNKLWDQNVSPFTLVRNTYYLGSKLTSGWSYRRFKQLKQSGHLMQFEKLHRYAYSIFNQK 325

Query: 338 GSGEYSLSHILKAGGDPRTPLQEEFFTCQSTTNNGIRRSNVEYSWLYGQSDWINKTGGFK 397
           GSGEY L   LK GGDPR PL++  F  +S    GI +S+ E+ W+YG+ DW++  GG +
Sbjct: 326 GSGEYILGFALKCGGDPRIPLEDNLF--KSPKTEGIPKSDCEWLWVYGEKDWMDIGGGKR 383

Query: 398 IS-QFLNSLNKKSNVFIAPNSGHHLYFDNYMWFNSYLAKEM 437
           ++ + +    KKS+  + P+SGHHLYFDNY +FN  L KEM
Sbjct: 384 VTDELVTRFGKKSSTTVVPDSGHHLYFDNYKFFNELLVKEM 424

>ABL019W Chr2 (361560..362855) [1296 bp, 431 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YGR110W
          Length = 431

 Score =  356 bits (913), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 193/405 (47%), Positives = 250/405 (61%), Gaps = 25/405 (6%)

Query: 41  TLKPSTAPKAASLPQILRNLPRLFPRSMTDSIRDYSQFKTNPEFFQDRLLSQLSFYPSLY 100
           T++  T P A  L +I+RNLP LFP   + S  DY  FK++ E FQ  LLS L F+    
Sbjct: 38  TVRKPTPPTAVPLYEIIRNLPNLFPLPTSQSWEDYKAFKSDREAFQVGLLSTLPFF---- 93

Query: 101 XXXXXXXXXXXXPRQGQIIKTYVN-ENEYINEFQILPNTSTPYD--RLKHLILIHGYGAG 157
                        + G+II+T V+ E  YINEF I P +          HLI IHGYGAG
Sbjct: 94  -------ERAREGKIGKIIRTPVDDEGNYINEFCIRPASMEENHGAATNHLIFIHGYGAG 146

Query: 158 LGFYINTLQHLSM--DNWCIHAVDLPGYGFSSRLKFPYGTINPRIYSKKDVLDWFQKRLK 215
           LGF+I   +HL +  D W IHA+DLPGYG+S+R +FP+       +S ++V  WF +RL+
Sbjct: 147 LGFFIKNFEHLPLLDDQWVIHAIDLPGYGYSTRCQFPFDV---NTHSVREVEAWFHERLE 203

Query: 216 TWFHKKGLLAHPENNLVTAHSMGAYIMCHYLNNHPSDFRKIIMCSPAGFYPASNPLTNIP 275
           TW  K+GLL  P  N+V AHSMGAY+  HY  +  + F+K+IMCSPAG  P+ +     P
Sbjct: 204 TWLSKRGLLQAPHRNMVMAHSMGAYLTAHYAQSRQNHFKKLIMCSPAGISPSKSMKKQPP 263

Query: 276 LWYTYLWDRNYSPFSLVRISGPLGSKLTSGWSYSRFFH--SNQTISNELSLALHTYAYSI 333
            W+  LWDRN SPFSLVR SGPLGSKLTSGWS+ RF H  +   I      ALH Y+Y+I
Sbjct: 264 WWFIKLWDRNVSPFSLVRNSGPLGSKLTSGWSFRRFRHLLNEGEIGMRQFEALHKYSYAI 323

Query: 334 FNLPGSGEYSLSHILKAGGDPRTPLQEEFFTCQSTTNNGIRRSNVEYSWLYGQSDWINKT 393
           FN+PGSGEY LS +LK GGDPR PL    F+ +    +G  ++  E+ WLYG   W++K 
Sbjct: 324 FNMPGSGEYLLSFVLKCGGDPRIPLLGSMFSPEK--EHGF-KAQCEWLWLYGDHVWMDKE 380

Query: 394 GGFKISQFL-NSLNKKSNVFIAPNSGHHLYFDNYMWFNSYLAKEM 437
           GG + S ++ + +  KS V I PNSGHHLYFDNY +FN  L +EM
Sbjct: 381 GGQRASSYITDRIGGKSRVEIVPNSGHHLYFDNYSYFNKILLREM 425

>KLTH0E13948g Chr5 complement(1231122..1232438) [1317 bp, 438 aa]
           {ON} similar to uniprot|P53264 Saccharomyces cerevisiae
           YGR110W Hypothetical ORF
          Length = 438

 Score =  355 bits (911), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 194/409 (47%), Positives = 253/409 (61%), Gaps = 27/409 (6%)

Query: 41  TLKPSTAPKAASLPQILRNLPRLFPRSMTDSIRDYSQFKTNPEFFQDRLLSQLSFYPSLY 100
           T +PS+ P A  L +++ NLPRLFPRSM +S+RDY  F+ +    Q +LLS L F+P   
Sbjct: 48  TCRPSS-PSAIPLRELVINLPRLFPRSMKESVRDYFAFRKDAGTLQHQLLSTLPFFP--- 103

Query: 101 XXXXXXXXXXXXPRQGQIIKTYVNENE-YINEFQILPNTSTPYDRLKHLILIHGYGAGLG 159
                        +  ++++T V+E   YINEF + P    P   L+HLI++HGYGAGLG
Sbjct: 104 --------VAGDDKVAEVVQTPVDEQANYINEFCVRPAMPHPSGTLRHLIIVHGYGAGLG 155

Query: 160 FYINTLQHLSM-DN-WCIHAVDLPGYGFSSRLKFPYGTINPRIYSKKDVLDWFQKRLKTW 217
           F++  L+ L++ DN W IHA+DLPGYGFSSR KFPY     +      V  WF  R KTW
Sbjct: 156 FFLKNLEKLNLIDNRWVIHAIDLPGYGFSSRPKFPYKY---KSDPAAQVEHWFHARFKTW 212

Query: 218 FHKKGLLAHPENNLVTAHSMGAYIMCHYLNNHPSDFRKIIMCSPAGFY--PASNPLTNIP 275
             K+GLL HPE N++ AHSMGAY+   Y N +P+ F+K++MCSPAG    P++      P
Sbjct: 213 LEKRGLLQHPEQNMLVAHSMGAYLAALYANKYPNHFKKLVMCSPAGICNTPSNKQRRLPP 272

Query: 276 LWYTYLWDRNYSPFSLVRISGPLGSKLTSGWSYSRFFH--SNQTISNELSLALHTYAYSI 333
            W+  LWDRN SPFSLVR S  LGSKLTSGWSY RF    S      +   A+H YAY+I
Sbjct: 273 WWFAKLWDRNISPFSLVRNSRLLGSKLTSGWSYRRFGQLLSEGYRGAQQFEAIHKYAYAI 332

Query: 334 FNLPGSGEYSLSHILKAGGDPRTPLQEEFFTCQSTTNNGIRRSNVEYSWLYGQSDWINKT 393
           FN PGSGEY LS  LK GGDPR  L+   F  +        ++  E+ WLYG  DW++  
Sbjct: 333 FNSPGSGEYLLSFALKCGGDPRDALERRLFHNKMNQF----KAKCEWLWLYGDQDWMDVG 388

Query: 394 GGFKISQFLN-SLNKKSNVFIAPNSGHHLYFDNYMWFNSYLAKEMTLFN 441
           GG ++S FLN ++ KKS V +  +SGHHLYFDNY  FN  L KEM +++
Sbjct: 389 GGRRVSHFLNTAMGKKSKVEVVHDSGHHLYFDNYEQFNRILEKEMKMWD 437

>Skud_7.415 Chr7 (692655..694013) [1359 bp, 452 aa] {ON} YGR110W
           (REAL)
          Length = 452

 Score =  355 bits (912), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 190/413 (46%), Positives = 259/413 (62%), Gaps = 33/413 (7%)

Query: 42  LKPSTAPKAASLPQILRNLPRLFPRSMTDSIRDYSQFKTNPEFFQDRLLSQLSFYPSLYX 101
           L+  +AP A  L +I+  +P LFPR + DS++D+  F  N + FQ  LL  L FYP+   
Sbjct: 52  LRTPSAPTAIPLREIIYKVPGLFPRPLEDSVKDFRDFTKNEDVFQTELLETLPFYPNPSK 111

Query: 102 XXXXXXXXXXXPRQGQIIKTYVNEN-EYINEFQILPNT-STPYDRLKHLILIHGYGAGLG 159
                       ++ ++IKT V+++  YINEF I P   S P   LKHL+ IHGYGAGLG
Sbjct: 112 Y-----------KKSKLIKTVVDDDGNYINEFCIYPQKPSVPETELKHLVFIHGYGAGLG 160

Query: 160 FYINTLQHLSM--DNWCIHAVDLPGYGFSSRLKFPYGTINPRIYSKKDVLDWFQKRLKTW 217
           F+I  L+ + +  + WCIHA+DLPGYGFSSR KFP+      +++   V DWF +R+ TW
Sbjct: 161 FFIKNLEDIPLLDNEWCIHAIDLPGYGFSSRPKFPFEYPKDNLHT---VQDWFHERIHTW 217

Query: 218 FHKKGLLAHPENNLVTAHSMGAYIMCHYLNNHPSD--FRKIIMCSPAGF--YPASNPLTN 273
           F+K+ LL  P+ N+V AHS+G+Y+M  YL  +     F+K+++CSPAG       N    
Sbjct: 218 FNKRNLLHKPDKNIVVAHSLGSYLMALYLQKYKESPSFKKLVLCSPAGVSNRDFDNTTAE 277

Query: 274 I------PLWYTYLWDRNYSPFSLVRISGPLGSKLTSGWSYSRFFH--SNQTISNELSLA 325
           +      P WY  LWDRN SPF+LVR +  LGSK+TSGWSY RF H  +     +    A
Sbjct: 278 VGKWKPPPWWYVKLWDRNISPFTLVRNARQLGSKITSGWSYRRFKHILNGDPGQSRRFEA 337

Query: 326 LHTYAYSIFNLPGSGEYSLSHILKAGGDPRTPLQEEFFTCQSTTNNGIRRSNVEYSWLYG 385
           LH YAYSIFN  GSGEY LS  L+ GG+PR PL+E+ F  +++    ++ SN E+ WLYG
Sbjct: 338 LHRYAYSIFNKRGSGEYLLSFALRCGGEPRLPLEEQLFNGENS--KVLKNSNYEWVWLYG 395

Query: 386 QSDWINKTGGFKISQFLNS-LNKKSNVFIAPNSGHHLYFDNYMWFNSYLAKEM 437
             DW++  GG ++S++LN  L +KSNVFI P++GHHLY DNY +FN  L KEM
Sbjct: 396 NDDWMDVDGGLRVSKYLNEKLGQKSNVFIVPHAGHHLYLDNYTFFNKILVKEM 448

>Smik_6.200 Chr6 (329969..331306) [1338 bp, 445 aa] {ON} YGR110W
           (REAL)
          Length = 445

 Score =  353 bits (907), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 195/409 (47%), Positives = 257/409 (62%), Gaps = 33/409 (8%)

Query: 46  TAPKAASLPQILRNLPRLFPRSMTDSIRDYSQFKTNPEFFQDRLLSQLSFYPSLYXXXXX 105
           +AP A  L +I+  +P LFPR + DS++D+  F  + + FQ  LL  L FYP+       
Sbjct: 50  SAPTAIPLREIIYKVPGLFPRPVGDSVKDFRDFIKSEDVFQTELLKTLPFYPN------- 102

Query: 106 XXXXXXXPRQGQIIKTYVNEN-EYINEFQILP-NTSTPYDRLKHLILIHGYGAGLGFYIN 163
                   ++ ++I+T V+++  YINEF I P N S P   LKHLI IHGYGAGLGF+I 
Sbjct: 103 ----PSKLKKSRVIRTVVDDDGNYINEFCIRPINPSVPETELKHLIFIHGYGAGLGFFIK 158

Query: 164 TLQHLSMDN--WCIHAVDLPGYGFSSRLKFPYGTINPRIYSKKDVLDWFQKRLKTWFHKK 221
             + + + N  WC+HA+DLPGYGFSSR KFP+      ++   DV DWF KRL TWF+K+
Sbjct: 159 NFEDIPLLNNEWCVHAIDLPGYGFSSRPKFPFEYPRDNLH---DVQDWFHKRLHTWFNKR 215

Query: 222 GLLAHPENNLVTAHSMGAYIMCHYLNNHPS--DFRKIIMCSPAGF-YPASNPLTNI---- 274
            LL  P+ N+V AHS+G+Y+M  Y+  +     F+K+I+CSPAG  +  SN  T+     
Sbjct: 216 NLLNKPDKNVVMAHSLGSYLMALYVQKYKERPSFKKLILCSPAGVSHRDSNNTTSEAEKW 275

Query: 275 ---PLWYTYLWDRNYSPFSLVRISGPLGSKLTSGWSYSRFFH--SNQTISNELSLALHTY 329
              P WY  LWDRN SPF+LVR S   GSK+TSGWSY RF H  +     +    ALH Y
Sbjct: 276 KPPPWWYVKLWDRNISPFTLVRNSRQFGSKITSGWSYRRFKHILNGDLKQSSRFEALHRY 335

Query: 330 AYSIFNLPGSGEYSLSHILKAGGDPRTPLQEEFFTCQSTTNNGIRRSNVEYSWLYGQSDW 389
           AYSIFN  GSGEY LS  LK GG+PR PL+E+ F  ++   N +R SN E+ WLYG  DW
Sbjct: 336 AYSIFNKRGSGEYLLSFALKCGGEPRLPLEEQLFNDRNL--NILRSSNYEWLWLYGDDDW 393

Query: 390 INKTGGFKISQFLNS-LNKKSNVFIAPNSGHHLYFDNYMWFNSYLAKEM 437
           ++  GG ++S+FLN  L +KSNV I P++GHHLY DN  +FN  L KEM
Sbjct: 394 MDVNGGIRVSKFLNEKLRQKSNVIIVPHAGHHLYLDNSKFFNDILVKEM 442

>KNAG0B00950 Chr2 (173167..174423) [1257 bp, 418 aa] {ON} Anc_3.454
           YGR110W
          Length = 418

 Score =  350 bits (899), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 191/408 (46%), Positives = 251/408 (61%), Gaps = 39/408 (9%)

Query: 42  LKPSTAPKAASLPQILRNLPRLFPRSMTDSIRDYSQFKTNPEFFQDRLLSQLSFYPSLYX 101
           +K  TAP A  L +I+  LP LFPR +  S+ DY  F  N +  Q  LLS L F+P    
Sbjct: 37  VKTPTAPTAIPLTEIIVKLPYLFPRGVAQSLEDYKVFSNNADKIQYDLLSTLPFFPE--- 93

Query: 102 XXXXXXXXXXXPRQGQIIKTYVNENE-YINEFQILPNTSTPYDRLKHLILIHGYGAGLGF 160
                       ++ +I++T ++E++ +INEF I P   T   +LKHLI IHGYGAGLGF
Sbjct: 94  --------AKDGKRAEIVRTKIDEDDNFINEFFIQPANVTEPSKLKHLIFIHGYGAGLGF 145

Query: 161 YINTLQHLSM--DNWCIHAVDLPGYGFSSRLKFPYGTINPRIYSKKDVLD---WFQKRLK 215
           ++   +++ +  ++WCIHA+DLPG+GFSSR KFP+       Y + DV     WF +RLK
Sbjct: 146 FLKNFENIQLKDNSWCIHAIDLPGFGFSSRTKFPFK------YPEDDVSKVQTWFHERLK 199

Query: 216 TWFHKKGLLAHPENNLVTAHSMGAYIMCHYLNNHPSDFRKIIMCSPAGFYPASNPLTNIP 275
            WF K+ LL +P NN+V AHS+GAY+M  Y  N+P  F+K+IMCSPAG   ++      P
Sbjct: 200 IWFEKRDLLKNPGNNMVVAHSLGAYLMALYKRNNPLHFKKLIMCSPAGMCNSTVVKKQPP 259

Query: 276 LWYTYLWDRNYSPFSLVRISGPLGSKLTSGWSYSRF--FHSNQTISNELSLALHTYAYSI 333
            WY  LWD N SPFSLVR SG LGSKLTSGWSY RF   HS     N     LH Y+Y+I
Sbjct: 260 WWYAALWDMNLSPFSLVRNSGWLGSKLTSGWSYRRFRSLHSKIQFEN-----LHLYSYAI 314

Query: 334 FNLPGSGEYSLSHILKAGGDPRTPLQEEFFTCQSTTNNGIRR--SNVEYSWLYGQSDWIN 391
           FN PG GEY L+  L+ GGDPR  L+   F      N+ + +  S+ E+ WLYG  DW++
Sbjct: 315 FNRPGCGEYLLAFALRCGGDPRVSLEATLF------NDVVNKWDSDSEWVWLYGDRDWMD 368

Query: 392 KTGGFKISQFLNSL-NKKSNVFIAPNSGHHLYFDNYMWFNSYLAKEMT 438
             GG +ISQ +N +   KS+V + PN+GHHLYFDN   FN+ L KEMT
Sbjct: 369 VKGGRRISQKINEIFPGKSSVEVIPNAGHHLYFDNISCFNAILEKEMT 416

>YGR110W Chr7 (713709..715046) [1338 bp, 445 aa] {ON}
           CLD1Mitochondrial cardiolipin-specific phospholipase;
           functions upstream of Taz1p to generate
           monolyso-cardiolipin; transcription increases upon
           genotoxic stress; involved in restricting Ty1
           transposition; has homology to mammalian CGI-58
          Length = 445

 Score =  351 bits (900), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 191/413 (46%), Positives = 257/413 (62%), Gaps = 33/413 (7%)

Query: 42  LKPSTAPKAASLPQILRNLPRLFPRSMTDSIRDYSQFKTNPEFFQDRLLSQLSFYPSLYX 101
           L+  +AP A  L +I+  +P LFPR + DS++D+  F  N + FQ  LL  L FYP+   
Sbjct: 46  LRTPSAPTAIPLREIIYRVPSLFPRPLEDSVKDFRDFIKNEDAFQTELLKTLPFYPT--- 102

Query: 102 XXXXXXXXXXXPRQGQIIKTYVN-ENEYINEFQILP-NTSTPYDRLKHLILIHGYGAGLG 159
                       +  ++I+T V+ E  YINEF I P  TS P   LKHL+ IHGYGAGLG
Sbjct: 103 --------PSESKTARLIRTVVDDEGNYINEFCIRPRKTSVPEADLKHLVFIHGYGAGLG 154

Query: 160 FYINTLQHLSM--DNWCIHAVDLPGYGFSSRLKFPYGTINPRIYSKKDVLDWFQKRLKTW 217
           F+I   + + +  + WCIHA+DLPGYGFSSR KFP+      I+S   V DWF +R+ TW
Sbjct: 155 FFIKNFEDIPLLDNEWCIHAIDLPGYGFSSRPKFPFEYPRDNIHS---VQDWFHERIHTW 211

Query: 218 FHKKGLLAHPENNLVTAHSMGAYIMCHYLNNHPSD--FRKIIMCSPAG--FYPASNPLTN 273
           F K+ LL  PE N+V AHS+G+Y+M  YL  +     F+K+I+CSPAG  +   +N  + 
Sbjct: 212 FSKRNLLNRPEKNIVMAHSLGSYLMALYLQKYKESPSFKKLILCSPAGVSYRDFNNTASE 271

Query: 274 I------PLWYTYLWDRNYSPFSLVRISGPLGSKLTSGWSYSRFFH--SNQTISNELSLA 325
           +      P WY  LWDRN SPF+LVR    LGSK+TSGWSY RF H  +     ++   A
Sbjct: 272 VEKWKPPPWWYVKLWDRNISPFTLVRNFRQLGSKITSGWSYRRFKHILNGDPEQSKRFEA 331

Query: 326 LHTYAYSIFNLPGSGEYSLSHILKAGGDPRTPLQEEFFTCQSTTNNGIRRSNVEYSWLYG 385
           LH YAY+IFN  GSGEY LS  LK GG+PR  L+++ F  + +  + ++ SN ++ WLYG
Sbjct: 332 LHRYAYAIFNKRGSGEYLLSFALKCGGEPRLSLEQQLFDGKKS--DILKNSNCDWLWLYG 389

Query: 386 QSDWINKTGGFKISQFLNS-LNKKSNVFIAPNSGHHLYFDNYMWFNSYLAKEM 437
             DW++  GG ++S+FL   L +KSNV I P+SGHHLY DNY +FN+ L KEM
Sbjct: 390 DDDWMDVNGGLRVSRFLKEKLKQKSNVIIVPHSGHHLYLDNYKFFNNILTKEM 442

>TPHA0O01310 Chr15 complement(258745..260061) [1317 bp, 438 aa] {ON}
           
          Length = 438

 Score =  350 bits (899), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 184/397 (46%), Positives = 249/397 (62%), Gaps = 33/397 (8%)

