Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0F030808.261ON58358328700.0
YLR088W (GAA1)8.261ON61460918120.0
Smik_12.1478.261ON61360817980.0
SAKL0H17050g8.261ON58457817860.0
Skud_12.1568.261ON61260717830.0
Kpol_543.378.261ON57858317600.0
TDEL0F038808.261ON57958217540.0
KLTH0G13706g8.261ON58457117510.0
Suva_10.1728.261ON61460917500.0
KLLA0F19118g8.261ON57857817000.0
NDAI0J013908.261ON58358616690.0
AGR087C8.261ON57757016660.0
Kwal_56.238048.261ON57857216520.0
ZYRO0C01672g8.261ON56958216470.0
TPHA0A018208.261ON58157616410.0
NCAS0B038608.261ON58358516300.0
KNAG0H032508.261ON58557616170.0
Ecym_43098.261ON57757015980.0
CAGL0L12232g8.261ON59158215780.0
KAFR0B055508.261ON55555215510.0
Kwal_26.71547.86ON121344771.2
Smik_5.1117.140ON43060714.2
KLTH0D02486g7.86ON122339699.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0F03080
         (583 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0F03080 Chr6 complement(747695..749446) [1752 bp, 583 aa] {O...  1110   0.0  
YLR088W Chr12 (316107..317951) [1845 bp, 614 aa] {ON}  GAA1Subun...   702   0.0  
Smik_12.147 Chr12 (295948..297789) [1842 bp, 613 aa] {ON} YLR088...   697   0.0  
SAKL0H17050g Chr8 complement(1497051..1498805) [1755 bp, 584 aa]...   692   0.0  
Skud_12.156 Chr12 (299282..301120) [1839 bp, 612 aa] {ON} YLR088...   691   0.0  
Kpol_543.37 s543 (82589..84325) [1737 bp, 578 aa] {ON} (82589..8...   682   0.0  
TDEL0F03880 Chr6 (722770..724509) [1740 bp, 579 aa] {ON} Anc_8.2...   680   0.0  
KLTH0G13706g Chr7 complement(1173326..1175080) [1755 bp, 584 aa]...   679   0.0  
Suva_10.172 Chr10 (320928..322772) [1845 bp, 614 aa] {ON} YLR088...   678   0.0  
KLLA0F19118g Chr6 (1771250..1772986) [1737 bp, 578 aa] {ON} simi...   659   0.0  
NDAI0J01390 Chr10 complement(319754..321505) [1752 bp, 583 aa] {...   647   0.0  
AGR087C Chr7 complement(890706..892439) [1734 bp, 577 aa] {ON} S...   646   0.0  
Kwal_56.23804 s56 complement(710216..711952) [1737 bp, 578 aa] {...   640   0.0  
ZYRO0C01672g Chr3 complement(119344..121053) [1710 bp, 569 aa] {...   639   0.0  
TPHA0A01820 Chr1 complement(367804..369549) [1746 bp, 581 aa] {O...   636   0.0  
NCAS0B03860 Chr2 complement(687424..689175) [1752 bp, 583 aa] {O...   632   0.0  
KNAG0H03250 Chr8 complement(605885..607642) [1758 bp, 585 aa] {O...   627   0.0  
Ecym_4309 Chr4 complement(656032..657765) [1734 bp, 577 aa] {ON}...   620   0.0  
CAGL0L12232g Chr12 (1324754..1326529) [1776 bp, 591 aa] {ON} sim...   612   0.0  
KAFR0B05550 Chr2 complement(1136432..1138099) [1668 bp, 555 aa] ...   602   0.0  
Kwal_26.7154 s26 (237387..241028) [3642 bp, 1213 aa] {ON} YOL045...    34   1.2  
Smik_5.111 Chr5 complement(152669..153961) [1293 bp, 430 aa] {ON...    32   4.2  
KLTH0D02486g Chr4 (247566..251237) [3672 bp, 1223 aa] {ON} simil...    31   9.5  

>TBLA0F03080 Chr6 complement(747695..749446) [1752 bp, 583 aa] {ON}
           Anc_8.261 YLR088W
          Length = 583

 Score = 1110 bits (2870), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 556/583 (95%), Positives = 556/583 (95%)

Query: 1   MALLATIHRRVIDMGLVPKIMKRLPLVSIFLAAIGIVLFLMLPMDGQYRHTYISENALMP 60
           MALLATIHRRVIDMGLVPKIMKRLPLVSIFLAAIGIVLFLMLPMDGQYRHTYISENALMP
Sbjct: 1   MALLATIHRRVIDMGLVPKIMKRLPLVSIFLAAIGIVLFLMLPMDGQYRHTYISENALMP 60