Query: 52  SLPQILRNLPRLFPRSMTDSIRDYSQFKTNPEFFQDRLLSQLSFYPSLYXXXXXXXXXXX 111
           SL ++++  PRLFPRS   S +DY QF ++ E FQ RLL  L ++P              
Sbjct: 60  SLFELIKQFPRLFPRSFMKSFQDYKQFHSDVENFQVRLLETLPYFPD------------- 106

Query: 112 XPRQG---QIIKTYVN-ENEYINEFQILP-NTSTPYDRLKHLILIHGYGAGLGFYINTLQ 166
            P  G   +I  T V+ E   INEF + P N S P ++LKHLI +HGYGAGLGF++  L+
Sbjct: 107 -PSNGIYSKITNTIVDDEGSSINEFVVYPSNISVPSEKLKHLIFVHGYGAGLGFFLKNLE 165

Query: 167 HLSM--DNWCIHAVDLPGYGFSSRLKFPYGTINPRIYSKKDVLDWFQKRLKTWFHKKGLL 224
           ++ +  D WC+HA+DLPGYGFS+R KFP+     R      V +WF  R++ W H++ LL
Sbjct: 166 NIKLLNDEWCVHAIDLPGYGFSTRAKFPFQVGKHR---HDQVNEWFHSRIRNWMHQRNLL 222

Query: 225 AHPENNLVTAHSMGAYIMCHYLNNHPSDFRKIIMCSPAGFYPASNPLTNIPL-WYTYLWD 283
            H +NN + AHS+GAY+M  Y++ HP+D +KI+MCSPAG   + N     P  W+  LW+
Sbjct: 223 QHSQNNFLIAHSLGAYLMALYVDKHPNDLQKILMCSPAGIGDSMNLKKKTPAWWFEKLWE 282

Query: 284 RNYSPFSLVRISGPLGSKLTSGWSYSRFFHSNQTISNELSL--ALHTYAYSIFNLPGSGE 341
           RN SPF+LVR S  +GSKLTSGW+Y RF  S+    N L    ALH Y YSIFN  GSGE
Sbjct: 283 RNISPFTLVRSSSYIGSKLTSGWTYRRF--SSLLSQNNLKQFEALHKYTYSIFNQRGSGE 340

Query: 342 YSLSHILKAGGDPRTPLQEEFFTCQSTTNNGIRRSNVEYSWLYGQSDWINKTGGFKISQF 401
           Y L+  LK GG PR PL++  F      + GI +S+ E+ W YG +DW++K GG ++S+ 
Sbjct: 341 YLLNFALKCGGGPRYPLEKTLFM---NNDKGISKSSTEWIWAYGDNDWMDKNGGIRVSEI 397

Query: 402 L-NSLNKKSNVFIAPNSGHHLYFDNYMWFNSYLAKEM 437
           L   L K+S V+I P +GHHLYFDN+ +FN  + KEM
Sbjct: 398 LTKQLKKRSEVYIVPRAGHHLYFDNHQFFNDLILKEM 434

>ZYRO0C06270g Chr3 (475283..476575) [1293 bp, 430 aa] {ON} similar
           to uniprot|P53264 Saccharomyces cerevisiae YGR110W
           Hypothetical ORF
          Length = 430

 Score =  349 bits (896), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 189/406 (46%), Positives = 252/406 (62%), Gaps = 31/406 (7%)

Query: 46  TAPKAASLPQILRNLPRLFPRSMTDSIRDYSQFKTNPEFFQDRLLSQLSFYPSLYXXXXX 105
            AP A  L +I+  LP+LFPRS+  S RDY  F  +    Q+ LL  L FYP        
Sbjct: 39  AAPTAIPLHKIIMRLPKLFPRSVDASTRDYKDFCYHTGQLQEELLRTLPFYP-------- 90

Query: 106 XXXXXXXPRQGQIIKTYVNEN-EYINEFQILP-NTSTPYDRLKHLILIHGYGAGLGFYIN 163
                   ++ +++KT V++   YINEF I P   S P  ++KHLI IHGYGAGLGF++ 
Sbjct: 91  ---YCAESKKAEVVKTTVDDQGNYINEFCITPVKPSVPSHKMKHLICIHGYGAGLGFFLK 147

Query: 164 TLQHLSM--DNWCIHAVDLPGYGFSSRLKFPYGTINPRIYSKKDVLDWFQKRLKTWFHKK 221
            L+ + +  ++W IHA+DLPGYGFSSR KFP+        S   V  WF  R+ TWF K+
Sbjct: 148 NLEGIPLLDNSWVIHAIDLPGYGFSSRPKFPFKYPKD---SLSQVHSWFHDRIHTWFKKR 204

Query: 222 GLLAHPENNLVTAHSMGAYIMCHYLNNHPSDFRKIIMCSPAGFYPASNPL----TNIPLW 277
           GLL + +NNLV AHS+GAY+M  Y   + + F+K++MCSPAG   ++       T  P W
Sbjct: 205 GLLVNSQNNLVMAHSLGAYLMALYTTKYTTHFKKLVMCSPAGVCKSTTAKNIGNTTPPWW 264

Query: 278 YTYLWDRNYSPFSLVRISGPLGSKLTSGWSYSRF-----FHSNQTISNELSLALHTYAYS 332
           YT LWD N SPF LVR +  LGS +TSGWSY RF      +SN  +      ALH YAY+
Sbjct: 265 YTKLWDLNISPFCLVRNAAALGSMVTSGWSYRRFNKLLQSNSNTNLDRLQFEALHRYAYA 324

Query: 333 IFNLPGSGEYSLSHILKAGGDPRTPLQEEFFTCQSTTNNGIRRSNVEYSWLYGQSDWINK 392
           IFN  GSGEY LS  L  GGDPR PL++  F  +++   GI RSN E+ W+YG+ DW++ 
Sbjct: 325 IFNRRGSGEYLLSFALSCGGDPRLPLEDTIFKDKTS---GIFRSNCEWIWIYGERDWMDV 381

Query: 393 TGGFKISQFL-NSLNKKSNVFIAPNSGHHLYFDNYMWFNSYLAKEM 437
            GG ++S+F+ N   +KS V +APNSGHHLYFDN+ +FNS++ K+M
Sbjct: 382 NGGERVSRFIENQGGRKSQVHVAPNSGHHLYFDNHKFFNSFIVKQM 427

>KAFR0I01970 Chr9 (401907..403142) [1236 bp, 411 aa] {ON} 
          Length = 411

 Score =  348 bits (893), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 183/403 (45%), Positives = 251/403 (62%), Gaps = 35/403 (8%)

Query: 45  STAPKAASLPQILRNLPRLFPRSMTDSIRDYSQFKTNPEFFQDRLLSQLSFYPSLYXXXX 104
           S+AP A  L +I+  LPRLFPRS+ +S +DY  +K  PE  Q+ LLS L FYP++     
Sbjct: 31  SSAPVAIPLVKIIAQLPRLFPRSIDESFKDYRVYKEGPERMQEDLLSTLPFYPNV----- 85

Query: 105 XXXXXXXXPRQGQIIKTYVNEN-EYINEFQILPNTSTPYDRLKHLILIHGYGAGLGFYIN 163
                    +  +IIKT V+E   YINEF I P  +    +LKHLI IHGYGAG GF++ 
Sbjct: 86  ------SKDKVARIIKTVVDEEGNYINEFCITPKNTVNSQKLKHLIFIHGYGAGFGFFLK 139

Query: 164 TLQHLSM--DNWCIHAVDLPGYGFSSRLKFP--YGTINPRIYSKKDVLDWFQKRLKTWFH 219
            L+ + +  +NWCIHA+DLPG+GFSSR  FP  Y T N       +V  WF +R++ W  
Sbjct: 140 NLESIPLLDNNWCIHAIDLPGFGFSSRKNFPFKYPTSN-----TSEVTAWFHERIRRWLE 194

Query: 220 KKGLLAHPENNLVTAHSMGAYIMCHYLNNHPSDFRKIIMCSPAGFYPASN---PLTNIPL 276
           ++ LL +P+NN++ AHS+GAY+M  Y   +P+  RK+IMCSPAG   + N    +   P 
Sbjct: 195 ERTLLDNPKNNVIVAHSLGAYLMALYTQVYPAHLRKLIMCSPAGVSKSQNNSKAVLQPPW 254

Query: 277 WYTYLWDRNYSPFSLVRISGPLGSKLTSGWSYSRFFHSNQTISNELSLA-LHTYAYSIFN 335
           WY  LWD N SPF+LVR+S  LGSKLTSGWSY RF    + I N +    LH Y+Y+IFN
Sbjct: 255 WYAKLWDMNLSPFTLVRLSKHLGSKLTSGWSYRRF----KLIENRMQFEMLHRYSYAIFN 310

Query: 336 LPGSGEYSLSHILKAGGDPRTPLQEEFFTCQSTTNNGIRRSNVEYSWLYGQSDWINKTGG 395
            PGSGEY L  IL+ GG+PR  L++  F     +NN    S VE++W+YG++DW++  GG
Sbjct: 311 QPGSGEYLLGFILECGGNPRCSLEDTLF-----SNNFNVSSKVEWAWIYGENDWMDIEGG 365

Query: 396 FKISQ-FLNSLNKKSNVFIAPNSGHHLYFDNYMWFNSYLAKEM 437
            ++    L   N+ S  ++ PN+GHHLY DN  +FN+ + + M
Sbjct: 366 RRVHNLLLEKFNRDSKFYMVPNAGHHLYLDNIRYFNNIIVQHM 408

>Suva_7.395 Chr7 (684763..686118) [1356 bp, 451 aa] {ON} YGR110W
           (REAL)
          Length = 451

 Score =  346 bits (888), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 187/413 (45%), Positives = 255/413 (61%), Gaps = 33/413 (7%)

Query: 42  LKPSTAPKAASLPQILRNLPRLFPRSMTDSIRDYSQFKTNPEFFQDRLLSQLSFYPSLYX 101
           L+  +AP A  L +I+  +P LFPR + DS++D+  F  N + FQ  LL+ L FYP+   
Sbjct: 52  LRTPSAPTAIPLREIIYKVPGLFPRPLEDSVKDFRDFIKNEDSFQTELLATLPFYPN--- 108

Query: 102 XXXXXXXXXXXPRQGQIIKTYVNEN-EYINEFQILPNT-STPYDRLKHLILIHGYGAGLG 159
                       ++ ++IKT V+++  YINEF I P   S P   LKHL+ IHGYGAGLG
Sbjct: 109 --------PSTTKKSKLIKTIVDDDGNYINEFCIYPQVPSVPEADLKHLVFIHGYGAGLG 160

Query: 160 FYINTLQHLSMDN--WCIHAVDLPGYGFSSRLKFPYGTINPRIYSKKDVLDWFQKRLKTW 217
           F+I   + + + N  WC+HA+DLPGYGFSSR KFP+      I+S   V DWF +R+ TW
Sbjct: 161 FFIKNFEDIPLLNNEWCVHAIDLPGYGFSSRPKFPFKYPRDDIHS---VQDWFHERIHTW 217

Query: 218 FHKKGLLAHPENNLVTAHSMGAYIMCHYLNNHPSD--FRKIIMCSPAGF----YPASNPL 271
           F K+ LL  PE N+V AHS+G+Y+M  YL  +     F+K+I+CSPAG     + + N  
Sbjct: 218 FEKRNLLNKPEKNIVMAHSLGSYLMALYLQKYEGSPSFKKLILCSPAGVSHRDFDSGNSD 277

Query: 272 TNI----PLWYTYLWDRNYSPFSLVRISGPLGSKLTSGWSYSRFFH--SNQTISNELSLA 325
                  P WY  LWD+N SPF+LVR S   GSK+TSGWSY RF H  +     ++   A
Sbjct: 278 VEKWKPPPWWYVKLWDKNISPFTLVRNSRQFGSKITSGWSYRRFKHILNGDPDQSKRFEA 337

Query: 326 LHTYAYSIFNLPGSGEYSLSHILKAGGDPRTPLQEEFFTCQSTTNNGIRRSNVEYSWLYG 385
           LH YAYSIFN  GSGEY LS  LK GG+PR PL+E+ F  ++   N ++ +  E+ WLYG
Sbjct: 338 LHRYAYSIFNKRGSGEYLLSFALKCGGEPRLPLEEQLFNGKNA--NVLKNAKYEWVWLYG 395

Query: 386 QSDWINKTGGFKISQFLNS-LNKKSNVFIAPNSGHHLYFDNYMWFNSYLAKEM 437
             DW++  GG ++S+ LN  L +KS+V   PN+GHHLY DN+ +FN+ +  EM
Sbjct: 396 DDDWMDVNGGLRVSKLLNDKLKQKSSVITVPNAGHHLYLDNHKFFNTIIMNEM 448

>Kwal_27.12317 s27 complement(1173365..1174672) [1308 bp, 435 aa]
           {ON} YGR110W - Hypothetical ORF [contig 20] FULL
          Length = 435

 Score =  345 bits (884), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 186/404 (46%), Positives = 244/404 (60%), Gaps = 29/404 (7%)

Query: 43  KPSTAPKAASLPQILRNLPRLFPRSMTDSIRDYSQFKTNPEFFQDRLLSQLSFYPSLYXX 102
           KPS+ P A  L +I+  LP LFPRS+  S RD+  FK N    Q  LL+ L F+P+    
Sbjct: 50  KPSS-PSAIPLNEIILKLPNLFPRSLEQSARDFKDFKLNAGALQSELLATLPFFPA---- 104

Query: 103 XXXXXXXXXXPRQGQIIKTYVN-ENEYINEFQILPNTSTPYDRLKHLILIHGYGAGLGFY 161
                      R  +II+T V+ +  YINEF I P        +KHLIL+HGYGAGLGF+
Sbjct: 105 -------GDSRRTAEIIRTTVDAQGNYINEFNIRPTAVDTSKTMKHLILVHGYGAGLGFF 157

Query: 162 INTLQHLSM--DNWCIHAVDLPGYGFSSRLKFPYGTINPRIYSKKDVLDWFQKRLKTWFH 219
           + T ++L++  +NW IHA+DLPGYGFSSR  FP+   +    +   V  WF  R   W  
Sbjct: 158 LKTFENLNLINENWMIHAIDLPGYGFSSRPPFPFKVGDS---TPAQVEQWFHSRFHRWME 214

Query: 220 KKGLLAHPENNLVTAHSMGAYIMCHYLNNHPSDFRKIIMCSPAGFYPASNPLTNI--PLW 277
           ++GLL  PENN+V AHSMGAY+   Y N HP  F+K++MCSPAG   ++  +     P W
Sbjct: 215 RRGLLETPENNMVVAHSMGAYLTALYANKHPGHFKKLVMCSPAGVCHSAPEMRKRPPPWW 274

Query: 278 YTYLWDRNYSPFSLVRISGPLGSKLTSGWSYSRFFH--SNQTISNELSLALHTYAYSIFN 335
           +  LWD+N SPFSLVR +  LGSKLTSGWSY R      ++ ++     ALH YAY+IFN
Sbjct: 275 FAKLWDKNISPFSLVRNANVLGSKLTSGWSYRRLGQLLKDKVLNARQHEALHRYAYAIFN 334

Query: 336 LPGSGEYSLSHILKAGGDPRTPLQEEFFTCQSTTNNGIR-RSNVEYSWLYGQSDWINKTG 394
             GSGEY LS  L+ GG+PR PL+   F      N G + ++N E+ WLYG  DWI++ G
Sbjct: 335 RKGSGEYLLSFALQCGGEPRVPLERRLF-----HNRGQQFKANCEWLWLYGDQDWIDRRG 389

Query: 395 GFKISQFLNS-LNKKSNVFIAPNSGHHLYFDNYMWFNSYLAKEM 437
           G ++SQFL + +  +S V I  NSGHHLY DN+  FN  L  EM
Sbjct: 390 GERVSQFLTAEMGHESCVKIVKNSGHHLYLDNHRMFNKILEDEM 433

>Ecym_2465 Chr2 complement(908173..909489) [1317 bp, 438 aa] {ON}
           similar to Ashbya gossypii ABL019W
          Length = 438

 Score =  343 bits (879), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 187/402 (46%), Positives = 246/402 (61%), Gaps = 26/402 (6%)

Query: 46  TAPKAASLPQILRNLPRLFPRSMTDSIRDYSQFKTNPEFFQDRLLSQLSFYPSLYXXXXX 105
           T P A  L +IL N+P LFP  + +S +DY  F  + + FQ  LLS L F+PS       
Sbjct: 44  TPPTAIPLMEILLNIPSLFPMPLKESWKDYKIFHDDVDKFQTGLLSTLPFFPS------- 96

Query: 106 XXXXXXXPRQGQIIKTYVNEN-EYINEFQILPNTS--TPYD-RLKHLILIHGYGAGLGFY 161
                   + G+II+T V+E   YINEF I PN+    P D ++ HLI +HGYGAGLGF+
Sbjct: 97  ----AADGKIGEIIRTPVDEEGNYINEFCIRPNSPPVNPKDSKMHHLIFVHGYGAGLGFF 152

Query: 162 INTLQHLSMDN--WCIHAVDLPGYGFSSRLKFPYGTINPRIYSKKDVLDWFQKRLKTWFH 219
           +   +++ + N  W IHA+D PGYGFSSR KFP+ +IN    S  +V +WF  R + W  
Sbjct: 153 LKNFENIKLLNNSWTIHAIDFPGYGFSSRPKFPF-SINKNTAS--EVENWFHDRFEIWLQ 209

Query: 220 KKGLLAHPENNLVTAHSMGAYIMCHYLNNHPSDFRKIIMCSPAGFYPASNPLTNIPLWYT 279
           K+GLL   E NLV AHS+GAY++  Y  + P   +K+IMCSPAG  P++  +   P W+ 
Sbjct: 210 KRGLLEDQERNLVLAHSLGAYLIALYAQSRPKHLKKLIMCSPAGICPSNKVIKQPPWWFV 269

Query: 280 YLWDRNYSPFSLVRISGPLGSKLTSGWSYSRF--FHSNQTISNELSLALHTYAYSIFNLP 337
            LWDRN SPFSLVR SG  GSKLTSGWS+ RF  F +  T+      ALH YAY+IFN P
Sbjct: 270 KLWDRNLSPFSLVRNSGIFGSKLTSGWSFRRFKQFLNEGTMGESQFQALHRYAYAIFNKP 329

Query: 338 GSGEYSLSHILKAGGDPRTPLQEEFFTCQSTTNNGIRRSNVEYSWLYGQSDWINKTGGFK 397
           GSGEY LS +LK GGDPR+PL    F  Q+  +    ++  ++ W+YG  DW++  GG +
Sbjct: 330 GSGEYLLSFVLKCGGDPRSPLLSRLFNSQAADS---FKAQCDWLWMYGDQDWMDCKGGEQ 386

Query: 398 ISQFL-NSLNKKSNVFIAPNSGHHLYFDNYMWFNSYLAKEMT 438
            S F+   + K+SNV + P SGHHLY DNY  FN  L  EM 
Sbjct: 387 ASDFIVRHIGKESNVHVIPQSGHHLYLDNYSVFNELLQAEMA 428

>CAGL0L04686g Chr12 (539203..540558) [1356 bp, 451 aa] {ON} similar
           to uniprot|P53264 Saccharomyces cerevisiae YGR110w
          Length = 451

 Score =  338 bits (868), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 190/427 (44%), Positives = 252/427 (59%), Gaps = 55/427 (12%)

Query: 45  STAPKAASLPQILRNLPRLFPRSMTDSIRDYSQFKTNPEFFQDRLLSQLSFYPSLYXXXX 104
           +TAP A  L +I+R+LPRLFPRS+ +S RDY+ F +N +  Q  LL  L F+        
Sbjct: 42  ATAPTAKPLYEIVRDLPRLFPRSLAESKRDYATFHSNVDLMQLELLRTLPFFE------- 94

Query: 105 XXXXXXXXPRQGQIIKTYVNENE------YINEFQILPNTSTPYDRLKHLILIHGYGAGL 158
                    R G   + Y+ + E      YINE  I P    P  + K LI +HGYGAGL
Sbjct: 95  ---------RTGYNKRAYLRKTEIDSDGNYINELVIEPANVDPNKKRKRLIFVHGYGAGL 145

Query: 159 GFYINTLQHLSM--DNWCIHAVDLPGYGFSSRLKFPYGTINPRIYSKKDVLDWFQKRLKT 216
           GFY+   +HL +  D+W IHA+DLPGYGFSSR+ FP+    PR  +   V DWF  RL+T
Sbjct: 146 GFYLKNYEHLPLLDDSWSIHAIDLPGYGFSSRMDFPFQF--PRDDTSV-VCDWFISRLRT 202

Query: 217 WFHKKGLLAHPENNLVTAHSMGAYIMCHYLNNHPSDFRKIIMCSPAGF----YPASNPLT 272
            F K+G      +N+V AHSMGAY+M  YLN +P   +K++MCSPAG     Y  +N +T
Sbjct: 203 LFEKRGF--DKSDNIVMAHSMGAYLMAFYLNKYPDSVKKMVMCSPAGISRSQYSINNNIT 260

Query: 273 N---------------IPLWYTYLWDRNYSPFSLVRISGPLGSKLTSGWSYSRF--FHSN 315
                           +P WYT LWDRN SPF LVR +G LGSK+TSGW+Y RF     N
Sbjct: 261 EDISSGKEEIKLKIKKVPWWYTKLWDRNISPFVLVRKTGILGSKITSGWTYRRFKPILLN 320

Query: 316 QTISNELSLALHTYAYSIFNLPGSGEYSLSHILKAGGDPRTPLQEEFFTCQSTT----NN 371
           +  + E    LH Y+++IFN+ GSGEY LS +L+ GGDPR+PL+   F+  +      N 
Sbjct: 321 KENNYEQFEKLHRYSFAIFNMKGSGEYLLSFVLECGGDPRSPLENSLFSSDANKFGIDNA 380

Query: 372 GIRRSNVEYSWLYGQSDWINKTGGFKISQ-FLNSLNKKSNVFIAPNSGHHLYFDNYMWFN 430
           GI+ S+ E+ W+YG +DW++  G  ++++ FL +  KKS V   P SGHHLYFDNY  FN
Sbjct: 381 GIKNSSCEWVWVYGANDWMDIHGAERVTKDFLMNNRKKSRVVTIPESGHHLYFDNYPMFN 440

Query: 431 SYLAKEM 437
           S L  EM
Sbjct: 441 SLLIDEM 447

>NDAI0G01090 Chr7 (230932..232302) [1371 bp, 456 aa] {ON} Anc_3.454
          Length = 456

 Score =  329 bits (843), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 185/410 (45%), Positives = 255/410 (62%), Gaps = 32/410 (7%)

Query: 41  TLKPSTAPKAASLPQILRNLPRLFPRSMTDSIRDYSQFKTNPEFFQDRLLSQLSFYPSLY 100
           T+ P T P A  L +I+ +LP+LFPRS+  SI+DY  F+ +PE  Q  LL  L F+ +  
Sbjct: 66  TIAP-TPPTAIPLLRIITSLPKLFPRSIKQSIQDYKIFQKDPERLQIDLLKTLPFFSN-- 122

Query: 101 XXXXXXXXXXXXPRQGQIIKTYVNENE--YINEFQILPNTSTPYDR--LKHLILIHGYGA 156
                        + G+I+KT + +N+  YINEF I P+T+   +   +KHLI IHGYGA
Sbjct: 123 ---------GAKFKTGKILKTQIEDNDDYYINEFCITPDTNININSADVKHLIFIHGYGA 173

Query: 157 GLGFYINTLQHLSMDN--WCIHAVDLPGYGFSSR-LKFPYGTINPRIYSKKDVLDWFQKR 213
           GLGF+I  L+++ + N  WCIHA+DLPGYG+S+R  KFP+    PR  S+  V +WF  +
Sbjct: 174 GLGFFIKNLENIPLLNNRWCIHAIDLPGYGYSTRNKKFPFKY--PR-DSQLKVQNWFHDK 230

Query: 214 LKTWFHKKGLLAHPENNLVTAHSMGAYIMCHYLNNHPSDFRKIIMCSPAGFYPASNPLTN 273
           +  W  K+ LL +P+NNL+ AHS+GAY+M  Y    PS F+K+IMCSPAG   +S    N
Sbjct: 231 IHIWLQKRNLLNYPKNNLIVAHSLGAYLMAQYAFKFPSHFQKLIMCSPAGVTKSSIKKLN 290

Query: 274 --IPLWYTYLWDRNYSPFSLVRISGPLGSKLTSGWSYSRFFHSNQTISNELSLALHTYAY 331
              P WY  LWD N+SPFS+VR SG  GSK+TS WSY RF      + ++   ALH YAY
Sbjct: 291 NSPPWWYEKLWDLNFSPFSIVRNSGIYGSKITSAWSYRRF--KPLDLDHKQFEALHRYAY 348

Query: 332 SIFNLPGSGEYSLSHILKAGGDPRTPLQEEFFTCQSTTNNGIRRSNVEYSWLYGQSDWIN 391
           SIFN PG GEY LS IL  GG+PR  L++  F  ++ +         ++ W+YG +DW++
Sbjct: 349 SIFNRPGCGEYLLSFILSCGGNPRFSLEDTLFQRENLSTEL-----CDWGWIYGDNDWMD 403

Query: 392 KTGGFKISQFLNSLNK-KSNVFIAPNSGHHLYFDNYMWFNSYLAKEMTLF 440
             G  ++S+ +N   K KS+V + P++GHHLY DNY  FN  L KEM +F
Sbjct: 404 INGAKRVSRLINEQQKGKSDVHVIPSAGHHLYLDNYKDFNKLLIKEMEMF 453

>NCAS0E00860 Chr5 (157521..158843) [1323 bp, 440 aa] {ON} Anc_3.454
          Length = 440

 Score =  325 bits (834), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 186/409 (45%), Positives = 245/409 (59%), Gaps = 35/409 (8%)

Query: 43  KPSTAPKAASLPQILRNLPRLFPRSMTDSIRDYSQFKTNPEFFQDRLLSQLSFYPSLYXX 102
           +PST P A  +  I+ +LP LFPRS+ DS RDY+ F T+ +  Q  LL  L F+P     
Sbjct: 49  QPSTPPVAIPITDIITSLPSLFPRSLHDSRRDYNTFTTDIDSLQLNLLKTLPFFP----- 103

Query: 103 XXXXXXXXXXPRQGQIIKTYVN-ENEYINEFQILP-----NTSTPYDRLKHLILIHGYGA 156
                      +  ++I+T ++ E  YINEF I+P     + S+P   LKHLI IHGYGA
Sbjct: 104 ------MGSSQKVAKLIRTPIDDEGNYINEFCIMPAVKDGDYSSP--DLKHLIFIHGYGA 155

Query: 157 GLGFYINTLQHLSM--DNWCIHAVDLPGYGFSSRLKFPYGTINPRIYSKKDVLDWFQKRL 214
           GLGF++  L+++ +  + WCIHA+DLPGYGFSSR KFP+   N    S+  V  WF  R+
Sbjct: 156 GLGFFLKNLENIPLLDNKWCIHAIDLPGYGFSSRFKFPFHYPND---SQTKVQKWFHDRI 212

Query: 215 KTWFHKKGLLAHPENNLVTAHSMGAYIMCHYLNNHPSDFRKIIMCSPAGF--YPASNPLT 272
             WF ++ LL +P+NNLV AHS+GAY+M HY  +  + F+KIIMCSPAG   +       
Sbjct: 213 YRWFRERNLLQNPQNNLVMAHSLGAYLMAHYAFHFSNHFKKIIMCSPAGVSQFAVGKQNK 272

Query: 273 NIPLWYTYLWDRNYSPFSLVRISGPLGSKLTSGWSYSRFFHSNQTISNELSL-ALHTYAY 331
             P WY  LWD NYSPFSLVR SG  GSK+TSGWSY RF  ++    NE    ALH Y Y
Sbjct: 273 QPPWWYNKLWDLNYSPFSLVRNSGIYGSKITSGWSYRRFKPTSFNGLNESQFEALHKYTY 332

Query: 332 SIFNLPGSGEYSLSHILKAGGDPRTPLQEEFFTCQSTTNNGIRRSNVEYSWLYGQSDWIN 391
            IFN  GSGEY LS IL  GGDPR  L++  F  ++   +       ++ W+YG  DW++
Sbjct: 333 GIFNKNGSGEYLLSFILSCGGDPRFALEDNLFKEENPPEDL-----CDWVWVYGDRDWMD 387

Query: 392 KTGGFKISQFL---NSLNKKSNVFIAPNSGHHLYFDNYMWFNSYLAKEM 437
             G  +IS+ L        KS V + P++GHHLY DNY  FN+ + KEM
Sbjct: 388 INGAHRISRRLVKKAGDTSKSKVHVIPSAGHHLYLDNYKAFNNLIIKEM 436

>KLLA0B12914g Chr2 (1126975..1128255) [1281 bp, 426 aa] {ON} similar
           to uniprot|P53264 Saccharomyces cerevisiae YGR110W
          Length = 426

 Score =  301 bits (772), Expect = 4e-98,   Method: Compositional matrix adjust.
 Identities = 178/404 (44%), Positives = 233/404 (57%), Gaps = 36/404 (8%)

Query: 41  TLKPSTAPKAASLPQILRNLPRLFPRSMTDSIRDYSQFKTNPEFFQDRLLSQLSFYPSLY 100
           T++ STAP    L QI+ NL +LFP S  +S++DY Q+  N E FQ+ LLS L +YP   
Sbjct: 53  TVRKSTAPIGLPLLQIVTNLHKLFPLSFAESLKDYKQYNINKEQFQEDLLSVLPYYPEPS 112

Query: 101 XXXXXXXXXXXXPRQGQIIKTYVNE-NEYINEFQILP-NTSTPYDRLKHLILIHGYGAGL 158
                           +IIKT ++    YINEFQI P    +    LKH+IL+HGYGAGL
Sbjct: 113 ARF-----------SSKIIKTPIDAAGNYINEFQITPIRPESDGKPLKHIILVHGYGAGL 161

Query: 159 GFYINTLQHLSMDNWCIHAVDLPGYGFSSRLKFPYGTINPRIYSKKD----VLDWFQKRL 214
           GFY+     L  +N  +HA+DLPGYGFSSR  FP+       +  KD    V D+F   L
Sbjct: 162 GFYLKNFNALLSENVVVHAIDLPGYGFSSRPMFPF-------HYPKDSYLAVEDYFHDAL 214

Query: 215 KTWFHKKGLLAHPENNLVTAHSMGAYIMCHYLNNHPSDFRKIIMCSPAGFYPASNPLTNI 274
             WF KKGL++  ENN V AHSMGAYI   Y N +   F+K+ MCSP G    +  +   
Sbjct: 215 HKWFDKKGLISCWENNYVIAHSMGAYIFSLYANKY-KHFKKLFMCSPGGI-SRNKDMPPP 272

Query: 275 PLWYTYLWDRNYSPFSLVRISGPLGSKLTSGWSYSRFFHSNQTISNELSLALHTYAYSIF 334
           P W+  LWD+N SPFSLVR +G +GSKL SGW+  RF   +          LH Y Y IF
Sbjct: 273 PWWFLKLWDQNISPFSLVRNAGHVGSKLVSGWTARRFGLHHPNFDK-----LHHYTYGIF 327

Query: 335 NLPGSGEYSLSHILKAGGDPRTPLQEEFFTCQSTTNNGIRRSNVEYSWLYGQSDWINKTG 394
           N PGSGEY LS +L  GG PR PL+   FT ++        S++++ WLYG SDW++  G
Sbjct: 328 NQPGSGEYMLSFMLGCGGWPRVPLETRLFTEEN-----FNSSHLDWVWLYGDSDWMDING 382

Query: 395 GFKISQFLNSLNKKSNVFIAPNSGHHLYFDNYMWFNSYLAKEMT 438
             +I+ FL      + + I PN+GHHLY+DN  +FN+ L KE+ 
Sbjct: 383 ARRINDFLRKKCINTKLEIVPNAGHHLYWDNDSFFNNVLRKELV 426

>SAKL0G19074g Chr7 (1646858..1648156) [1299 bp, 432 aa] {ON}
           conserved hypothetical protein
          Length = 432

 Score =  173 bits (439), Expect = 8e-49,   Method: Compositional matrix adjust.
 Identities = 120/410 (29%), Positives = 174/410 (42%), Gaps = 90/410 (21%)

Query: 86  QDRLLSQLSFYPSLYXXXXXXXXXXXXPRQGQIIKTYVNENEYINEFQILPNTSTPYDRL 145
           ++ +LS L FYP                R+ + +   +     I+EF I     +  D  
Sbjct: 45  EENILSMLDFYPE-----------GDESRRCETMDVDIGTGNSIHEFCIENTKESDRDYC 93

Query: 146 KHLILIHGYGAGLGFYINTLQHLS-MDNWCIHAVDLPGYGFSSRLKFPYGTI-----NPR 199
           + ++L+HGYGA LG +I     LS +    +HA+D+ GYG SSR KFP           R
Sbjct: 94  RDMVLVHGYGAALGLFIRNFDGLSQIPGIRLHAIDMLGYGLSSRPKFPDTGFLTSFWKKR 153

Query: 200 IYSKKDVL---DWFQKRLKTWFHKKGLLAHPENNLVTAHSMGAYIMCHYLNNHPSDFRKI 256
             +K+DVL   D+F   ++TW HK+    H +  ++  HS+G Y+ C Y   +P    K+
Sbjct: 154 EVTKEDVLLAEDFFIDSIETWRHKR----HLDKFVLVGHSLGGYLSCRYALKYPERVEKL 209

Query: 257 IMCSPAGFYPASNPLT-------------------------------------------- 272
           I+ SP G   +   LT                                            
Sbjct: 210 ILVSPVGVETSIFDLTKEHTATHEHAAELGPDIAQELKVVPENSTTDKPVQPSSSFHVPN 269

Query: 273 ---------NIPLWYTYLWDRNYSPFSLVRISGPLGSKLTSGWSYSRFFHSNQTISNELS 323
                    N+P     +W+ N SPF ++R  GP G  L S WS+ RF H       E  
Sbjct: 270 ESGHVERIPNLPKIVRIIWENNISPFGILRSLGPWGPLLCSRWSFRRFSHCGD---KEQV 326

Query: 324 LALHTYAYSIFNLPGSGEYSLSHILKAGGDPRTPLQEEFFTCQSTTNNGIRRSNVEYSWL 383
           +  H YAY+ FN  GSGEY+L+ IL  G   R PL     +C        +    E  W+
Sbjct: 327 MKFHDYAYNTFNARGSGEYALTRILAPGVLARIPL----LSCAP------KNLKCESLWM 376

Query: 384 YGQSDWINKTGGFKISQFLNSLNKKSNVFIAPNSGHHLYFDNYMWFNSYL 433
           YG  DW++K  G  I + LN     ++  +  ++GHHLY DN   FN  L
Sbjct: 377 YGSHDWMSKEAGSVIVKELNKAGNTADYSVVSDAGHHLYLDNPHEFNQKL 426

>KLTH0C01254g Chr3 complement(113435..114739) [1305 bp, 434 aa] {ON}
           conserved hypothetical protein
          Length = 434

 Score =  159 bits (401), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 120/417 (28%), Positives = 180/417 (43%), Gaps = 98/417 (23%)

Query: 86  QDRLLSQLSFYPSLYXXXXXXXXXXXXPRQGQIIKTYVNENEYINEFQILPNTSTPYDRL 145
           + +LLS L F+P                R  +++   +   ++I+EF I    S   D  
Sbjct: 43  EKKLLSTLEFFPG-----------GDSIRNCELLDVDIGNKQHIHEFSIQNIESCSRDYC 91

Query: 146 KHLILIHGYGAGLGFYINTLQHLS-MDNWCIHAVDLPGYGFSSRLKFP-YGTINPRI--- 200
           K L+++HGYGA LG ++     LS +    +HA+D+ G G SSR +FP  G I+  I   
Sbjct: 92  KDLVMVHGYGAALGLFVRNFDGLSRIPGINLHALDMLGCGLSSRPRFPGTGLISSVIKRG 151

Query: 201 -YSKKDVLD---WFQKRLKTWFHKKGLLAHPENNLVTAHSMGAYIMCHYLNNHPSDFRKI 256
             +K++V +   +F   L+ W  ++ L    +  ++  HS+G Y+ C Y    P    K+
Sbjct: 152 RVTKEEVYEAENFFIDSLEKWRQQRKL----DKFVLVGHSLGGYLSCCYALKFPERVEKL 207

Query: 257 IMCSPAGFYPASNPLT-------------------------------------------- 272
           ++ SP G   +   LT                                            
Sbjct: 208 VLVSPVGVEKSVFDLTKEHTPSHNNASELGPDLSKEVTNSSGRPTTDDPVKTSSSFHVPD 267

Query: 273 ---------NIPLWYTYLWDRNYSPFSLVRISGPLGSKLTSGWSYSRFFHSNQTISNELS 323
                    N+P  ++ +W  N SPF L+R +GP G  L+S WS+ RF  +  T   E  
Sbjct: 268 EAGNVERVPNMPWIFSSMWTYNISPFGLLRSAGPAGPLLSSRWSFRRFSFAENT---EQL 324

Query: 324 LALHTYAYSIFNLPGSGEYSLSHILKAGGDPRTPLQE---EFFTCQSTTNNGIRRSNVEY 380
           L  H Y YSIF+  GSGEY+L+ IL  G   R PL     E   C S             
Sbjct: 325 LTFHEYCYSIFSGSGSGEYALTRILAPGVLARVPLLSRVPENLKCDSF------------ 372

Query: 381 SWLYGQSDWINKTGGFKISQFLNSLNK--KSNVFIAPNSGHHLYFDNYMWFNSYLAK 435
            W+YG  DW++K  G  I + +N      K++  +  ++GHHLY DN   FN  LAK
Sbjct: 373 -WMYGSHDWMSKEAGSVIVRQINKTKGSVKADYSVVSDAGHHLYLDNPEEFNQKLAK 428

>Kwal_14.985 s14 complement(142781..144088) [1308 bp, 435 aa] {ON}
           YDR125C (ECM18) - (putative) involved in cell wall
           biogenesis [contig 244] FULL
          Length = 435

 Score =  148 bits (373), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 115/428 (26%), Positives = 183/428 (42%), Gaps = 98/428 (22%)

Query: 79  KTNPEFFQDRLLSQLSFYPSLYXXXXXXXXXXXXPRQGQIIKTYVNENEYINEFQILPNT 138
           K+N    + +LLS L F+P                R+ +I+   + + + I+E +I    
Sbjct: 37  KSNARENEKQLLSTLEFFPQ-----------GDSTRKCKILDVDIGDKQTIHELEIENLK 85

Query: 139 STPYDRLKHLILIHGYGAGLGFYINTLQHLS-MDNWCIHAVDLPGYGFSSRLKFP-YGTI 196
           ++       L+L+HGYGA LG ++     LS +    +HA+D+ G G SSR KFP  G I
Sbjct: 86  TSSRSYANDLVLVHGYGAALGLFVRNFDGLSSVPGIKLHAIDMLGCGLSSRPKFPGTGLI 145

Query: 197 NPRI----YSKKDVL---DWFQKRLKTWFHKKGLLAHPENNLVTAHSMGAYIMCHYLNNH 249
           +  I     +K++V    D+F   ++ W  K+ +    E  ++  HS+G Y+   Y   +
Sbjct: 146 SSLIKRGNVTKEEVYEAEDFFVDSMEKWRKKRQV----EKFVLVGHSLGGYLSSCYALKY 201

Query: 250 PSDFRKIIMCSPAGFYPA------------------------------SNPLTNIPL--- 276
           P    K+++ SP G   +                                P T+ P+   
Sbjct: 202 PERVEKLVLVSPVGVEKSIFDLTHEHTESHKGAAELGPDVAKEITNNPDKPTTDNPVKNS 261

Query: 277 --------------------WYTYLWDRNYSPFSLVRISGPLGSKLTSGWSYSRFFHSNQ 316
                                ++Y+W  N SPF ++R  GP+G  ++S WS+ RF  ++ 
Sbjct: 262 SSFHVPDEHGMVERVPNMSRIFSYMWTYNISPFGILRTLGPVGPLISSNWSFRRFSFTDD 321

Query: 317 TISNELSLALHTYAYSIFNLPGSGEYSLSHILKAGGDPRTPLQEEF---FTCQSTTNNGI 373
               +  L  H Y Y +F+  GSGEY+L+ IL  G   R PL         C S      
Sbjct: 322 P---KQLLTFHEYCYGVFSGAGSGEYALTRILAPGVLARLPLLSRMPGNLKCDSF----- 373

Query: 374 RRSNVEYSWLYGQSDWINKTGGFKISQFLNSLN--KKSNVFIAPNSGHHLYFDNYMWFNS 431
                   W+YG  DW++K  G  + + LN      K++  I  ++GHHLY DN   FN 
Sbjct: 374 --------WMYGSQDWMSKEAGSVMVKKLNESPGLGKADFSIVSDAGHHLYLDNPEEFNR 425