Query: 61  SQAYSYFRESEWNILRGYRTEIDIFPSMPSRDRNLVMTQWLEEFGTKTSVYHNDEYGDTL 120
           SQAYSYFRESEWNILRGYRTEIDIFPSMPSRDRNLVMTQWLEEFGTKTSVYHNDEYGDTL
Sbjct: 61  SQAYSYFRESEWNILRGYRTEIDIFPSMPSRDRNLVMTQWLEEFGTKTSVYHNDEYGDTL 120

Query: 121 YGIFNAPRGDGTEAIVLAIPWYNADGEFNTGGAALGIALSRFFSRWPIWSKNIIVVFSEN 180
           YGIFNAPRGDGTEAIVLAIPWYNADGEFNTGGAALGIALSRFFSRWPIWSKNIIVVFSEN
Sbjct: 121 YGIFNAPRGDGTEAIVLAIPWYNADGEFNTGGAALGIALSRFFSRWPIWSKNIIVVFSEN 180

Query: 181 PDGALRSWVDAYHHSLDLTGGSIEAAIVMDYPSSSDFFDYVEIYYHGINGELPNLDLLNI 240
           PDGALRSWVDAYHHSLDLTGGSIEAAIVMDYPSSSDFFDYVEIYYHGINGELPNLDLLNI
Sbjct: 181 PDGALRSWVDAYHHSLDLTGGSIEAAIVMDYPSSSDFFDYVEIYYHGINGELPNLDLLNI 240

Query: 241 AIQITEHEGMQVSLHGLPKESLHQNNYFSRLRTLLLGTKDALLSGIKPRHGNEAFSGFRI 300
           AIQITEHEGMQVSLHGLPKESLHQNNYFSRLRTLLLGTKDALLSGIKPRHGNEAFSGFRI
Sbjct: 241 AIQITEHEGMQVSLHGLPKESLHQNNYFSRLRTLLLGTKDALLSGIKPRHGNEAFSGFRI 300

Query: 301 QAITLKAKFTPDNNDHDITSFGRIAEASFRSVNNLLEKFHQSFFFYLILAPKYFVSISSY 360
           QAITLKAKFTPDNNDHDITSFGRIAEASFRSVNNLLEKFHQSFFFYLILAPKYFVSISSY
Sbjct: 301 QAITLKAKFTPDNNDHDITSFGRIAEASFRSVNNLLEKFHQSFFFYLILAPKYFVSISSY 360

Query: 361 LPSAVTFSVAFAXXXXXXXXXXXXXXXPIFSEYNLLAGLLFTISITFSFFVARLSLLFTE 420
           LPSAVTFSVAFA               PIFSEYNLLAGLLFTISITFSFFVARLSLLFTE
Sbjct: 361 LPSAVTFSVAFAISSLSSYINNSYSTLPIFSEYNLLAGLLFTISITFSFFVARLSLLFTE 420

Query: 421 PRXXXXXXXXXXXXPHLLGNRFTIPEPLSYRLKSIAFLYISLVLTSLLVLNFSLAFGIGI 480
           PR            PHLLGNRFTIPEPLSYRLKSIAFLYISLVLTSLLVLNFSLAFGIGI
Sbjct: 421 PRLLVLGSVFLSVLPHLLGNRFTIPEPLSYRLKSIAFLYISLVLTSLLVLNFSLAFGIGI 480

Query: 481 LGFAMTAVKTITIHSSMRVRVRNTMHLLLSNPFTSVLLFTYIFDKDIYGIKIFYEFIHSW 540
           LGFAMTAVKTITIHSSMRVRVRNTMHLLLSNPFTSVLLFTYIFDKDIYGIKIFYEFIHSW
Sbjct: 481 LGFAMTAVKTITIHSSMRVRVRNTMHLLLSNPFTSVLLFTYIFDKDIYGIKIFYEFIHSW 540

Query: 541 NTLNCWTWFIICVGWLPPWILVSISSIQTNTVMQSPDYGKKQL 583
           NTLNCWTWFIICVGWLPPWILVSISSIQTNTVMQSPDYGKKQL
Sbjct: 541 NTLNCWTWFIICVGWLPPWILVSISSIQTNTVMQSPDYGKKQL 583

>YLR088W Chr12 (316107..317951) [1845 bp, 614 aa] {ON}  GAA1Subunit
           of the GPI (glycosylphosphatidylinositol):protein
           transamidase complex, removes the GPI-anchoring signal
           and attaches GPI to proteins in the ER
          Length = 614