Query: 432 YLAKEMTL 439
            L K + L
Sbjct: 426 KLLKFLKL 433

>Ecym_5577 Chr5 (1185997..1187298) [1302 bp, 433 aa] {ON} similar to
           Saccharomyces cerevisiae YGR110W
          Length = 433

 Score =  132 bits (331), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 120/421 (28%), Positives = 176/421 (41%), Gaps = 97/421 (23%)

Query: 86  QDRLLSQLSFYPSLYXXXXXXXXXXXXPRQGQIIKTYVNENEYINEFQILPNTSTPYDRL 145
           +D +L  LSFYP                R  +++   +   +Y++EF I        D  
Sbjct: 41  EDNVLRMLSFYPD-----------GDSERTCEVLHVDIGGGDYMHEFCIENKLPMTRDTC 89

Query: 146 KHLILIHGYGAGLGFYINTLQHLS-MDNWCIHAVDLPGYGFSSRLKFPYGT-----INPR 199
           K ++L+HGYG  LG +I     LS +    +HA+D+ GYG SSR +FP        +  +
Sbjct: 90  KDIVLVHGYGTALGVFIRNFDELSQIPGVRLHAIDMLGYGLSSRPRFPRSGFWDYYVKGK 149

Query: 200 IYSKKDV---LDWFQKRLKTWFHKKGL-------------------LAHPE--NNLVTAH 235
           + +K+ V   L +F   L+ W  K+ +                   L HPE  + LV   
Sbjct: 150 VVTKEQVEEALAFFVDSLEAWREKRNVDSFVLVGHSLGGYLSSFYALRHPERIDKLVLVS 209

Query: 236 SMGAYIMCHYLNNH---------------PSDFRKIIMCSPAGFYPASNP---------- 270
            +G     + L                   S+F++            SN           
Sbjct: 210 PVGVETSIYDLTAEHTPEHQHAGQLGPEVASEFKEDATEHTTDLSIDSNSPQSSSLHIPN 269

Query: 271 -------LTNIPLWYTYLWDRNYSPFSLVRISGPLGSKLTSGWSYSRFFHSNQTISNELS 323
                  + NIP     LW+ N SPFSL+R+ GPLG K+ + WS+ RF     T  NEL 
Sbjct: 270 EKGFVEHVPNIPWLVKMLWNTNVSPFSLLRLLGPLGPKICANWSFRRFGACKDT--NEL- 326

Query: 324 LALHTYAYSIFNLPGSGEYSLSHILKAGGDPRTPLQEEF---FTCQSTTNNGIRRSNVEY 380
           +  H YAY+ F   GSGEY++  IL  G   R PL  +      C S             
Sbjct: 327 MNFHQYAYNNFKAKGSGEYAMMKILAPGALARVPLLSQLPGALKCDSL------------ 374

Query: 381 SWLYGQSDWINKTGGFKISQFLNSLNK-KSNVFIAPNSGHHLYFDNYMWFNSYLAKEMTL 439
            W+YG +DW++K  G  I + L   +  ++   I  N+GHHLY DN   FN    +E+ L
Sbjct: 375 -WMYGSNDWMSKEAGCIIVEELQEKSDYRAEYKIVNNAGHHLYLDNPEEFN----RELKL 429

Query: 440 F 440
           F
Sbjct: 430 F 430

>KAFR0B05380 Chr2 (1107049..1108284) [1236 bp, 411 aa] {ON}
           Anc_8.284 YDR125C
          Length = 411

 Score = 76.3 bits (186), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 89/339 (26%), Positives = 139/339 (41%), Gaps = 74/339 (21%)

Query: 149 ILIHGYGAGLGFYINTLQHLSMDNWCIHAVDLPGYGFSSRLKFPYGTINPRIYSKKDVLD 208
           +L+HG+ +    +      LS D   ++A+DLP  G S  L   +  ++P+   K D+LD
Sbjct: 91  LLLHGFASSSMSFFRNFTGLSQDIMDLYAIDLPANGLSRSLSTKFYRVSPKETRKFDMLD 150

Query: 209 WFQKRLKT---WFHKKGLLAHPE-------------NNL----VTAHSMGAYIMCHYLNN 248
               +L +   +  +K L+   E             N L    + AHS G Y+   Y   
Sbjct: 151 DIHFQLLSHGNYHAEKELIQKCEDYYIDTIERWRRSNELHKINIVAHSFGGYLSFKYALK 210

Query: 249 HPSDFRKIIMCSPAG----FYPASNPLTNIPLWYTYLWDR-----------NYSP----- 288
           +P    K+ + SP G     Y  +N   N  +  TY  +R           N  P     
Sbjct: 211 YPESINKLCLVSPLGVEANIYSINN---NFNVGETYTVNRLDPSSCCYINENEIPKYVFD 267

Query: 289 --FSLVRISGPLGSKLTSGWSYSRFFHSNQTISNELSLALHTYAYSIFNLPGSGEYS--- 343
             F ++R+SGP+G+KL   W+Y     S   IS   SL    Y + +  L G G  +   
Sbjct: 268 NLFKILRLSGPIGAKLC--WNY--VLSSYSRIS---SLDFKRYVFEL--LYGKGGMTATA 318

Query: 344 ---LSHILKAGGDPRTPLQEEFFTCQSTTNNGIRRSNVEYSWLYGQSDWINKTGGFKISQ 400
               + +       R PL +   +  S + NGI         LYG+ DW+ K  G  +  
Sbjct: 319 INLFTQLFTTRLLARDPLMD---SAHSLSCNGIL-------LLYGEYDWMAKNAGKSLLT 368

Query: 401 FLNSLNK----KSNVFIAPNSGHHLYFDNYMWFNSYLAK 435
              + NK    K+     P SGH+L+ DN  +FN  +A+
Sbjct: 369 NCKADNKGSASKTKYLEVPKSGHNLFLDNPAFFNKSIAE 407

>Suva_2.288 Chr2 complement(496577..497884) [1308 bp, 435 aa] {ON}
           YDR125C (REAL)
          Length = 435

 Score = 74.3 bits (181), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 89/341 (26%), Positives = 145/341 (42%), Gaps = 68/341 (19%)

Query: 149 ILIHGYGAGLGFYINTLQHLSMDNWCIHAVDLPGYGFSS--------------------- 187
           +LIHGY A    Y      LS     ++++DLP  G SS                     
Sbjct: 112 LLIHGYAASSMSYFRNYSGLSKHFQNLYSIDLPASGLSSIPPLEVNTTTPLPLDIKFIGK 171

Query: 188 -RLKFPYGTINP--RIYSKKDVLDWFQKRLKTWFHKKGLLAHPENNLVTAHSMGAYIMCH 244
            + K PY TIN     +  +   D++  R++ W     L    +   +  HS G Y+   
Sbjct: 172 NKFKIPY-TINASHHKFVIQMFEDFYIDRIEQWRIDNKL----DKMNIVGHSFGGYLSFK 226

Query: 245 YLNNHPSDFRKIIMCSPAG----FYPASNPLTNIPLWYTYLWD---RNYSP--------- 288
           Y   +P+   K+ + SP G     +  +N L++  L+ T   D   + YS          
Sbjct: 227 YAVKYPNSVEKLCLVSPLGVERNIWSVNNNLSSNTLYTTDFKDPSSKFYSKGHLIPKYLF 286

Query: 289 ---FSLVRISGPLGSKLTSGWSYSRFFHSNQTISNELSLALHTYAYSIFNLPGSGEYSLS 345
              F L+R+ GPLG+K+   W+Y    +S  T     SLA   Y + +F   G      +
Sbjct: 287 EEQFKLLRLMGPLGAKVC--WNYIMAAYSRVT-----SLAFKEYIFELFYGKGGIPEVTT 339

Query: 346 HILKAGGDPRTPLQEEFFTCQSTTNNGIRRSNVEYSWLYGQSDWINKTGGFKISQFLNSL 405
            I K G   R+ L  +     S     +++  V    +YGQ DW+NK  G  + + +N L
Sbjct: 340 DIFK-GLFSRSILARDPI-LDSLNYLNVKKLLV----VYGQYDWMNKNAGMLLVENVNKL 393

Query: 406 N---KKSNVFIAPNSGHHLYFDNYMWFN----SYLAKEMTL 439
               ++++    P+SGH+L+ DN   FN    S+L+++ +L
Sbjct: 394 GNGLERASYLEVPSSGHNLFLDNPESFNQSIVSFLSEKSSL 434

>Smik_4.371 Chr4 complement(662692..663999) [1308 bp, 435 aa] {ON}
           YDR125C (REAL)
          Length = 435

 Score = 73.2 bits (178), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 84/338 (24%), Positives = 136/338 (40%), Gaps = 76/338 (22%)

Query: 149 ILIHGYGAGLGFYINTLQHLSMDNWCIHAVDLPGYGFSS--------------------- 187
           +LIHGY A    +      LS     ++++DLP  G SS                     
Sbjct: 112 LLIHGYAASSMSFFRNYPGLSKHIQNLYSIDLPASGLSSIPPLEINATTPLPLDIEFTGK 171

Query: 188 -RLKFPYGT-INPRIYSKKDVLDWFQKRLKTWFHKKGLLAHPENNL----VTAHSMGAYI 241
            + K PY   +N   +  +   D++  +++ W          +N L    +  HS G Y+
Sbjct: 172 NKFKIPYTINLNHHKFVIQMYEDFYLDKIEQW--------RIDNKLGKVNIVGHSFGGYL 223

Query: 242 MCHYLNNHPSDFRKIIMCSPAGFY----------------------PASNPLTNIPLWYT 279
              Y   +P+   K+ + SP G                        P+S   +   +   
Sbjct: 224 SFKYAAKYPNSVEKLCLVSPLGVERNIWSINNNFRSNTLYTIGFEDPSSKFYSKRNMIPK 283

Query: 280 YLWDRNYSPFSLVRISGPLGSKLTSGWSYSRFFHSNQTISNELSLALHTYAYSIFNLPGS 339
           YL++R    F L+R+ GP+G+KL   W+Y    +S        SLA   Y + +F   G 
Sbjct: 284 YLFERQ---FQLLRMMGPVGAKLC--WNYIMAAYSRVP-----SLAYKEYIFELFYGKGG 333

Query: 340 GEYSLSHILKAGGDPRTPLQEEFFTCQSTTNNGIRRSNVEYSWLYGQSDWINKTGGFKIS 399
                + I K G   R  L ++     S     +R+  V    +YGQ DW+NK  G  + 
Sbjct: 334 IPEVTTEIFK-GLFSRCILAKDPLM-DSLHYLNVRKLMV----VYGQYDWMNKKAGMLMV 387

Query: 400 QFLNSLN---KKSNVFIAPNSGHHLYFDNYMWFNSYLA 434
           + LNSL    +K++    P+SGH+L+ DN + FN  + 
Sbjct: 388 ENLNSLGNCLEKASYLEIPSSGHNLFLDNPLSFNQSIV 425

>CAGL0B01969g Chr2 complement(181406..182677) [1272 bp, 423 aa] {ON}
           similar to uniprot|Q04623 Saccharomyces cerevisiae
           YDR125c ECM18 or uniprot|Q12385 Saccharomyces cerevisiae
           YLR099c ICT1
          Length = 423

 Score = 71.2 bits (173), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 79/336 (23%), Positives = 133/336 (39%), Gaps = 77/336 (22%)

Query: 149 ILIHGYGAGLGFYINTLQHLSMDNWCIHAVDLPGYGFS---------------------- 186
           +LIHGY A    +  ++ +L+ D   ++ +DLPG G S                      
Sbjct: 110 VLIHGYAATSTAFFRSIPYLNRDIKDLYTIDLPGNGLSFTPSLDLEVSKPLPLKIENIDD 169

Query: 187 -SRLKFPYGTINP-RIYSKKDVLDWFQKRLKTWFHKKGLLAHPENNL----VTAHSMGAY 240
            +  + PY   +    Y  + +LD++  R++ W          +N L    V AHS G Y
Sbjct: 170 GNEFQLPYVIDSAHHRYVLQKLLDYYVDRIEQW--------RLDNKLGKINVVAHSYGGY 221

Query: 241 IMCHYLNNHPSDFRKIIMCSPAG----FYPASNPLTNIPLWY------------------ 278
           +  +Y   +P++   + + SP G     Y  +N   +  ++                   
Sbjct: 222 LSFNYALKYPANINTLGLISPLGVERNIYSINNEFHSRTIYKREWNDCNSMFYDRKFKLN 281

Query: 279 TYLWDRNYSPFSLVRISGPLGSKLTSGWSYSRFFHSNQTISNELSLALHTYAYSIFNLPG 338
            YL+ +   P   +R  GP+G+KL   W+Y R  ++     +       T+ Y    LP 
Sbjct: 282 DYLFQKQLKP---LRWLGPIGAKLC--WNYIRSAYARVPSIDYKDYTFETF-YGRGGLPE 335

Query: 339 SGEYSLSHILKAGGDPRTPLQEEFFTCQSTTNNGIRRSNVEYSWLYGQSDWINKTGGFKI 398
                 + +L +    R PL +     Q            +   +YGQ DW+NK GG  +
Sbjct: 336 QTSQIFTSLLTSSLLARDPLLDHVSQLQVP----------KLIMMYGQYDWMNKNGGKLM 385

Query: 399 SQFLNSLNKKSNVFIAPNSGHHLYFDNYMWFNSYLA 434
           +Q  N   K  ++   PN+GH+L+ DN   F S L 
Sbjct: 386 TQIFNGETKYIDI---PNAGHNLFLDNPSDFASQLT 418

>Skud_4.386 Chr4 complement(673125..674465) [1341 bp, 446 aa] {ON}
           YDR125C (REAL)
          Length = 446

 Score = 70.9 bits (172), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 93/351 (26%), Positives = 142/351 (40%), Gaps = 88/351 (25%)

Query: 149 ILIHGYGAGLGFYINTLQHLSMDNWCIHAVDLPGYGFSS--------------------- 187
           +LIHGY A    Y      LS     ++++DLP  G SS                     
Sbjct: 123 LLIHGYAASSMSYFRNYPGLSKHIRDLYSIDLPASGLSSIPSLEINATTPLPLDIKFIGK 182

Query: 188 -RLKFPYGTINP--RIYSKKDVLDWFQKRLKTWFHKKGLLAHPENNL----VTAHSMGAY 240
            + K PY TIN     +  +   D++  R++ W          +N L    +  HS GAY
Sbjct: 183 NKFKIPY-TINANHHKFVIQMFEDFYLDRIEQW--------RIDNKLGKMNIVGHSFGAY 233

Query: 241 IMCHYLNNHPSDFRKIIMCSPAGFY-----PASNPLTNIPLWYTYLWD---------RNY 286
           +   Y   +P+   K+ + SP G         +N  +N P  YT  ++         RN 
Sbjct: 234 LSFKYAVKYPNSVEKLCLVSPLGVERNIWSVNNNFRSNSP--YTIDFENPSSKFYSKRNI 291

Query: 287 SP-------FSLVRISGPLGSKLTSGWSYSRFFHSNQTISNELSLALHTYAYSIF----N 335
            P       F ++R+ GPLG+KL   W+Y    +S        SLA   Y + +F     
Sbjct: 292 IPRYLFQQQFQILRMMGPLGAKLC--WNYILAAYSRVP-----SLAYKEYIFELFYGKGG 344

Query: 336 LPGSGEYSLSHILKAGGDPRTPLQEEFFTCQSTTNNGIRRSNVEYSWLYGQSDWINKTGG 395
           +P         +       R PL +      S  +  +R+  V    +YGQ DW+NK  G
Sbjct: 345 IPAVTTEIFEGLFSRSILARDPLMD------SLNSLNVRKLLV----VYGQYDWMNKNAG 394

Query: 396 FKISQFLNSLN---KKSNVFIAPNSGHHLYFDNYMWFN----SYLAKEMTL 439
             + + LN+L    +K+     P SGH+L+ DN   FN    S+L++E  L
Sbjct: 395 MLMVKELNNLGDHFEKATYTEIPFSGHNLFLDNPESFNQSIVSFLSEEPEL 445

>TDEL0F04100 Chr6 complement(756762..758066) [1305 bp, 434 aa] {ON}
           Anc_8.284 YDR125C
          Length = 434

 Score = 70.1 bits (170), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 77/331 (23%), Positives = 129/331 (38%), Gaps = 61/331 (18%)

Query: 149 ILIHGYGAGLGFYINTLQHLSMDNWCIHAVDLPGYGFSSRLKFPYGTINPR--------- 199
           +LIHGY A    Y      LS     ++A+DLP  G S+   F      PR         
Sbjct: 116 LLIHGYAASSMAYYRNFTGLSQTVTDLYAIDLPANGLSAEQPFKLNGDKPRSLKVKYLDN 175

Query: 200 -IYSKKDVLD-------------WFQKRLKTWFHKKGLLAHPENNLVTAHSMGAYIMCHY 245
             +S + V+D             ++  +++ W     L    + NLV  HS G Y+   Y
Sbjct: 176 DKFSVQHVIDESGTKQMIQQCESYYLDKIEEWRKVNKL---EKINLV-GHSFGGYLSFKY 231

Query: 246 LNNHPSDFRKIIMCSPAG----FYPASNPLTNIPLWYTYLWD---------RNYSPF--- 289
              +P+   K+ + SP G     Y  +N L     +   L D         R    F   
Sbjct: 232 ALKYPNSIEKLCLVSPLGVETSIYSVNNKLEKNTKYALDLEDPTSNFYTRRREIPKFIFK 291

Query: 290 ---SLVRISGPLGSKLTSGWSYSRFFHSNQTISNELSLALHTYAYSIFNLPGSGEYSLSH 346
               ++R  GPLG+K+   W+Y    +S +    E    +    Y    +  +     ++
Sbjct: 292 NQSEILRWMGPLGAKMC--WNYILSAYS-RIPEMEYKSYIFELLYGKGGIAPTARQIFTN 348

Query: 347 ILKAGGDPRTPLQEEFFTCQSTTNNGIRRSNVEYSWLYGQSDWINKTGGFKISQFLNSL- 405
           +       + P+ +     Q+           +   +YG  DW+NK  G+K+ + LN++ 
Sbjct: 349 LFTRNLLAKDPIMDSLGQLQAK----------KVLLVYGDHDWMNKYAGYKLVERLNTIR 398

Query: 406 -NKKSNVFIAPNSGHHLYFDNYMWFNSYLAK 435
            N  +     P SGH+L+ DN  +FN+ L +
Sbjct: 399 NNTSAQYIEVPESGHNLFLDNPTFFNASLTE 429

>YLR099C Chr12 complement(339744..340928) [1185 bp, 394 aa] {ON}
           ICT1Lysophosphatidic acid acyltransferase, responsible
           for enhanced phospholipid synthesis during organic
           solvent stress; null displays increased sensitivity to
           Calcofluor white; highly expressed during organic
           solvent stress
          Length = 394

 Score = 67.4 bits (163), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 75/333 (22%), Positives = 128/333 (38%), Gaps = 64/333 (19%)

Query: 149 ILIHGYGAGLGFYINTLQHLSMDNWCIHAVDLPGYGFSS-------------RLKFPY-- 193
           +LIHGY A    +  T ++LS +   ++A+DLP  G S               L+F +  
Sbjct: 74  VLIHGYAASSMAFYRTFENLSDNIKDLYAIDLPANGASEAPALQVNKTKKIKSLRFKHIE 133

Query: 194 -GTINPRIYSKKDVLD----------WFQKRLKTWFHKKGLLAHPENNLVTAHSMGAYIM 242
              + P I  +    D          +F  R++ W     L        V  HS G YI 
Sbjct: 134 DDVVIPVIEKRPPAEDIKSHLEQYESYFVDRIEQWRKDNKL----RKINVVGHSFGGYIS 189

Query: 243 CHYLNNHPSDFRKIIMCSPAGFYPAS-------NPLTNIPLWYTYLWDRNYS-------- 287
             Y   +P    K+ + SP G   +         P T  PL +T    R Y+        
Sbjct: 190 FKYALKYPDSIEKLCLISPLGVENSIHAITHKWEPNTTYPLTFTDPSSRYYTRKLNVPRF 249

Query: 288 ----PFSLVRISGPLGSKLTSGWSYSRFFHSNQTISNELSLALHTYAYSIFNLPGSGEYS 343
                 ++++  GP+GSKL S +  + +      I  +    LH++      +       
Sbjct: 250 IFENQLNVLKWMGPIGSKLCSNYISTAYVKVPDQIYKDY--LLHSFVGKNQTVQPQTIKV 307

Query: 344 LSHILKAGGDPRTPLQEEFFTCQSTTNNGIRRSN--VEYSWLYGQSDWINKTGGFKISQF 401
            +H+ +     R P+            N +R  N      ++YG+ DW++K  G+  ++ 
Sbjct: 308 FTHLFERNLIARDPII-----------NNVRFLNPATPVMFMYGEHDWMDKYAGYLTTES 356