 Score =  702 bits (1812), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 342/609 (56%), Positives = 435/609 (71%), Gaps = 39/609 (6%)

Query: 1   MALLATIHRRVIDMGLVPKIMKRLPLVSIFLAAIGIVLFLMLPMDGQYRHTYISENALMP 60
           MALL  +HRR++DMGLVP+I+  LP++S+  A  G +   +LPMDGQYR TYISENALMP
Sbjct: 1   MALLEKLHRRIVDMGLVPRIIALLPVISMLCALFGFISIAILPMDGQYRRTYISENALMP 60

Query: 61  SQAYSYFRESEWNILRGYRTEIDIFPSMPSRDRNLVMTQWLEEFGTKTSVYHNDEYGDTL 120
           SQAYSYFRESEWNILRGYR++I    +M S +RN +M  WL+EFGTKT++Y N++YG+TL
Sbjct: 61  SQAYSYFRESEWNILRGYRSQIKEMVNMTSMERNNLMGSWLQEFGTKTAIYENEQYGETL 120

Query: 121 YGIFNAPRGDGTEAIVLAIPWYNADGEFNTGGAALGIALSRFFSRWPIWSKNIIVVFSEN 180
           YG+ +APRGDGTEA+VLA+PW+N+D EFN GGAALG++L+RFFSRWP+WSKNIIVVFSEN
Sbjct: 121 YGVMHAPRGDGTEAMVLAVPWFNSDDEFNIGGAALGVSLARFFSRWPVWSKNIIVVFSEN 180

Query: 181 PDGALRSWVDAYHHSLDLTGGSIEAAIVMDYPSSSDFFDYVEIYYHGINGELPNLDLLNI 240
           P  ALRSWV+AYH SLDLTGGSIEAA+V+DY S+ DFF+YVEI Y G+NGELPNLDL+NI
Sbjct: 181 PRAALRSWVEAYHTSLDLTGGSIEAAVVLDYSSTEDFFEYVEISYDGLNGELPNLDLVNI 240

Query: 241 AIQITEHEGMQVSLHGLPKESLHQNNYFSRLRTLLLGTKDALLSGIKPRHGNEAFSGFRI 300
           AI ITEHEGM+VSLHGLP + L  NN++SRL+ L LG +D  LSG+K  HGNEAFSG+RI
Sbjct: 241 AISITEHEGMKVSLHGLPSDQLTNNNFWSRLKILCLGIRDWALSGVKKPHGNEAFSGWRI 300

Query: 301 QAITLKAKFTPDNNDHDITSFGRIAEASFRSVNNLLEKFHQSFFFYLILAPKYFVSISSY 360
           Q++TLKA     N+ HDIT+FGRI EA FRS+NNLLEKFHQSFFFYL+LAP+ FVSISSY
Sbjct: 301 QSVTLKAH---GNSGHDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSY 357

Query: 361 LPSAVTFSVAFAXXXXXXXXXXXXXXXPIFSEYNLLAGLLFTISITFSFFVARLSLLFTE 420
           LPSAV  S+AFA                +FSEYNL+A L++ +S+  SF V++  LL   
Sbjct: 358 LPSAVALSIAFAISSLNAFINNAYANISLFSEYNLVALLVWFVSLVISFVVSQAFLLIPS 417

Query: 421 PRXXXXXXXXXXXXPHLLGNRFTIPEPLSYRLKSIAFLYISLVLTSLLVLNFSLAFGIGI 480
                         P +L  +  I EPLSYRLK++AFLY SLV TSLL++NF++A  IG 
Sbjct: 418 SGLLMTISMASCFLPLILSRKIHISEPLSYRLKNVAFLYFSLVSTSLLMINFAMALLIGT 477

Query: 481 LGFAMTAVKTITIHSS------------------------------------MRVRVRNT 504
           L F MT VKTI   SS                                     + +++N 
Sbjct: 478 LAFPMTFVKTIVESSSEHEVTTQSSNPIKTEPKDEIELVENHMDTTPATPQQQKQKLKNL 537

Query: 505 MHLLLSNPFTSVLLFTYIFDKDIYGIKIFYEFIHSWNTLNCWTWFIICVGWLPPWILVSI 564
           + L+L+NPF S+ LF   FD + +G  I  + + +W  L CW+WF++C+GWLP W+L+  
Sbjct: 538 VLLILTNPFISITLFGLFFDDEFHGFDIINKLVSAWLDLKCWSWFVLCIGWLPCWLLILA 597

Query: 565 SSIQTNTVM 573
           SS ++ +V+
Sbjct: 598 SSFESKSVV 606

>Smik_12.147 Chr12 (295948..297789) [1842 bp, 613 aa] {ON} YLR088W
           (REAL)
          Length = 613

 Score =  697 bits (1798), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/608 (56%), Positives = 433/608 (71%), Gaps = 38/608 (6%)

Query: 1   MALLATIHRRVIDMGLVPKIMKRLPLVSIFLAAIGIVLFLMLPMDGQYRHTYISENALMP 60
           MALL  +HRR++DMGLVP+I+  LP+VS+  A  G +   +LPMDGQYR TYISENALMP
Sbjct: 1   MALLEKLHRRIVDMGLVPRIIASLPVVSMVCALFGFISIAILPMDGQYRRTYISENALMP 60

Query: 61  SQAYSYFRESEWNILRGYRTEIDIFPSMPSRDRNLVMTQWLEEFGTKTSVYHNDEYGDTL 120
           SQAYSYFRESEWNILRGYR++I+   +M S +RN +M  WL+EFGTKT++Y N++YG+TL
Sbjct: 61  SQAYSYFRESEWNILRGYRSQIEEMVNMTSMERNNIMGSWLQEFGTKTAIYENEQYGETL 120

Query: 121 YGIFNAPRGDGTEAIVLAIPWYNADGEFNTGGAALGIALSRFFSRWPIWSKNIIVVFSEN 180
           YG+ +APRGDGTEA+VLA+PW+N+D +FN GGAALG++L+RFFSRWP+WSKNII+VFSEN
Sbjct: 121 YGVMHAPRGDGTEAMVLAVPWFNSDDKFNVGGAALGVSLARFFSRWPVWSKNIIIVFSEN 180

Query: 181 PDGALRSWVDAYHHSLDLTGGSIEAAIVMDYPSSSDFFDYVEIYYHGINGELPNLDLLNI 240
           P  ALRSWV+AYH SLDLTGGSIEAA+V+DY S+ DFF+YVEI Y G+NGELPNLDL+N+
Sbjct: 181 PCAALRSWVEAYHTSLDLTGGSIEAAVVVDYSSAEDFFEYVEISYDGLNGELPNLDLVNV 240

Query: 241 AIQITEHEGMQVSLHGLPKESLHQNNYFSRLRTLLLGTKDALLSGIKPRHGNEAFSGFRI 300
           AI ITEHEGM+VSLHGLP + L  NNY+SRL+ L LG +D  L+G+K  HGNEAFSG+RI
Sbjct: 241 AISITEHEGMKVSLHGLPLDQLTINNYWSRLKVLCLGIRDWALAGVKNPHGNEAFSGWRI 300

Query: 301 QAITLKAKFTPDNNDHDITSFGRIAEASFRSVNNLLEKFHQSFFFYLILAPKYFVSISSY 360
           Q++TLKA     N+ HDIT+FGRI EA FRS+NNLLEKFHQSFFFYL+LAP+ FVSISSY
Sbjct: 301 QSVTLKAH---GNSGHDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSY 357

Query: 361 LPSAVTFSVAFAXXXXXXXXXXXXXXXPIFSEYNLLAGLLFTISITFSFFVARLSLLFTE 420
           LPSAV  SVAFA                IFSEYNL+A L++ IS+  SF V+++ LL   
Sbjct: 358 LPSAVALSVAFAISSLNAFINNTYASISIFSEYNLVALLVWFISLVISFVVSQVFLLLPS 417

Query: 421 PRXXXXXXXXXXXXPHLLGNRFTIPEPLSYRLKSIAFLYISLVLTSLLVLNFSLAFGIGI 480
                         P +L  +  I EPLSYRLK++AFLY SLVLTSLL++NF++A  IG 
Sbjct: 418 AGLLMAISMISCFLPLILSKKVHISEPLSYRLKNVAFLYFSLVLTSLLMINFAMALLIGT 477

Query: 481 LGFAMTAVKTITIHS-----------SMRVRVRNTMHLL--------------------- 508
           L F MT VKTI   S           S++   +    L+                     
Sbjct: 478 LAFPMTLVKTIIESSGEHEVSAKPYISIKTEPKEETELIENYEDIMPGKSQQRQELKNLL 537