Query: 402 LNSLNKKSNVFIAPNSGHHLYFDNYMWFNSYLA 434
           +     K++    P++GH+L+ DN   F S L 
Sbjct: 357 MLKNKAKASYVEVPDAGHNLFLDNPQHFASSLV 389

>KNAG0G02140 Chr7 complement(484440..485666) [1227 bp, 408 aa] {ON} 
          Length = 408

 Score = 66.2 bits (160), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 95/372 (25%), Positives = 149/372 (40%), Gaps = 95/372 (25%)

Query: 127 EYINEFQILPNTSTPYDRLKH---LILIHGYGAG-LGFYINTLQ-HLSMDNWCIHAVDLP 181
           + INE+++    S   DR+      +LIHGY A  + F++N      +  + C+  VDLP
Sbjct: 61  DEINEWRL--QNSGDADRIAVHTPTVLIHGYAASSMAFHLNVAGLSNAFSDLCV--VDLP 116

Query: 182 GYGFS-----------------SRLKFPYGTIN-----PRIYSKKDVLD-------WFQK 212
             G S                   L    G++      P   S   VLD       +F  
Sbjct: 117 ANGLSREPPMLGPKVKGQPVHWKELDKKTGSLTVVCEPPSKMSSSGVLDDPGVYEDYFVD 176

Query: 213 RLKTWFHKKGLLAHPENNL-VTAHSMGAYIMCHYLNNHPSDFRKIIMCSPAGFY----PA 267
           R++ W      LAH  +N+ V  HS G Y+   Y   +     K+++ SP G        
Sbjct: 177 RIEKW-----RLAHGFDNINVVGHSFGGYMSFKYAIKYSKHVDKLVLLSPLGVERNIDSV 231

Query: 268 SNP--------LTNI----PLWYT------YLWDRNYSPFSLVRISGPLGSKLTSGWSYS 309
           SN         LT+I    PL+Y       YL++      +++R  GPLG+ +      S
Sbjct: 232 SNKWDVGKTYDLTDIDATSPLYYRPFTVPGYLFNNQ---LNVLRKMGPLGNHMAKRAIAS 288

Query: 310 RFFHSNQTISNELSLALHTYAYSIF----NLPGSGEYSLSHILKAGGDPRTPLQEEFFTC 365
           R+       SN    A H Y + +F      P +   + +H+       R PL +     
Sbjct: 289 RY-------SNVPGTAYHAYLHHVFYGAHTFPSANITAFTHLFTRQLLARDPLLDN---- 337

Query: 366 QSTTNNGIRRSNV-EYSWLYGQSDWINKTGGFKISQFLNS---LNKKSNVFIAPNSGHHL 421
                  I+R  V +   +YG  DW+NK  G+ + Q +N    +  K+     P++GH+L
Sbjct: 338 -------IQRLKVNKLMMVYGDHDWMNKEAGYGMVQEINKERYVPAKAVYAELPSAGHNL 390

Query: 422 YFDNYMWFNSYL 433
           + DN   FN  L
Sbjct: 391 FLDNPSGFNKLL 402

>Smik_12.158 Chr12 complement(319660..320844) [1185 bp, 394 aa] {ON}
           YLR099C (REAL)
          Length = 394

 Score = 65.9 bits (159), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 70/322 (21%), Positives = 126/322 (39%), Gaps = 60/322 (18%)

Query: 149 ILIHGYGAGLGFYINTLQHLSMDNWCIHAVDLPGYGFSS-------------RLKFPY-- 193
           +LIHGY A    +  T + LS +   ++A+DLP  G S               L+F +  
Sbjct: 74  VLIHGYAASSMAFYRTFESLSNNIKDLYAIDLPANGASEAPVLQVDKTKKVKSLRFKHIE 133

Query: 194 -GTINPRIYSKKDVLD----------WFQKRLKTWFHKKGLLAHPENNLVTAHSMGAYIM 242
              + P +  +    D          +F  R++ W     L        V  HS G YI 
Sbjct: 134 DDVVIPVLDRRPPAEDIKSHLEQYENYFVDRIEQWRKDNKL----RKINVVGHSFGGYIS 189

Query: 243 CHYLNNHPSDFRKIIMCSPAGFYPASN-------PLTNIPLWYTYLWDRNYS-------- 287
             Y   +P+   K+ + SP G   + +       P T  PL +T    R Y+        
Sbjct: 190 FKYALKYPNSIDKLCLISPLGVENSIHAITHKWEPNTTYPLTFTDPSSRYYTRKLNVPRF 249

Query: 288 ----PFSLVRISGPLGSKLTSGWSYSRFFHSNQTISNELSLALHTYAYSIFNLPGSGEYS 343
                 ++++  GP+GSKL S +  + +      I  +    LH++      +       
Sbjct: 250 IFENQLNVLKWMGPIGSKLCSNYISTAYVKVPDQIYKDY--LLHSFVGKNQTVQPQTIKV 307

Query: 344 LSHILKAGGDPRTPLQEEFFTCQSTTNNGIRRSNVEYSWLYGQSDWINKTGGFKISQFLN 403
            +H+ +     R P+           N G+    +   ++YG+ DW++K  G+  ++ + 
Sbjct: 308 FTHLFERNLIARDPI---------INNVGLLNPTMHVMFMYGEHDWMDKYAGYLTTESML 358

Query: 404 SLNKKSNVFIAPNSGHHLYFDN 425
               K++    P++GH+L+ DN
Sbjct: 359 KNKAKASYIEVPDAGHNLFLDN 380

>YDR125C Chr4 complement(701397..702758) [1362 bp, 453 aa] {ON}
           ECM18Protein of unknown function, similar to Rlp24p
          Length = 453

 Score = 65.5 bits (158), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 90/345 (26%), Positives = 137/345 (39%), Gaps = 82/345 (23%)

Query: 149 ILIHGYGAGLGFYINTLQHLSMDNWCIHAVDLPGYGFSS--------------------- 187
           +LIHGY A    +      LS     ++++D+P  G SS                     
Sbjct: 130 LLIHGYAASSMSFFRNYPGLSKHIRNLYSIDMPASGLSSVPSLEINTTTPLPLDIKFIGE 189

Query: 188 -RLKFPYGTINPRIYSKKDVL----DWFQKRLKTWFHKKGLLAHPENNL----VTAHSMG 238
            + K PY TIN      K V+    D++  R++ W          +N L    V  HS G
Sbjct: 190 NKFKVPY-TINAN--HNKFVIQMYEDFYLDRIEQW--------RIDNKLGKMNVVGHSFG 238

Query: 239 AYIMCHYLNNHPSDFRKIIMCSPAGFYPA---------SNPLTNIPLW---YTYLWDRNY 286
            Y+   Y   +P+   K+ + SP G             SN L  I        +   RN 
Sbjct: 239 GYLSFKYAVKYPNSVNKLCLVSPLGVERNIWSVNNNFHSNTLYTIDFKNPNSKFYSKRNM 298

Query: 287 SP-------FSLVRISGPLGSKLTSGWSYSRFFHSNQTISNELSLALHTYAYSIFNLPGS 339
            P       F ++R+ GPLG+KL   W+Y    +S        SLA   Y + +F   G 
Sbjct: 299 IPKYLFEQQFHILRMMGPLGAKLC--WNYIMAAYSRVP-----SLAYKEYIFELFYGKGG 351

Query: 340 GEYSLSHILKAGGDPRTPLQEEFFTCQSTTNNGIRRSNVEYSWL-YGQSDWINKTGGFKI 398
                + I KA       L       +    + ++  NV+   + YGQ DW+NK  G  +
Sbjct: 352 IPEVTTDIFKA-------LFSRCILAKDPLMDSLQYLNVKKLLIVYGQYDWMNKKAGMFM 404

Query: 399 SQFLNSLN---KKSNVFIAPNSGHHLYFDNYMWFN----SYLAKE 436
            + LN+L    + ++    P+SGH+L+ DN   FN    S+L+ E
Sbjct: 405 VKELNNLKNCLEGASYLEIPSSGHNLFLDNPESFNQSIVSFLSDE 449

>Skud_12.167 Chr12 complement(322870..324054) [1185 bp, 394 aa] {ON}
           YLR099C (REAL)
          Length = 394

 Score = 65.5 bits (158), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 74/331 (22%), Positives = 128/331 (38%), Gaps = 60/331 (18%)

Query: 149 ILIHGYGAGLGFYINTLQHLSMDNWCIHAVDLPGYGFSSR-------------LKF---- 191
           +LIHGY A    +  T + LS +   ++A+DLP  G S               L+F    
Sbjct: 74  VLIHGYAASSMAFYRTFESLSDNIKDLYAIDLPANGASQAPALQVDKTKKIKPLRFKHIE 133

Query: 192 -----PYGTINPRIYSKKDVLD----WFQKRLKTWFHKKGLLAHPENNLVTAHSMGAYIM 242
                P    +P     K  L+    +F  R++ W     L        V  HS G YI 
Sbjct: 134 DDVVVPVLDKHPPAEDIKSHLEQYENYFVDRIEQWRKDNKL----RRINVVGHSFGGYIS 189

Query: 243 CHYLNNHPSDFRKIIMCSPAGFYPASN-------PLTNIPLWYTYLWDRNYS-------- 287
             Y   +P+   K+ + SP G   + +       P T  PL +T    R Y+        
Sbjct: 190 FKYALKYPNSIDKLCLISPLGVENSIHAIAHKWEPNTTYPLTFTDPSSRYYTRKLNVPQF 249

Query: 288 ----PFSLVRISGPLGSKLTSGWSYSRFFHSNQTISNELSLALHTYAYSIFNLPGSGEYS 343
                 ++++  GP+GSKL S +  + +      +  +    LH++      +       
Sbjct: 250 IFENQLNVLKWMGPIGSKLCSNYISTAYVKVPDQLYKDY--LLHSFVGKNQTVQPQTIKV 307

Query: 344 LSHILKAGGDPRTPLQEEFFTCQSTTNNGIRRSNVEYSWLYGQSDWINKTGGFKISQFLN 403
            +H+ +     R P+           N G+        ++YG+ DW++K  G+  ++ + 
Sbjct: 308 FTHLFERNLIARDPI---------INNVGLLNPATHVMFMYGEHDWMDKYAGYLTTESML 358

Query: 404 SLNKKSNVFIAPNSGHHLYFDNYMWFNSYLA 434
               K++    P++GH+L+ DN   F S L 
Sbjct: 359 KNKAKASYVEVPDAGHNLFLDNPHHFTSSLV 389

>Kpol_543.49 s543 complement(108945..110234) [1290 bp, 429 aa] {ON}
           complement(108945..110234) [1290 nt, 430 aa]
          Length = 429

 Score = 64.3 bits (155), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 83/342 (24%), Positives = 130/342 (38%), Gaps = 83/342 (24%)

Query: 149 ILIHGYGAGLGFYINTLQHLSMDNWCIHAVDLPGYGFS-----------SRLKFPYGTIN 197
           +LIHGY A    Y  T   LS     ++A+DLP +G S           S +K      N
Sbjct: 103 LLIHGYAASSLAYFRTFSGLSDKIKNLYAIDLPSFGLSNAPPLDFKEKVSDIKIKLSDDN 162

Query: 198 PRIY----SKKDVL----------DWFQKRLKTWFHKKGLLAHPENNLVTAHSMGAYIMC 243
            +      ++ D L          D++ ++++ W     L    + NLV  HS G YI  
Sbjct: 163 TKFKISDSNRVDSLDLKKLIGKYEDYYVEKIEDWRKANKL---EKINLV-GHSFGGYISF 218

Query: 244 HYLNNHPSDFRKIIMCSPAGFYPASNPLTN-------------IPLWYTYLWDRNYSPF- 289
            Y   +P    ++ + SP G     + + N              P    Y  +R    F 
Sbjct: 219 KYAIKYPDAINRLCLVSPLGMESNIHSVNNNFETKKEYPLDLEDPSSRFYAKERRIPNFL 278

Query: 290 -----SLVRISGPLGSKLTSGWSYSRFFHSNQTISNELSLALHTYAYSIFNLPGSGEYSL 344
                +++R  GP+GSKL   W+Y     S + + N                P   EY  
Sbjct: 279 FKNQLNVLRWMGPIGSKLC--WNYIN--ASYRRVPN----------------PLFKEYLF 318

Query: 345 SHILKAGGDPRTPLQ--EEFFT----CQSTTNNGIRRSNVEYS-WLYGQSDWINKTGGFK 397
             +   GG P   +      FT     +    + I +   E    LYG+ DW+N   G+ 
Sbjct: 319 ELLYGKGGMPSVTIDIFTNLFTRSLLARDPIMDSISKLKAEKVLLLYGEHDWMNNLAGYN 378

Query: 398 ISQFLNSLNKKSNV--------FIAPNSGHHLYFDNYMWFNS 431
           + + LN L   +N+           P++GH+L+ DN  +FNS
Sbjct: 379 MVESLNQLKPNNNISTIDYANYVEVPDAGHNLFLDNPQFFNS 420

>KAFR0B02830 Chr2 complement(578530..579705) [1176 bp, 391 aa] {ON}
           Anc_8.284 YDR125C
          Length = 391

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 81/365 (22%), Positives = 141/365 (38%), Gaps = 85/365 (23%)

Query: 114 RQGQIIKTYVNENEYINEFQILPNTS---TPYDRLKHLILIHGYGAGLGFYINTLQHLSM 170
           +  Q++   +NE  + N     PN S   TP       +LIHGY A    +  T   LS 
Sbjct: 45  KTNQMVNNEINEWHFHN-----PNASKIKTP------TLLIHGYAASSMAFHRTFNRLST 93

Query: 171 DNWCIHAVDLPGYGFSS--------RLKFPYGTINPRI--YSKKDVLD------------ 208
           D   ++A+DLPG G SS        ++K    T+N     ++ K  +D            
Sbjct: 94  DIKDLYAIDLPGNGLSSAPELSDVIKMKDLKITLNKSKDGFTLKKAIDLEIEKANLAKYE 153

Query: 209 -WFQKRLKTWFHKKGLLAHPENNLVTAHSMGAYIMCHYLNNHPSDFRKIIMCSPAGFYPA 267
            ++  R+  W    G+    E   V  HS G +I   Y   HP+    +I+ SP G    
Sbjct: 154 NYYLSRIDEWRKFHGI----EKLNVIGHSFGGFISFKYAITHPNQVNDLILVSPLGMEKN 209

Query: 268 SNPL-TNIPLWYTYLWD----------RNY--------SPFSLVRISGPLGSKLTSGWSY 308
            + L  N  L   Y  D          R++        +  +++R  GPLG ++   +  
Sbjct: 210 IHSLNNNFELETKYTLDFENPASLYYARSFNVPSILFNNQLNILRWMGPLGGRMARQY-- 267

Query: 309 SRFFHSNQTISNELSLALHTYAYSIF----NLPGSGEYSLSHILKAGGDPRTPLQEEFFT 364
                 +        +A   Y Y +F    + P     + +++       R P+ +    
Sbjct: 268 -----IDMAYKKVPDVAYKNYLYYVFYDGKSFPKVTINNFTNMFSKNLLARDPIMDNLLK 322

Query: 365 CQSTTNNGIRRSNVEYSWLYGQSDWINKTGGFKISQFLNSLNKKSNVFI----APNSGHH 420
            ++           +   +YG+ DW++K  G+ + + L+  N K    +     P++GH+
Sbjct: 323 LRAK----------KVMLVYGEHDWMDKYAGYNMVELLSKSNYKLKDTVHYVEIPDAGHN 372

Query: 421 LYFDN 425
           L+ DN
Sbjct: 373 LFLDN 377

>Suva_10.183 Chr10 complement(344549..345733) [1185 bp, 394 aa] {ON}
           YLR099C (REAL)
          Length = 394

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 69/327 (21%), Positives = 131/327 (40%), Gaps = 52/327 (15%)

Query: 149 ILIHGYGAGLGFYINTLQHLSMDNWCIHAVDLPGYGFSS---------------RLKFPY 193
           +LIHGY A    +  T ++LS +   ++A+DLP  G S                R K   
Sbjct: 74  VLIHGYAASSMAFYRTFKNLSDNIKDLYAIDLPANGASEAPALQVEGVKKIKSLRFKHVE 133

Query: 194 GTINPRIYSKKDVLDWFQKRL---KTWFHKKGLLAHPENNL----VTAHSMGAYIMCHYL 246
             +   +  K+   +  +  L   +++F  +      +NNL    V  HS G YI   Y 
Sbjct: 134 DDMVTPVLDKRPPAEEIKSHLEQYESYFVDRIEQWRKDNNLRKINVVGHSFGGYISFKYA 193

Query: 247 NNHPSDFRKIIMCSPAGFYPASNPL-------TNIPLWYTYLWDRNYS------------ 287
             +P+   K+ + SP G   + + +       T  P+ +T    R Y+            
Sbjct: 194 LKYPNSIDKLCLISPLGVENSIHAINHKWEANTTYPVTFTDPSSRYYTRKLNVPQFIFEN 253

Query: 288 PFSLVRISGPLGSKLTSGWSYSRFFHSNQTISNELSLALHTYAYSIFNLPGSGEYSLSHI 347
             ++++  GP+GSKL S +  + +      +  +    LH++     ++        + +
Sbjct: 254 QLNVLKWMGPIGSKLCSSYISTAYVKVPDQLYKD--YLLHSFVGKNQSVQPQTIKVFTQL 311

Query: 348 LKAGGDPRTPLQEEFFTCQSTTNNGIRRSNVEYSWLYGQSDWINKTGGFKISQFLNSLNK 407
            +     R P+           N G+        ++YG+ DW++K  G+  ++ +     
Sbjct: 312 FERNLIARDPI---------INNVGLLNPATHVMFMYGEHDWMDKYAGYLTTESMLKNKA 362

Query: 408 KSNVFIAPNSGHHLYFDNYMWFNSYLA 434
           K++    P++GH+L+ DN   F S L 
Sbjct: 363 KASYMEVPDAGHNLFLDNPNHFTSSLV 389

>SAKL0H16500g Chr8 (1450828..1452087) [1260 bp, 419 aa] {ON} similar
           to uniprot|Q04623 Saccharomyces cerevisiae YDR125C
          Length = 419

 Score = 63.2 bits (152), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 83/336 (24%), Positives = 133/336 (39%), Gaps = 76/336 (22%)

Query: 149 ILIHGYGAG-LGFYINTLQHLSMDNWCIHAVDLPGYGFSSRLKFPYGTINPRIYSKKDVL 207
           +L+HGY A  +GF+ N    LS     ++A+DLP  G S       G+  P + S  + L
Sbjct: 100 LLLHGYAAASMGFHRN-FAGLSSRIQNLYAIDLPANGLSP------GSSQPLVVSCGEPL 152

Query: 208 ----DWFQKRLKT-----WFHKKGLLAHPE-------------NNL----VTAHSMGAYI 241
               ++   R K      + H+K  +   E             N L    + AHS G Y+
Sbjct: 153 PMKAEFSNDRFKIPYTLEYLHQKSFIQQLEDYYLNSIEQWRIDNKLNKINIVAHSFGGYL 212

Query: 242 MCHYLNNHPSDFRKIIMCSPAGFYPASNPLTNIPLWYTYLW-DRNY-------------- 286
              Y   +P    ++ + SP G     + + N   W +  W D NY              
Sbjct: 213 STKYAIKYPHAVERLCLVSPLGVERNIHSVNN--HWCSNTWYDLNYEDPGSKYYMRRMRG 270

Query: 287 -------SPFSLVRISGPLGSKLTSGWSYSRFFHSNQTISNELSLALHTYAYSIFNLPGS 339
                  S   L+R+ GPLG+KL   W+Y    +S   + NE       Y + +F     
Sbjct: 271 IPSTVFQSQVKLLRLLGPLGAKLC--WNYINAAYSR--VKNE---KYKEYVFELF----- 318

Query: 340 GEYSLSHILKAGGDPRTPLQEEFFTCQSTTNNGIRRSNVEYSWL-YGQSDWINKTGGFKI 398
             Y    + +   D  T L       +    + ++  +V    L YG+ DW+NK  G  +
Sbjct: 319 --YGKEGVTQTAMDIFTNLFTRQLLAKDPLMDSLQHLHVGRLMLAYGEHDWMNKYAGVLM 376

Query: 399 SQFLNSLNKKSNVF---IAPNSGHHLYFDNYMWFNS 431
           ++  N L  KS+     +  +SGH+++ DN   FN 
Sbjct: 377 TKEFNHLRGKSDAATYTVISSSGHNMFLDNPDEFNE 412

>AGR062C Chr7 complement(833212..834366) [1155 bp, 384 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR099C
           (ICT1) and YDR125C (ECM18)
          Length = 384

 Score = 63.2 bits (152), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 76/318 (23%), Positives = 119/318 (37%), Gaps = 58/318 (18%)

Query: 149 ILIHGYGAGLGFYINTLQHLSMDNWCIHAVDLPGYGFSSRLKFPYGTINPRIYSK----- 203
           +L+HGY +    +   L  L      ++A+DLPG G S  L  P G    R  ++     
Sbjct: 86  VLLHGYASSAVSFHRNLAALGAQVEQLYALDLPGNGMSQEL--PLGPAAARALARRCGAR 143

Query: 204 ---KDVLDWFQKRLKTWFHKKGLLAHPENNLVTAHSMGAYIMCHYLNNHPSDFRKIIMCS 260
              + + D++   L+ W    GL    E      HS G Y+   Y   HP+  +++ + S
Sbjct: 144 ADIRALADYYLDALERWRAANGL----ETLNAAGHSFGGYLAFKYALRHPARVQRLCLVS 199

Query: 261 PAGFYP--ASNPLTNIPLWYTYLWDRNYSP----------------FSLVRISGPLGSKL 302
           P G     A   +               SP                  ++R  GPLG+ L
Sbjct: 200 PLGVEAQTAGRRMPGRATRRRTRPPTPASPHYTRAAALPPLLFEQQLRVLRWLGPLGAHL 259

Query: 303 TSGWSYSRFFHSNQTISNELSLALHTYAYSIFNLPGSGEYSLSHILKAGGDPRTPLQEEF 362
              W Y      N + S       H Y +++            H L     PR  L    
Sbjct: 260 L--WQYV-----NASFSRVPGREFHRYTFALL-----------HRLALRPLPRK-LFTGL 300

Query: 363 FTCQSTTNNGIRRSNVE-----YSWLYGQSDWINKTGGFKISQFLNSLNKK--SNVFIAP 415
           FT      + +  S  E        LYG  DW++   G  +   LN+L  +  +++ I P
Sbjct: 301 FTNALLARDPLLDSLAELKVPNVQLLYGDHDWMDARAGRALVAELNALRGRPDASLAIVP 360

Query: 416 NSGHHLYFDNYMWFNSYL 433
            +GH+L+ DN   F+S+L
Sbjct: 361 AAGHNLFLDNPEDFHSWL 378

>NCAS0B05120 Chr2 complement(953798..954988) [1191 bp, 396 aa] {ON} 
          Length = 396

 Score = 62.4 bits (150), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 74/342 (21%), Positives = 130/342 (38%), Gaps = 73/342 (21%)

Query: 149 ILIHGYGAGLGFYINTLQHLSMDNWCIHAVDLPGYGFSS--------------------- 187
           +LIHGY A    Y  TL  LS +   ++ +DLP    SS                     
Sbjct: 70  VLIHGYAASSMAYYRTLATLSKNVKDVYVIDLPANSLSSVPPHSDISHLKINKIKVVQVS 129

Query: 188 ----RLKFPYGTINPRIYS---KKDVLD----WFQKRLKTWFHKKGLLAHPENNLVTAHS 236
                 K+ +    P  Y    +K V+D    ++   ++ W  ++      + NLV  HS
Sbjct: 130 KDKENEKYVFKVAPPHAYDAQREKQVIDKLENYYLDVIEKW--RRANYGLDKFNLV-GHS 186

Query: 237 MGAYIMCHYLNNHPSDFRKIIMCSPAGFYPASNPLTNI-------------PLWYTYLWD 283
            G Y+   Y   +P    K+ + SP G       + N+             P    Y   
Sbjct: 187 FGGYLSFKYAIKYPEVVDKLCLVSPLGVASNIRSVNNVFDTKKEYVMDLQNPGSMLYNRQ 246

Query: 284 RNYSPF------SLVRISGPLGSKLTSGWSYSRFFHSNQTISNELSLALHTYAYSIFNLP 337
           R    F      ++++  GP+GSKLT      ++ +S       +    + Y Y    +P
Sbjct: 247 RMIPNFLFNNQLNVLKWMGPVGSKLTR-----KYINSAYVKVPTMDYKDYLYEYFQMGVP 301

Query: 338 GSGEYSLSHILKAGGDPRTPLQEEFFTCQSTTNNGIRRSNVEYSWLYGQSDWINKTGGFK 397
                  + +       R P+ +     +ST           +  +YG +DW++K  G+ 
Sbjct: 302 QVNVDIFTKLFSRNLMARDPIMDNMNRLKST----------RFMMMYGDNDWMDKFSGYT 351

Query: 398 ISQFLNSL----NKKSNVFIAPNSGHHLYFDNYMWFNSYLAK 435
           + Q +N +    ++K+     P++GH+L+ DN   F++ L K
Sbjct: 352 LVQNINKIKNNFDRKATYVEIPDAGHNLFLDNPEDFSNNLIK 393

>NDAI0J01200 Chr10 (280820..282103) [1284 bp, 427 aa] {ON} 
          Length = 427

 Score = 60.5 bits (145), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 77/336 (22%), Positives = 128/336 (38%), Gaps = 68/336 (20%)

Query: 149 ILIHGYGAGLGFYINTLQHLSMDNWCIHAVDLPGYGFSS---------------RLKFPY 193
           +L+HGY      +  T   LS     ++A+D P  G S                ++KF  
Sbjct: 107 LLLHGYATSSIAFFRTFGPLSKQIRDLYAIDFPANGLSKAPPLNVNHLKKHTPYKVKFKD 166

Query: 194 GTINPRIYSKKDV------LDWFQKRLKTWFHKKGLLAHPENNLVTAHSMGAYIMCHYLN 247
                +I    DV      ++ ++        K  L    E   +  HS G Y    Y  
Sbjct: 167 DNTKFQISHTVDVQLQKETIEHYENYYLDAVRKWQLTNKIEKFNLVGHSFGGYFAYKYAL 226

Query: 248 NHPSDFRKIIMCSPAG----FYPASNPLTNIPLWYTYLWD-------RNYS--------P 288
            +P    K+ + SP G     Y  +N   +  ++   L D       R +          
Sbjct: 227 RYPDSVDKLCLVSPLGVERNIYSVNNNFEDKKVYNLELEDPTSKYYGRTFQIPKCLFEGQ 286

Query: 289 FSLVRISGPLGSKLTSGWSYSRFFHSNQTISNELSLALHTYAYSIFNLPGSGEYS----- 343
           F ++R  GPLG + T  W+Y      N +     S+    Y + +  L G+ + S     
Sbjct: 287 FDILRKFGPLGPRFT--WNYI-----NSSYRRVPSMEFKEYIFEL--LYGNRKTSPILTE 337

Query: 344 -LSHILKAGGDPRTPLQEEFFTCQSTTNNGIRRSNVEYSWLYGQSDWINKTGGFKISQFL 402
             S+I+      R P+ +          + ++ SNV    +YGQ DW+N   G+ + + L
Sbjct: 338 VFSNIVSRNLLARDPILDSI--------DELKASNV--MLMYGQEDWMNSQAGYLMVKEL 387

Query: 403 NSLNKKSNV---FIAPNSGHHLYFDNYMWFNSYLAK 435
           N + +  N       PN+GH+L+ DN  +F S L +
Sbjct: 388 NEIRENPNAASYVEVPNAGHNLFLDNPDFFCSSLTR 423

>Ecym_4285 Chr4 (612053..613270) [1218 bp, 405 aa] {ON} similar to
           Ashbya gossypii AGR062C
          Length = 405

 Score = 58.9 bits (141), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 71/334 (21%), Positives = 125/334 (37%), Gaps = 70/334 (20%)

Query: 149 ILIHGYGAGLGFYINTLQHLSMDNWCIHAVDLPGYGFSSRLKFPYGTINPRIY------- 201
           +L+HGY      Y   +  LS     ++ +DLP  G S  L        P ++       
Sbjct: 87  LLLHGYATSSMCYHRNMPQLSEGIKHLYTIDLPANGLSKELPLELDIAKPIVFKPEFNSV 146

Query: 202 -----------------SKKDVLDWFQKRLKTWFHKKGLLAHPENNLVTAHSMGAYIMCH 244
                            + + + D++   ++ W  K  L A    NLV  HS G YI   
Sbjct: 147 KSEFHIPYTIDGLHHRCAIQKLEDYYIDSIELWRRKNSLGA---INLV-GHSFGGYISFK 202

Query: 245 YLNNHPSDFRKIIMCSPAGFY----------------------PASNPLTNIPLWYTYLW 282
           Y   +P + +K+ + SP G                        P+S    N  +   +++
Sbjct: 203 YSIKYPQNVKKLCLISPIGVERNIYSVHNNWRSNCPYSIDYEDPSSKHFANKTMIPEFVF 262

Query: 283 DRNYSPFSLVRISGPLGSKLTSGWSYSRFFHSNQTISNELSLA-LHTYAYSIFNLPGSGE 341
           +       L+R+ GPLG+KL  GW Y    +S   + N L L  + T  Y    +  +  
Sbjct: 263 NEQT---KLLRLMGPLGAKL--GWKYINAVYSK--VPNFLYLEFIFTLIYGKNVMTDTSR 315

Query: 342 YSLSHILKAGGDPRTPLQEEFFTCQSTTNNGIRRSNVEYSWLYGQSDWI-NKTGGFKISQ 400
              +++       R P+ +                  +   LYG+ DW+ ++ G   + +
Sbjct: 316 NIFTYLFTNSLLARDPMLDSLEHLHVD----------KLLMLYGEHDWVRSQPGKMMVEE 365

Query: 401 FLNSLNKKSNVF-IAPNSGHHLYFDNYMWFNSYL 433
           F    +  S    + P++ H+L+ DN ++FN  L
Sbjct: 366 FNKQRSHPSGTLTVVPDASHNLFLDNPVFFNVAL 399

>NCAS0B03710 Chr2 (664097..665389) [1293 bp, 430 aa] {ON} Anc_8.284
          Length = 430

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 79/328 (24%), Positives = 125/328 (38%), Gaps = 74/328 (22%)

Query: 149 ILIHGYGAGLGFYINTLQHLSMDNWCIHAVDLPGYGFSSRLKF---PYG----------- 194
           +L+HGY A    +  T   LS     ++A DLPG G S    F    YG           
Sbjct: 112 LLLHGYAASSLCFFRTFVPLSRSIKNLYATDLPGNGLSKNKSFFSVMYGNEYMKVKYEEN 171

Query: 195 ---------TINPRIYSKKDVLDWFQKRLKTWFHKKGLLAHPENNLVTAHSMGAYIMCHY 245
                    ++  +  S K   D++   ++ W     L   P+ NLV  HS G Y+   Y
Sbjct: 172 NKFSIKYLNSLKDQTNSIKHSEDYYIDAIREWQLSNNL---PKINLV-GHSFGGYLSFKY 227

Query: 246 LNNHPSDFRKIIMCSPAG----FYPASNPLTNIPLWYTYLWDRNYSP------------- 288
              +P +  K+ + SP G     Y  +N L        YL+D +YS              
Sbjct: 228 ALRYPDNVNKLCLVSPLGVESNLYSVNNSLKE-----NYLYDVDYSDPKSSYYSRNFAIP 282

Query: 289 -------FSLVRISGPLGSKLTSGWSYSRFFHSNQTISNELSLALHTYAYSIFNLPGSGE 341
                  F ++R  GP+G+++   W+Y         +S+   +    Y   +F+L     
Sbjct: 283 KSLFEGQFGILRWMGPIGARVC--WNY--------ILSSYKRVPSMKYKEYLFHLL---- 328

Query: 342 YSLSHILKAGGDPRTPLQEEFFTCQSTTNNGIRRSNVE-YSWLYGQSDWINKTGGFKISQ 400
           +  +  L       T L       +    + I +   E    +YGQ DW+NK  G+ +  
Sbjct: 329 FGNAKKLVTSAKTFTNLFTRNLLAKDPIMDSIEKLQCEKLMVMYGQHDWMNKYAGYCLIA 388

Query: 401 FLNSL--NKKSNVFIA-PNSGHHLYFDN 425
            LN+    K +  F   P +GH+L  DN
Sbjct: 389 KLNNYRSTKDAGYFTEIPEAGHNLILDN 416

>Kwal_56.23702 s56 complement(668862..670112) [1251 bp, 416 aa] {ON}
           YDR125C (ECM18) - (putative) involved in cell wall
           biogenesis [contig 174] FULL
          Length = 416

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 80/338 (23%), Positives = 125/338 (36%), Gaps = 68/338 (20%)

Query: 149 ILIHGYGAG-LGFYINTLQHLSMDNWCIHAVDLPGYGFSSRLKFPYGTINP---RIYSKK 204
           +L+HGY A  +GF+ N    LS     ++A+DLP  G S  L        P   +I   K
Sbjct: 100 LLVHGYAASSMGFHRN-FPGLSQSIKDLYAIDLPASGLSPALPLEMRCTQPLDLKINMSK 158

Query: 205 DVL-------------------DWFQKRLKTWFHKKGLLAHPENNLVTAHSMGAYIMCHY 245
           D                     D++   ++ W H   L   P N  + AHS G Y+   Y
Sbjct: 159 DTFSLPYTINYLHHKSLIQNYEDYYLDAIEQWRHDNKL--GPIN--IVAHSFGGYLSFKY 214

Query: 246 LNNHPSDFRKIIMCSPAGFYPASNPLTNIPLW-----YTYLWDRNYSPF----------- 289
               P    K+ + SP G     N  +    W     Y   ++   S F           
Sbjct: 215 AVKFPHAVEKLCLVSPLGV--ERNIFSVNNQWRSNTSYNLDFENPASKFYIKKGPAIPRL 272

Query: 290 ------SLVRISGPLGSKLTSGWSYSRFFHSNQTISNELSLALHTYAYSIFNLPGSGEYS 343
                  L+R  GPLG+KL+  W+Y      N   S   SL    Y + +        Y 
Sbjct: 273 VFEQQTQLLRNLGPLGAKLS--WNY-----INAAYSRVPSLDYKKYVFELL-------YG 318

Query: 344 LSHILKAGGDPRTPLQEEFFTCQSTTNNGIR--RSNVEYSWLYGQSDWINKTGGFKISQF 401
            + + +   D    L       +    + I+    + +   +YG  DW+N+  G ++   
Sbjct: 319 KNGLNQTSKDLFIGLFNNRVLARDPLLDSIQFFGKSAKLMCIYGDHDWMNRRAGMEMVNE 378

Query: 402 LNSLNKKSNVFIAPNSGHHLYFDNYMWFNSYLAKEMTL 439
            N L  ++      +SGH+L+ DN   FN  L + + L
Sbjct: 379 ANQLGIEAKYNEVSSSGHNLFLDNPEEFNDKLVRFLKL 416

>NDAI0J01210 Chr10 (282384..283634) [1251 bp, 416 aa] {ON} Anc_8.284
          Length = 416

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 80/339 (23%), Positives = 127/339 (37%), Gaps = 78/339 (23%)

Query: 149 ILIHGYGAGLGFYINTLQHLSMDNWCIHAVDLPGYGFSSRLKFPYGTINPRIYSKK---- 204
           +L+HGY A    +  T   LS +   ++A+DLP  G S  +         R+Y  K    
Sbjct: 98  LLLHGYAASSMSFYRTFAPLSNNFKNLYAIDLPANGLSVAIPLKITKQRKRLYEVKYKEN 157

Query: 205 -------DVLDWFQKRLKTWFHKKGLLA----HPENNL----VTAHSMGAYIMCHYLNNH 249
                   V    QK L   +    L A       NN+    +  HS G Y    Y    
Sbjct: 158 NKFSISYPVPIEEQKPLIEQYENYYLDAMRSWQVANNIEKFNLVGHSFGGYFSFKYALRF 217

Query: 250 PSDFRKIIMCSPAGF----YPASNPLTNIPLWYTYLWDRNYSPF---------------- 289
           P    K+ + SP G     +   N      ++   L D   SPF                
Sbjct: 218 PDSINKLCLVSPLGMESNIFSIHNKFEENKIYNVNLTDPT-SPFYGKKFQIPNYLFENQL 276

Query: 290 SLVRISGPLGSKLTSGWSYSRFFHSNQTISNELSLALHTYAYSIFNLPGSGEYSLSHILK 349
            ++R  GP G++L   W+Y     + + +    S+    Y + +F               
Sbjct: 277 DVIRKLGPFGARLC--WNY--ILSAYKRVP---SMEYKEYLFELF--------------- 314

Query: 350 AGGDPRTPLQEEFFTCQSTTN-----------NGIRRSNVEYSWLYGQSDWINKTGGFKI 398
            G    +P+  E FT   T N           + ++ SNV    +YG+ DW+N+  G+ +
Sbjct: 315 YGNRQVSPILCELFTNLLTRNLLARDPILDSIDQLQLSNVLV--MYGEHDWMNRYAGYCM 372

Query: 399 SQFLNSLNKKSNV---FIAPNSGHHLYFDNYMWFNSYLA 434
              LN++ +  N       P +GH+L+ DN  +F+S LA
Sbjct: 373 VSRLNNIRRTPNTAQYLQVPAAGHNLFLDNPEYFSSALA 411

>ZYRO0D06666g Chr4 (576172..577314) [1143 bp, 380 aa] {ON} similar
           to uniprot|Q04623 Saccharomyces cerevisiae YDR125C
          Length = 380

 Score = 55.8 bits (133), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 76/335 (22%), Positives = 124/335 (37%), Gaps = 68/335 (20%)

Query: 149 ILIHGYGAGLGFYINTLQHLSMDNWCIHAVDLPGYGFSSRLKFPYGTINP---------- 198
           +LIHGY A    Y  T Q L+     ++ +DLP  G S  L        P          
Sbjct: 62  LLIHGYAASSMAYYRTFQGLTDKISDLYTIDLPSNGLSKELPLILDGQTPPPLKVEIHKD 121

Query: 199 ----RIYSKKDVL----------DWFQKRLKTWFHKKGLLAHPENNLVTAHSMGAYIMCH 244
               +I  + D            D++   ++ W    G+      NLV  HS G YI   
Sbjct: 122 GSKFKIIERVDAEHCRSVVKQYEDYYLDSIELWRKHNGI---GRFNLV-GHSFGGYIAFK 177

Query: 245 YLNNHPSDFRKIIMCSPAGF------------------YPASNPLTNIPLWYTYLWDRNY 286
           Y   +P    ++ + SP G                     +++P + +   Y   W+   
Sbjct: 178 YAVKYPKAVEQLGLISPLGVESNIYSVNNDWKLDTVYEMESTDPASRM---YGKNWEIPK 234

Query: 287 SPF----SLVRISGPLGSKLTSGWSYSRFFHSNQTISNELSLALHTYAYSIFNLPGSGEY 342
             F     L+R  GP+G+KL   W+Y    + N+  + E    +    Y    +P +   
Sbjct: 235 VLFERQTELLRWMGPIGAKLC--WNYITAAY-NKLPTMEYKDYVFELLYGNGGIPKTARK 291

Query: 343 SLSHILKAGGDPRTPLQEEFFTCQSTTNNGIRRSNVEYSWLYGQSDWINKTGGFKISQFL 402
               +       R P+ +      S    G R+  +    LYG SDW+N   G+++ + L
Sbjct: 292 VFGGLFTRSLLARDPIMD------SMDKLGARKVLL----LYGDSDWMNNYAGYRMVELL 341

Query: 403 NSLNKK--SNVFIAPNSGHHLYFDNYMWFNSYLAK 435
           N    K  +     P++ H+L+ DN   FN  L +
Sbjct: 342 NQKRGKGYATYDEVPDARHNLFLDNPDSFNDKLIQ 376

>TPHA0A01690 Chr1 (344521..345738) [1218 bp, 405 aa] {ON} Anc_8.284
           YDR125C
          Length = 405

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 75/353 (21%), Positives = 133/353 (37%), Gaps = 86/353 (24%)

Query: 149 ILIHGYGAGLGFYINTLQHLSMDNWCIHAVDLPGYGFSSRLKFPYGTINPRI-------- 200
           +L+HGY      Y      LS     ++++DLP +G S   + P   +   +        
Sbjct: 65  LLVHGYATSSLAYYRNFAGLSSYIKDLYSIDLPTFGLSKTPELPTRKVTKNLKVTLSNSN 124

Query: 201 -------------YSKKDVL-----------------DWFQKRLKTWFHKKGLLAHPENN 230
                         SK D+                  +++  R++ W  +  L    + N
Sbjct: 125 DKSDDPKKITSFQLSKDDIKHNEKYYNETKKELEINENYYIDRIEKWRIENKL---DKIN 181

Query: 231 LVTAHSMGAYIMCHYLNNHPSDFRKIIMCSPAGF----YPASNPLTNIPLWYTYLWD--- 283
           LV  HS G Y+   Y   +P    K+ + SP G     Y  +N   N  ++     D   
Sbjct: 182 LV-GHSFGGYLSYKYATKYPDSIEKLCLVSPLGMESNIYSINNKFENDKIYEIEEEDPSS 240

Query: 284 ------RNYSPF------SLVRISGPLGSKLTSGWSYSRFFHSNQTISNEL-SLALHTYA 330
                 R    F      +++R  GP+GS LT  W Y +   S + + + L    +H   
Sbjct: 241 IFFTNTRTIPKFLFNNQLNVLRWLGPVGSTLT--WKYIK--ASYRRVDDALYKDYIHELI 296

Query: 331 YSIFNLPGSGEYSLSHILKAGGDPRTPLQEEFFTCQSTTNNGIRRSNVEYSWLYGQSDWI 390
           Y    +  +   + +++       + P+ +        T + ++  NV    LYGQ DW+
Sbjct: 297 YGKGGMEETTIKTFTNLFTTKLLAKDPITD--------TVDKLKAKNV--LLLYGQEDWM 346

Query: 391 NKTGGFKISQFLNSLNKKSNVFI----------APNSGHHLYFDNYMWFNSYL 433
           N   G+++++ LN L   +   +           P +GH+L+ DN  +FN  L
Sbjct: 347 NNYAGYQMTKKLNELKGYNTSKVGELNYATYMEVPEAGHNLFLDNPSFFNKAL 399

>CAGL0M11462g Chr13 complement(1129244..1130404) [1161 bp, 386 aa]
           {ON} similar to uniprot|Q12385 Saccharomyces cerevisiae
           YLR099c ICT1
          Length = 386

 Score = 53.9 bits (128), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 78/352 (22%), Positives = 128/352 (36%), Gaps = 82/352 (23%)

Query: 149 ILIHGYGAGLGFYINTLQHLSMDNWCIHAVDLPGYGFSS-----------RLKFP----- 192
           +L+HGYGA    Y      LS     ++A+DLP  G S            + KF      
Sbjct: 48  LLVHGYGASSMAYHRCFAPLSRHIRDLYAIDLPANGLSEAPPLVAEGEAPKAKFKIEENK 107

Query: 193 YGTINPRIYSKKDVLDWFQKR---LKTWFHKKGLLAH-------------PENNL----V 232
           +  +     + + V D    +   L+T   K+  L                ENNL    +
Sbjct: 108 FTVVQGARRAAEPVTDAQVDQELMLRTHREKRRYLQQYEDYYVESIEQWRKENNLDKFNL 167

Query: 233 TAHSMGAYIMCHYLNNHPSDFRKIIMCSPAGFYPASNPLTNI-------------PLWYT 279
             HS G Y+   Y   +P    K+ + SP G     + + N              P  Y 
Sbjct: 168 VGHSFGGYLSYKYALKYPESVNKLCLLSPLGMERNIHSINNTFEENVVYELQESDPSSYL 227

Query: 280 YLWDRNY------SPFSLVRISGPLGSKLTSGWSYSRFFHSNQTISNELSLALHTYAYSI 333
           Y   R        + FS++R  GP+G KL   +        N + +   S A   Y +  
Sbjct: 228 YTRKRKAPKFLFENQFSVLRWMGPIGDKLCLSF-------INSSYAKVPSQAYKDYLFES 280

Query: 334 F----NLPGSGEYSLSHILKAGGDPRTPLQEEFFTCQSTTNNGIRRSNVEYSWLYGQSDW 389
           F    +      ++L H+       R P+ +        T + ++  +V  S  YG  DW
Sbjct: 281 FLGKKHFAKQNVHALKHLFTRSLLARDPIMD--------TIDKLKVPDV--SVFYGDHDW 330

Query: 390 INKTGGFKISQFLNSLNKKS------NVFIAPNSGHHLYFDNYMWFNSYLAK 435
           +N   G+ + + L      S      +    P++GH+L+ DN  +F+  L +
Sbjct: 331 MNSYAGYLMVERLKKFRVASTSGGSASYLEVPDAGHNLFLDNPDYFSKKLVQ 382

>KLLA0F19624g Chr6 complement(1817206..1818435) [1230 bp, 409 aa]
           {ON} similar to uniprot|Q04623 Saccharomyces cerevisiae
           YDR125C ECM18 Protein of unknown function, similar to
           Rlp24p
          Length = 409

 Score = 53.5 bits (127), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 84/339 (24%), Positives = 127/339 (37%), Gaps = 77/339 (22%)

Query: 149 ILIHGYGAGLGFYINTLQHLSMDNWCIHAVDLPGYGFSSRLKFPYGTINPRIYSKKDVLD 208
           ++IHGY A    +    + LS+    ++AVDLPG G S  L     ++      K D ++
Sbjct: 90  LMIHGYAASSMTFFRNFEQLSLSLKDVYAVDLPGNGLSKELPLSVDSM-----QKPDRVE 144

Query: 209 WFQKRLKTWFHK----------KGLLAHPENNLVTA-----------------HSMGAYI 241
            F + +K  + +          K  LAH E+  V A                 HS G Y+
Sbjct: 145 -FNETVKGQYFRLQNPVDEEKYKKHLAHYEDYYVDALEKWRKENKLSKINLVGHSYGGYL 203

Query: 242 MCHYLNNHPSDFRKIIMCSPAG----FYPASNPL---------TNIPLWYTYLWDRNYSP 288
              Y   +P +  K+ + SP G     +   N L         +  P    Y   RN   
Sbjct: 204 TFKYSLKYPDNVHKLCLVSPLGVERSIFSIHNHLEPERDYEIQSEDPSKSNYSNKRNIPK 263

Query: 289 FSL------VRISGPLGSKLTSGWSYSRFFHSNQTISNELSLALHTYAYSIFNLPGSGEY 342
             L      +R  GPLG+K  + W Y      N +     S+    Y + +  + G G  
Sbjct: 264 LILQYQNKALRWMGPLGAK--ACWGY-----VNSSYGRVPSVPYREYVFQL--VFGKGIM 314

Query: 343 SLSHILKAGGDPRTPLQEEFFTCQSTTNNGIRRS--NVEYSWL---YGQSDWINKTGGFK 397
           +         D    +  + F+      + I  S   V+ S L   YG+ DW+NK  G  
Sbjct: 315 T---------DTSIRIFNQLFSRSLLAYDPIMDSLDKVKVSKLMLVYGEHDWMNKVAGRL 365

Query: 398 ISQFLNSLNK--KSNVFIAPNSGHHLYFDNYMWFNSYLA 434
             +  NS+ K       I   +GH+L  DN   FNS L 
Sbjct: 366 AIEEFNSIRKSYDGTFDIVSRAGHNLVLDNPSEFNSKLV 404

>TBLA0H01400 Chr8 (312727..313992) [1266 bp, 421 aa] {ON} Anc_8.284
           YDR125C
          Length = 421

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 42/149 (28%), Positives = 73/149 (48%), Gaps = 21/149 (14%)

Query: 289 FSLVRISGPLGSKLTSGWSYSRFFHSNQTISNELSLALHTYAYSIF-NLPGSGEYSLSHI 347
           F++++  GPLGSKLT  +   R+ H    I++E   A   + + +F  +P     + S++
Sbjct: 284 FNVLKCMGPLGSKLTWSFISRRYEH----IASE---AYQNFLFKLFATVPNVTINNFSNM 336

Query: 348 LKAGGDPRTPLQEEFFTCQSTTNNGIRRSNVEYSWLYGQSDWINKTGGFKISQFLNSL-- 405
                  + P+ +     QS           +    YG++DW+NK  GF +++ LN L  
Sbjct: 337 FTRNLLAKDPIMDSINKLQSK----------KLLLFYGENDWMNKEAGFLMAEKLNILKG 386

Query: 406 -NKKSNVFIAPNSGHHLYFDNYMWFNSYL 433
            +K +N    PNSGH+L  D+  +F+  L
Sbjct: 387 DSKYANWIEVPNSGHNLILDDPKFFSKNL 415

 Score = 40.0 bits (92), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 38/167 (22%), Positives = 63/167 (37%), Gaps = 44/167 (26%)

Query: 149 ILIHGYGAGLGFYINTLQHLSMDNWCIHAVDLPGYGFSS------------RLKFPYGTI 196
           +LIHGY A    Y  T ++L+     ++ +DLPG+G S+            + +F    I
Sbjct: 54  VLIHGYAASSMAYYKTFRYLTGSIKDLYTIDLPGFGLSASPKIIINDHNRKKSQFDIKLI 113

Query: 197 NPR-------IYSKKDVL-----------------DWFQKRLKTW--FHKKGLLAHPENN 230
           + +         SKK++                  D++  R++ W  F+  G +      
Sbjct: 114 DSKDSNNNKFSISKKNLKLLENGNIEDKAFISAFDDYYIDRIEKWRKFNNLGKIN----- 168

Query: 231 LVTAHSMGAYIMCHYLNNHPSDFRKIIMCSPAGFYPASNPLTNIPLW 277
            V  HS G YI   Y   +P     + + SP G       + N   W
Sbjct: 169 -VIGHSFGGYISFKYAIKYPDSIENLCLVSPFGMESNVYSINNYDDW 214

>KNAG0H03120 Chr8 (586146..587450) [1305 bp, 434 aa] {ON} Anc_8.284
           YDR125C
          Length = 434

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 79/345 (22%), Positives = 122/345 (35%), Gaps = 92/345 (26%)

Query: 148 LILIHGYGAGLGFYINTLQHLSMDNWCIHAVDLPGYGFSSRLKF---------------- 191
           ++LIHGY +    Y    + LS     ++A+DLP  G S  +                  
Sbjct: 111 VLLIHGYASSSMSYFRNFRGLSSQCKDVYAIDLPANGLSREISLSEDADLKDLVKYSLQV 170

Query: 192 -------------PYGTINPRIYSKKDVL-DWFQKRLKTWFHKKGLLAHPENNL----VT 233
                        PY   N    ++  +L D++   ++ W          EN +    + 
Sbjct: 171 KGLDSPGQVKVTKPYN--NKLCATQLRILEDYYVDEIERW--------RVENQIDQLHLV 220

Query: 234 AHSMGAYIMCHYLNNHPSDFRKIIMCSPAG----FYPASN--PLTNI----------PLW 277
            HS G YI   Y   +P +  K+ + SP G     Y  +N  P  +I          P +
Sbjct: 221 GHSFGGYISYKYALKYPQNVMKLALISPLGVERNLYSVNNHLPQDSIVQGTFEDPSSPSY 280

Query: 278 YTYLWDRNY---SPFSLVRISGPLGSKLTSGWSYSRFFHSNQTISNELSLALHTYAYSIF 334
              L    Y   +   ++R  GP+G++L   W+Y                   T AY+  
Sbjct: 281 LRKLEVPRYIFENQLKILRWGGPMGARLC--WNYI------------------TSAYAKV 320

Query: 335 NLPGSGEYSLSHILKAGGDPRTPLQE--EFFTCQSTTNNGIRRSNVEYS-----WLYGQS 387
                 EY        GG  +T L      FT      + I  S  E       + YGQ 
Sbjct: 321 PSREFKEYLFELFYGDGGITKTALTTFILLFTRNLLARDPIMDSIAELKVKDVMFQYGQY 380

Query: 388 DWINKTGGFKISQFLNS--LNKKSNVFIAPNSGHHLYFDNYMWFN 430
           DW+NK  G + ++ L     N  +     P SGH+L+ D+   FN
Sbjct: 381 DWMNKNAGARAAELLRKQPYNNSALYLEIPESGHNLFLDSPQSFN 425

>TPHA0L01600 Chr12 (338450..339568) [1119 bp, 372 aa] {ON} Anc_8.524
           YBR204C
          Length = 372

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 31/115 (26%), Positives = 56/115 (48%), Gaps = 11/115 (9%)

Query: 149 ILIHGYGAGLGFYINTLQHLSMDNWCIHAVDLPGYGFSSRLKFPYGTINPRIYSKKDVLD 208
           I IHG G  L  ++  L+   + N    AVDLPG+G  S     Y   N   YS   ++ 
Sbjct: 93  IFIHGLGGSLEQFLPLLKLTDLSNKSFIAVDLPGFG-QSEFNDEYNIAN---YSMSSIIG 148

Query: 209 WFQKRLKTWFHKKGLLAHPENNLVTAHSMGAYIMCHYLNNHPSDF--RKIIMCSP 261
           + + ++ + +     L      ++T HSMG Y+  H+   + +++  +KI++ +P
Sbjct: 149 FLKSQVFSRY-----LTTNTKIILTGHSMGCYLALHFYQQYKTEYQIQKIVLLAP 198

>KLTH0G13178g Chr7 (1131579..1132826) [1248 bp, 415 aa] {ON} similar
           to uniprot|Q04623 Saccharomyces cerevisiae YDR125C
          Length = 415

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 72/326 (22%), Positives = 120/326 (36%), Gaps = 73/326 (22%)

Query: 149 ILIHGYGAGLGFYINTLQHLSMDNWCIHAVDLPGYGFS---------------------S 187
           +L+HGY A    +    + LS     ++A+DLP  G S                      
Sbjct: 100 LLLHGYAASSMAFHRNFEGLSKCIRDLYAIDLPANGLSPPQPLEIRCTEPQPLKIEISND 159

Query: 188 RLKFPYGTINPRIYSK--KDVLDWFQKRLKTWFHKKGLLAHPENNLVTAHSMGAYIMCHY 245
             K PY TIN   +    ++  D++   L+ W     L   P N  + AHS G YI   Y
Sbjct: 160 TFKLPY-TINSLHHKSAIQNFEDYYLDALEQWRLDNKL--GPIN--IVAHSFGGYISFRY 214

Query: 246 LNNHPSDFRKIIMCSPAG-----FYPASNPLTNIPLWYTYLWDRNYSPF----------- 289
              +P   +++ + SP G     F   +N  +N    Y   ++   S F           
Sbjct: 215 AVKYPHAVKRLCLLSPLGVERNIFSVNNNWRSNT--QYKLDFENPASKFYIRKGPAIPPA 272

Query: 290 ------SLVRISGPLGSKLTSGWSYSRFFHSNQTISNELSLALHTYAYSIF----NLPGS 339
                  ++R  GPLG++L   W+Y    ++        SL    Y + +F     L  +
Sbjct: 273 IFELQTKVLRGLGPLGARLC--WNYITAAYARVP-----SLKYKQYIFEMFYGKNALTQT 325

Query: 340 GEYSLSHILKAGGDPRTPLQEEFFTCQSTTNNGIRRSNVEYSWLYGQSDWINKTGGFKIS 399
            +   + +       R PL +     +S           +   +YG  DW+N+  G ++ 
Sbjct: 326 SKDIFTGLFTNRLLARDPLLDSLCHVRSK----------KLLLMYGDHDWMNRKAGLEMV 375

Query: 400 QFLNSLNKKSNVFIAPNSGHHLYFDN 425
                L   +      +SGH+L+ DN
Sbjct: 376 TEAKKLGIDAQYGEVSSSGHNLFLDN 401

>NCAS0B02260 Chr2 complement(374788..375879) [1092 bp, 363 aa] {ON}
           Anc_8.524 YBR204C
          Length = 363

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 42/145 (28%), Positives = 60/145 (41%), Gaps = 14/145 (9%)

Query: 149 ILIHGYGAGLGFYINTLQHLSMDNWCIHAVDLPGYGFSSRLK-FPYGTINPRIYSKKDVL 207
           + IHG G  LG +   L+   +       +DLPG+G S  L+ +   ++   I S  D+ 
Sbjct: 85  LFIHGLGGSLGQFEPLLRLTHLKGKKFLTLDLPGFGQSDELESYSMKSVIETIRSVVDLA 144

Query: 208 DWFQKRLKTWFHKKGLLAHPENNLVTAHSMGAYIMCHYLNNHPS--DFRKIIMCSPAGFY 265
              QK L      K +L        T HSMG Y+  H+   +    D RKI + SP    
Sbjct: 145 TGNQKSLGENTQLKLIL--------TGHSMGCYLCLHFFETYSKNYDIRKIALLSPPK-- 194

Query: 266 PASNPLTNIPLWYTY-LWDRNYSPF 289
           P    L+    W  + LW     PF
Sbjct: 195 PIMTSLSKRNYWTQWALWGVFKLPF 219

>CAGL0M05467g Chr13 complement(583722..584786) [1065 bp, 354 aa]
           {ON} weakly similar to uniprot|P38139 Saccharomyces
           cerevisiae YBR204c peroxisomal serine-active lipase
          Length = 354

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 56/288 (19%), Positives = 109/288 (37%), Gaps = 38/288 (13%)

Query: 149 ILIHGYGAGLGFYINTLQHLSMDNWCIHAVDLPGYGFSSRLKFPYGTINPRIYSKKDVLD 208
           +LIHG G  +  +   ++ L++  + + A+DLPG+G S      Y  +      KK V +
Sbjct: 79  LLIHGLGGSMDQFQPLMKLLTLLKYRVIALDLPGFGQSGSSTNGYDMLYVTSVVKKVVDN 138

Query: 209 WFQKRLKTWFHKKGLLAHPENNLVTAHSMGAYIMCHYLNNHPSDF---RKIIMCSP---A 262
             + +    F             V  HSMG YI  H++  +  ++   + ++ C P    
Sbjct: 139 NIENKTDIDFK------------VVGHSMGCYIASHFVQMYHEEYNIDKLVLTCPPPPSI 186

Query: 263 GFYPASNPLTNIP----LWYTYLWDRNYSPFSLVRISGPLGSKLTSGWSYSRFFHSNQTI 318
                 N +  +     +W  ++       F++ R+       L S    + F  + +T 
Sbjct: 187 STLRQDNYIMKMAMRGLMWAPFI-------FNIYRVWFDQSKGLNSSGIMNFFSANTETF 239

Query: 319 SNELSLALHTYAYSIFNLPGSGEYSLSHILKAGGDPRTPLQEEFFTCQSTTNNGIRRSNV 378
            +E +   +     ++    + +   S I       + P  E+        +N I  +NV
Sbjct: 240 QDEETENKNLKFRKLWQFSNNIKIDTSTIFSYFLGWKFPDWEDL-------DNIINTNNV 292

Query: 379 EYSWLYGQSDWI--NKTGGFKISQFLNSLNKKSNVFIAPNSGHHLYFD 424
           E   +Y + D I   +        F N    K  +    N GH+++F+
Sbjct: 293 ELVVIYAEHDKITPKQDAQLIFDAFKNVAATKKKLLEITNCGHNIFFN 340

>Kwal_27.11975 s27 (1028242..1029252) [1011 bp, 336 aa] {ON} YBR204C
           - Hypothetical ORF [contig 26] FULL
          Length = 336

 Score = 39.3 bits (90), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 51/224 (22%), Positives = 87/224 (38%), Gaps = 33/224 (14%)

Query: 149 ILIHGYGAGLGFYINTLQHLSMDNWCIHAVDLPGYGFSSRLKFPYGTINPRIYSKKDVLD 208
           + IHG G  L  +   L+ L + N     +DLPG+G S  L           YS  D+  
Sbjct: 82  VFIHGLGGTLTQFEPLLRVLDVLNEGFLTIDLPGFGHSDELDS---------YSMLDIAK 132

Query: 209 WFQKRLKTWFHKKGLLAHPENNLVTAHSMGAYIMCHYLNNHPSDF--RKIIMCS------ 260
             ++ L      K +       +V  HSMG +I  H+   + ++F  + ++  S      
Sbjct: 133 IIREVLVETTKNKKV-------IVVGHSMGCHIALHFGQLYNAEFAIKDMVFLSPPPPTL 185

Query: 261 ----PAGFYPASNPLTNIPLWYTYLWDRNYSPFSLVRISGPLGSKLTSGWSYSRF--FHS 314
                     A + L+ +P  + + W R Y   S    S  +     +   Y +   FH+
Sbjct: 186 PQLQKVSTRVALSVLSKVP--FVFDWYRAYFDQSKGLQSSGIRQFFLNEEPYRKLWQFHN 243

Query: 315 NQTISNELSLALHTYAYSIFNLPGSGEYSLSHILKAGGDPRTPL 358
           N  I +  SL  +   +  F+   +  Y+   ++    DP TPL
Sbjct: 244 NVQIRSR-SLVEYLRGWVPFDWSTACSYASVIVITGDADPVTPL 286

>KNAG0A03770 Chr1 complement(494021..495091) [1071 bp, 356 aa] {ON}
           Anc_8.524 YBR204C
          Length = 356

 Score = 38.1 bits (87), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 32/115 (27%), Positives = 49/115 (42%), Gaps = 13/115 (11%)

Query: 149 ILIHGYGAGLGFYINTLQHLSMDNWCIHAVDLPGYGFSSRLKFPYGTINPRIYSKKDVLD 208
           I IHG G  L  +   L+ L +      A+DLPG+G S        T  P I   K +  
Sbjct: 86  IFIHGLGGSLDQFFPLLKLLDLSEKYFVAIDLPGFGKSDE-----HTDYPMIQVVKHIDA 140

Query: 209 WFQKRLKTWFHKKGLLAHPENNLVTAHSMGAYIMCHYLNNHPSDFR--KIIMCSP 261
              + L      +  LA     L+  HSMG Y+  H++      +R  K+++ +P
Sbjct: 141 VISELL-----NEARLAFDTVRLI-GHSMGCYLTLHFMTLFSKKYRIGKVVLLAP 189

>Skud_2.331 Chr2 complement(599967..601097) [1131 bp, 376 aa] {ON}
           YBR204C (REAL)
          Length = 376

 Score = 36.2 bits (82), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 32/122 (26%), Positives = 54/122 (44%), Gaps = 15/122 (12%)

Query: 149 ILIHGYGAGLGFYINTLQHLSMDNWCIHAVDLPGYGFSSR-LKFPYGTINPRIYSKKDVL 207
           + + G    L  +   L+ +  D     A+DLPG+G SS    +P   +   I+    V 
Sbjct: 91  LFVPGLAGNLEQFEPLLKLIDSDQKAFLALDLPGFGHSSEWADYPMLKVVELIFVL--VC 148

Query: 208 DWFQKRLKTWFHK--KGLLAHPENN---LVTAHSMGAYIMCHYLNNHPSDFR---KIIMC 259
           D     LK W     K    +P +N   ++T HSMG ++ CH    H +  +   K+++ 
Sbjct: 149 D----VLKKWPAAVPKDREVNPFDNRKIVLTGHSMGCFLACHLYEQHLAALKVVEKMVLL 204

Query: 260 SP 261
           +P
Sbjct: 205 TP 206

>Kpol_1042.24 s1042 complement(53853..54788) [936 bp, 311 aa] {ON}
           complement(53853..54788) [936 nt, 312 aa]
          Length = 311

 Score = 35.0 bits (79), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 32/126 (25%), Positives = 54/126 (42%), Gaps = 11/126 (8%)

Query: 148 LILIHGYGAGLGFYINTLQHLSMDNWCIHAVDLPGYGFSSRLKFPYGTINPRIYSKKDVL 207
           ++++HG+G     Y   +  L+++ +     D  G G +S  K   G  N   Y   + L
Sbjct: 49  IVIVHGFGEYSQIYYRMMDQLALNGFETFMFDQRGSGETSPGKLK-GITNE--YHTFNDL 105

Query: 208 DWFQKRLKTWFHKKGLLAHPENNLVTAHSMGAYIMCHYL--NNHPSDFRKIIMCSP-AGF 264
           D+F ++      +KG+  H     +  HSMG  I+ +Y     H +D    I   P    
Sbjct: 106 DYFLRKNIDECKEKGIPIH-----LWGHSMGGGIILNYACDGKHKNDVATFIASGPLVVL 160

Query: 265 YPASNP 270
           +P S P
Sbjct: 161 HPHSQP 166

>TDEL0B03250 Chr2 complement(575015..576061) [1047 bp, 348 aa] {ON}
           Anc_8.524 YBR204C
          Length = 348

 Score = 35.0 bits (79), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 34/116 (29%), Positives = 50/116 (43%), Gaps = 17/116 (14%)

Query: 149 ILIHGYGAGLGFYINTLQHLSMDNWCIHAVDLPGYGFSSRL-KFPYGTINPRIYSKKDVL 207
           + IHG G  L  +   L+ L   N    A DLPG+G S    ++P   +   I       
Sbjct: 82  LFIHGLGGTLEQFEPVLRELDQRNKSFLAFDLPGFGKSDEWDQYPMLDVVKSI------- 134

Query: 208 DWFQKRLKTWFHKKGLLAHPENNLVTAHSMGAYIMCH-YLNNHPS-DFRKIIMCSP 261
           DW   +L      + L      NL+  HSMG Y+  H YL  H S    ++++ +P
Sbjct: 135 DWLIHQLTNNLKFEKL------NLI-GHSMGCYLAVHFYLLFHESWCISRLVLLAP 183

>SAKL0H10450g Chr8 complement(897598..898776) [1179 bp, 392 aa] {ON}
           similar to uniprot|P38139 Saccharomyces cerevisiae
           YBR204C Hypothetical ORF
          Length = 392

 Score = 34.7 bits (78), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 31/116 (26%), Positives = 53/116 (45%), Gaps = 20/116 (17%)

Query: 149 ILIHGYGAGLGFYINTLQHLSMDNWCIHAVDLPGYGFSSRLKFPYGTINPRIYSKKDVLD 208
           + IHG G  L  +   L+ LS+ N    ++DLPG+G S  ++  YG +        +++ 
Sbjct: 133 VFIHGLGGTLAQFEPLLKLLSLLNKGFFSMDLPGFGSSDEVE-SYGML--------EIVA 183

Query: 209 WFQKRLKTWFHKKGLLAHPENNLV-TAHSMGAYIMCHYLN--NHPSDFRKIIMCSP 261
             QK              P  NLV   HSMG Y+  H+ +       F+++++ +P
Sbjct: 184 IVQKTFAKL--------TPSRNLVLIGHSMGCYLAIHFCSAFQEQYSFQELVLLAP 231

>NCAS0J01810 Chr10 (338250..340382) [2133 bp, 710 aa] {ON} Anc_4.301
           YLR424W
          Length = 710

 Score = 34.7 bits (78), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 25/50 (50%), Gaps = 3/50 (6%)

Query: 213 RLKTW--FHKKGLLAHPENNLVTAHSMGAYIMCHYLNNHPSDFRKIIMCS 260
            L+ W    + G  A  EN+  T ++M   I  HY   HP DFR I+ C+
Sbjct: 470 ELEIWGDIKRHGEFAEEENDADTTYAMSLLIKYHYAF-HPDDFRIIVTCT 518

>KLTH0E12188g Chr5 (1082142..1083152) [1011 bp, 336 aa] {ON} similar
           to uniprot|P38139 Saccharomyces cerevisiae YBR204C
           Hypothetical ORF
          Length = 336

 Score = 33.9 bits (76), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 54/224 (24%), Positives = 85/224 (37%), Gaps = 33/224 (14%)

Query: 149 ILIHGYGAGLGFYINTLQHLSMDNWCIHAVDLPGYGFSSRLKFPYGTINPRIYSKKDVLD 208
           +  HG G  L  +   L+ L   N    A+DLPG+G S   +  Y  +       + + D
Sbjct: 82  LFFHGLGGNLTQFEPLLRLLGELNEGFVAMDLPGFGLSEE-QDGYQMLQ----VTQVIHD 136

Query: 209 WFQKRLKTWFHKKGLLAHPENNLVTAHSMGAYIMCHYLNNHPSDF---RKIIMCSPAGFY 265
            F   L+   HKK +L          HSMG +++ H+      +F     + +  PA   
Sbjct: 137 AF---LQITDHKKIIL--------VGHSMGCHLVLHFAILFGLEFDIKDSVFLSPPAPTL 185

Query: 266 P---------ASNPLTNIPLWYTYLWDRNYSPFSLVRISGPLGSKLTSGWSYSRF--FHS 314
           P         A + L  +P  +   W R+Y   S    S  +      G  Y +   FH 
Sbjct: 186 PQLQKVSTRLALSVLCRLPFLFD--WYRSYFDQSKGLESSGIKQFFYEGDCYRKLWQFHY 243

Query: 315 NQTISNELSLALHTYAYSIFNLPGSGEYSLSHILKAGGDPRTPL 358
           N  I +  SL  +   +   + P  G    + ++    DP TPL
Sbjct: 244 NVQIRSR-SLVAYLRGWVPVDWPKVGVIPSAVVITGEKDPVTPL 286

>YBR204C Chr2 complement(632254..633381) [1128 bp, 375 aa] {ON}
           LDH1Serine hydrolase; exhibits active esterase plus weak
           triacylglycerol lipase activities; proposed role in
           lipid homeostasis, regulating phospholipid and non-polar
           lipid levels and required for mobilization of LD-stored
           lipids; localizes to the lipid droplet (LD) surface;
           contains a classical serine containing catalytic triad
           (GxSxG motif)
          Length = 375

 Score = 33.9 bits (76), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 56/265 (21%), Positives = 92/265 (34%), Gaps = 50/265 (18%)

Query: 149 ILIHGYGAGLGFYINTLQHLSMDNWCIHAVDLPGYGFSSRL-KFPYGTINPRIYS-KKDV 206
           + + G    L  +   L+ +  D      +DLPG+G SS    +P   +   I+    DV
Sbjct: 90  VFVPGLAGNLEQFEPLLELVDSDQKAFLTLDLPGFGHSSEWSDYPMLKVVELIFVLVCDV 149

Query: 207 LDWFQKRLKTWFHKKGLLAHPENN----------LVTAHSMGAYIMCHYLNNHPSDFRK- 255
           L            +K   A P N+          ++  HSMG ++ CH    H +D +  
Sbjct: 150 L------------RKWSTAVPNNDNVNPFNGHKIVLVGHSMGCFLACHLYEQHMADTKAV 197

Query: 256 ---IIMCSPAGFYPASNPLTNIPLWYTY-------LWDRNYSPFSLVRISGPLGSKL--- 302
              +++  P       +   +I  W  Y       L+D   + F  V+     G K    
Sbjct: 198 QTLVLLTPPKAHIEQLSKDKHIIQWALYGVFKLPWLFDVYRNKFDQVKGLQSSGIKQYFY 257

Query: 303 ----TSGWSYSRFFHSNQTISNELS------LALHTYAYSIFN--LPGSGEYSLSHILKA 350
                    Y +F+     ISN+        L   T  +  FN  L  +       I  A
Sbjct: 258 QQGDDVKLKYRKFWQFKNNISNKSRTIIGYLLGWETVDWVKFNGVLTQTDMKQKIIIFGA 317

Query: 351 GGDPRTPLQEEFFTCQSTTNNGIRR 375
             DP  P++   F  Q+     +R+
Sbjct: 318 EKDPIAPIENLEFYKQTINKECLRK 342

>NDAI0C05430 Chr3 (1259106..1260194) [1089 bp, 362 aa] {ON}
           Anc_8.524 YBR204C
          Length = 362

 Score = 33.9 bits (76), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 30/115 (26%), Positives = 49/115 (42%), Gaps = 15/115 (13%)

Query: 149 ILIHGYGAGLGFYINTLQHLSMDNWCIHAVDLPGYGFSSRLKFPYGTINPRIYSKKDVLD 208
           + IHG G  L  +   L+ L ++     A+DLPG+G S   +          Y+  DV+ 
Sbjct: 93  LFIHGLGGVLEQFEPLLRLLDLNENKFLALDLPGFGKSDEYE---------DYNMFDVIS 143

Query: 209 WFQKRLKTWFHKKGLLAHPENNLVTAHSMGAYIMCH--YLNNHPSDFRKIIMCSP 261
                +     ++       N ++  HSMG YI  H  Y +     F+K++  SP
Sbjct: 144 IIHTIVDRLIPERT----TSNIVLVGHSMGCYISLHLFYKSYTRFSFKKLVFLSP 194

>Smik_2.345 Chr2 complement(618817..619944) [1128 bp, 375 aa] {ON}
           YBR204C (REAL)
          Length = 375

 Score = 33.5 bits (75), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 30/123 (24%), Positives = 47/123 (38%), Gaps = 30/123 (24%)

Query: 149 ILIHGYGAGLGFYINTLQHLSMDNWCIHAVDLPGYGFSSRL-KFPYGTI----------- 196
           + + G    L  +   L+ +  D     A+DLPG+G SS    +P   +           
Sbjct: 90  VFVPGLAGNLEQFEPLLKLVDSDRKAFLALDLPGFGDSSEWSDYPMLKVVELIFILLCDV 149

Query: 197 ---NPRIYSKKDVLDWFQKRLKTWFHKKGLLAHPENNLVTAHSMGAYIMCHYLNNHPSDF 253
               P + SK D L++F        HK  L+ H         SMG ++ CH    H  D 
Sbjct: 150 LKGRPAVLSKDDNLNFFNG------HKLVLVGH---------SMGCFLACHLYEQHLVDA 194

Query: 254 RKI 256
           + +
Sbjct: 195 KVV 197

>Kpol_299.6 s299 (14238..15287) [1050 bp, 349 aa] {ON}
           (14238..15287) [1050 nt, 350 aa]
          Length = 349

 Score = 32.3 bits (72), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 26/115 (22%), Positives = 51/115 (44%), Gaps = 17/115 (14%)

Query: 149 ILIHGYGAGLGFYINTLQHLSMDNWCIHAVDLPGYGFSSRLKFPYGTINPRIYSKKDVLD 208
           + IHG G     +   L+ +   +     +DLPG+G S  L+  YG     ++   +V++
Sbjct: 86  LFIHGLGGNFEQFEPLLRLVDASDKKFLTMDLPGFGKSDELE-SYG-----MFDIIEVIN 139

Query: 209 WFQKRLKTWFHKKGLLAHPENNLVTAHSMGAYIMCHYLNNHPSDFR--KIIMCSP 261
           +  K+    F K G   +     V  HSMG  +  H++     +    ++++ +P
Sbjct: 140 YVAKK----FIKDGKSIN-----VIGHSMGCLLSIHFMEKFSKELNITQLVLLTP 185

>TBLA0D03080 Chr4 (741949..748887) [6939 bp, 2312 aa] {ON} Anc_1.144
           YCR032W
          Length = 2312

 Score = 32.3 bits (72), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 22/38 (57%)

Query: 388 DWINKTGGFKISQFLNSLNKKSNVFIAPNSGHHLYFDN 425
           D+I     FKI  F N LN  SN  I P S ++LYF+N
Sbjct: 206 DFIYLYSNFKIKSFQNVLNILSNQLIDPLSSNYLYFEN 243

>Suva_6.143 Chr6 (237157..238056) [900 bp, 299 aa] {ON} YJL068C
           (REAL)
          Length = 299

 Score = 31.6 bits (70), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 30/94 (31%), Positives = 44/94 (46%), Gaps = 17/94 (18%)

Query: 212 KRLKTWFHKKGL--LAHPENNLVTAHSMGAY-IMCHYLNNHPSDFRKIIMCSPAGFYPAS 268
           + L   F+K G   L   +N  +T HSMG Y  +C YL  +    ++   CS   F P  
Sbjct: 135 QTLDAHFNKNGAARLDFLDNVAITGHSMGGYGAICGYLKGYAE--KRYKSCS--AFAPIV 190

Query: 269 NPLTNIP----LWYTYLWD-----RNYSPFSLVR 293
           NP +NIP     +  YL D     + Y P +L++
Sbjct: 191 NP-SNIPWGQKAFKGYLGDERAQWQAYDPCALIK 223

>Kpol_1036.78 s1036 (208850..211480,211530..211538,211627..212820)
            [3834 bp, 1277 aa] {ON}
            (208850..211480,211530..211538,211627..212820) [3834 nt,
            1278 aa]
          Length = 1277

 Score = 32.0 bits (71), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 44/178 (24%), Positives = 78/178 (43%), Gaps = 24/178 (13%)

Query: 196  INPRIYSK-KDVLDWFQKRLKTWFHKKGLLAHPENNLVT---AHSMGAYIMCHYLNNHPS 251
            I  RI  K + +LD  +K+ +   +++   +H +N+L+    A  M   ++   + N   
Sbjct: 1078 ITKRIDEKMRKMLDSERKKHEASINERNTYSHLQNHLIASPKAKKMKLPVLLSEVKNK-- 1135

Query: 252  DFRKIIMCSPAGFYPASNPLTNIPLWYTYLWDRNYSPFSLVRISGPLGSKLTSGWSYSRF 311
            +F+     +P+    AS+P  +  L   Y   +     S+  +  P         SYSR 
Sbjct: 1136 NFKLRTPSAPSMDTAASSPRISSHLAMKYRKTQRI--VSVPDVIAP------GTPSYSRN 1187

Query: 312  FHSNQTISNELSLALHTYAYSIFNLPGSGEYSLSHILKAGGDPRTPLQEEFFTCQSTT 369
            F SN  +SN  +LAL     +I N+   G  S         DP+ P ++++ T  +TT
Sbjct: 1188 FPSNSQLSNSSTLALGNRTPTITNI---GPLS-------TNDPQQPQRQQWSTPVTTT 1235

>TPHA0C03930 Chr3 (843179..844108) [930 bp, 309 aa] {ON} Anc_2.487
           YKL094W
          Length = 309

 Score = 31.2 bits (69), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 43/172 (25%), Positives = 73/172 (42%), Gaps = 16/172 (9%)

Query: 148 LILIHGYGAGLGFYINTLQHLSMDNWCIHAVDLPGYGFSSRLKFPYGTINPRIYSKKDVL 207
           ++++HG+G     Y   +  LS++ +     D  G G +S  K   G  N R Y+  D+ 
Sbjct: 46  VLIVHGFGEYTQIYYRMMDKLSVNGFESFFFDQRGTGETSPGKLK-GLTNER-YTFNDLN 103

Query: 208 DWFQKRLKTWFHKKGLLAHPENNLVTAHSMGAYIMCHYL--NNHPSDFRKIIMCSP-AGF 264
            +    L     +KG+        +  HSMG  I+ +Y     H  D +  I+  P    
Sbjct: 104 HFISTNL-VECKEKGIPL-----FLWGHSMGGGIVLNYACTGKHKDDIKSFIVSGPLVVL 157

Query: 265 YPASNPLTNIPLWYTYLWDRNYSPFSLVRISGPLG-SKLTSGWSYSRFFHSN 315
           +P S P   I ++++ L  +    F   RI   L    +TS  SY +F  ++
Sbjct: 158 HPHSAP-NKITIFFSSLLAKCLPNF---RIDTGLDLEGITSDSSYRQFLAND 205

>ZYRO0C15070g Chr3 (1172681..1175476) [2796 bp, 931 aa] {ON} similar
           to uniprot|P40462 Saccharomyces cerevisiae YIL137C
           RBF108 Hypothetical ORF
          Length = 931

 Score = 31.2 bits (69), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 16/60 (26%), Positives = 29/60 (48%), Gaps = 1/60 (1%)

Query: 162 INTLQHLSMDNWCIHAVDLPGYGFSSRLKF-PYGTINPRIYSKKDVLDWFQKRLKTWFHK 220
           IN L +    N    +++L  +G +   +F P GT N  +  +  V+DWF++    W  +
Sbjct: 797 INKLLNFVATNIDSTSIELALFGLAYNARFHPTGTANNNVQIRDIVVDWFKRHYDQWAQR 856

>SAKL0D07194g Chr4 (591271..592164) [894 bp, 297 aa] {ON} similar to
           uniprot|P40363 Saccharomyces cerevisiae YJL068C
           Hypothetical ORF
          Length = 297

 Score = 30.8 bits (68), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 36/66 (54%), Gaps = 7/66 (10%)

Query: 212 KRLKTWFHKKG-LLAHPENNLVTAHSMGAY-IMCHYLNNHPSDFRKIIMCSPAGFYPASN 269
           + L ++F+K G  L   +N  +T HSMG Y  +C +L ++  +  K    S + F P  N
Sbjct: 134 QELNSFFNKDGDKLDFLDNIAITGHSMGGYGALCGFLKHYGENRYK----SCSAFAPIVN 189

Query: 270 PLTNIP 275
           P+ N+P
Sbjct: 190 PI-NVP 194

>KAFR0D03260 Chr4 (640955..641881) [927 bp, 308 aa] {ON} Anc_2.487
           YKL094W
          Length = 308

 Score = 30.8 bits (68), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 41/102 (40%), Gaps = 15/102 (14%)

Query: 148 LILIHGYGAGLGFYINTLQHLSMDNWCIHAVDLPGYGFSSRLKFPYGTINPRIYSKKDVL 207
           L+LIHG+G     Y   + HLSM  +     D  G G +S  K   G  N   Y   + L
Sbjct: 44  LLLIHGFGEYTKIYYRLMDHLSMSGYETFMFDQRGSGVTSPGK-QKGVTNE--YHTFNDL 100

Query: 208 DWFQKRLKTWFHKKGLLAHPENNLVT----AHSMGAYIMCHY 245
           D F          K L    ENN V      HSMG  I  +Y
Sbjct: 101 DHFI--------AKNLEECQENNNVPLFLWGHSMGGGICLNY 134

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.322    0.138    0.439 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 49,592,210
Number of extensions: 2273389
Number of successful extensions: 5453
Number of sequences better than 10.0: 83
Number of HSP's gapped: 5349
Number of HSP's successfully gapped: 100
Length of query: 441
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 328
Effective length of database: 40,524,141
Effective search space: 13291918248
Effective search space used: 13291918248
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 67 (30.4 bits)