Query: 509 ---LSNPFTSVLLFTYIFDKDIYGIKIFYEFIHSWNTLNCWTWFIICVGWLPPWILVSIS 565
              L+NPF S+ +F   FD +  G  +  + + +W  L CW+WF++C+GWLP W+LV  S
Sbjct: 538 LLVLTNPFISITIFGSFFDDEFQGFDVINKLVSAWLDLKCWSWFVLCIGWLPCWLLVLAS 597

Query: 566 SIQTNTVM 573
           S ++  VM
Sbjct: 598 SFESKRVM 605

>SAKL0H17050g Chr8 complement(1497051..1498805) [1755 bp, 584 aa]
           {ON} similar to uniprot|P39012 Saccharomyces cerevisiae
           YLR088W GAA1 Subunit of the GPI:protein transamidase
           complex removes the GPI-anchoring signal and attaches
           GPI (glycosylphosphatidylinositol) to proteins in the ER
          Length = 584

 Score =  692 bits (1786), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/578 (56%), Positives = 431/578 (74%), Gaps = 6/578 (1%)

Query: 1   MALLATIHRRVIDMGLVPKIMKRLPLVSIFLAAIGIV-LFLMLPMDGQYRHTYISENALM 59
           MAL+  +HRR IDMGL+PK +  LP +SIF A +G+  L L +P DGQ+R TYISENALM
Sbjct: 1   MALVEKLHRRFIDMGLLPKFIALLPTLSIFCAVVGVSWLALFIPTDGQFRRTYISENALM 60

Query: 60  PSQAYSYFRESEWNILRGYRTEIDIFPSMPSRDRNLVMTQWLEEFGTKTSVYHNDEYGDT 119
           PSQAYSYFRE+EWN+LRGYRT+I++F    + +RN  ++ WL++FG KT++Y N+EYG+T
Sbjct: 61  PSQAYSYFRETEWNVLRGYRTQIELFKKSSTHERNEEVSSWLQQFGAKTAIYTNEEYGET 120

Query: 120 LYGIFNAPRGDGTEAIVLAIPWYNADGEFNTGGAALGIALSRFFSRWPIWSKNIIVVFSE 179
           LYGI +APRGDGTEA+VLA PWYN++ ++NTGG AL ++LSRFFSRWP+WSKNII+V SE
Sbjct: 121 LYGILHAPRGDGTEAMVLAAPWYNSENQYNTGGIALAVSLSRFFSRWPVWSKNIIIVLSE 180

Query: 180 NPDGALRSWVDAYHHSLDLTGGSIEAAIVMDYPSSSDFFDYVEIYYHGINGELPNLDLLN 239
           +P  ALRSWV+AYH SLDLTGGSIEAA+VMD+P S+DFF YVEI++ G+NGELPNLDL+N
Sbjct: 181 DPQAALRSWVEAYHTSLDLTGGSIEAAVVMDFPGSNDFFKYVEIHFDGLNGELPNLDLVN 240

Query: 240 IAIQITEHEGMQVSLHGLPKESLHQNNYFSRLRTLLLGTKDALLSGIKPRHGNEAFSGFR 299
           +A+ ITEHEGM+VSLHG+ +E L +N++FSR++T++LG K+  LSGIK  HGNE FSG+R
Sbjct: 241 VAVHITEHEGMKVSLHGISEEELGKNDFFSRMKTIILGVKNMALSGIKKSHGNEVFSGWR 300

Query: 300 IQAITLKAKFTPDNNDHDITSFGRIAEASFRSVNNLLEKFHQSFFFYLILAPKYFVSISS 359
           I ++TLKA  T  +   DIT+FGRI EA FRSVNNLLEKFHQSFFFYL+LAP+ FVSI S
Sbjct: 301 IHSVTLKACGT--DGPFDITTFGRIPEAIFRSVNNLLEKFHQSFFFYLLLAPRLFVSIGS 358

Query: 360 YLPSAVTFSVAFAXXXXXXXXXXXXXXXPIFSEYNLLAGLLFTISITFSFFVARLSLLFT 419
           YLP+AV  SV+FA               P+ S YN+ A L F +++  SF  A+  L   
Sbjct: 359 YLPAAVALSVSFALASLNTILNNEYTSLPLLSTYNVFALLGFAVALFVSFITAQAFLYAP 418

Query: 420 EPRXXXXXXXXXXXXPHLLGNRFTIPEPLSYRLKSIAFLYISLVLTSLLVLNFSLAFGIG 479
           +P             P ++  R  I  P SYRLKS A+LY S+VLTSLLV+NFSLAFG+G
Sbjct: 419 QPELLLSLNVLLLLMP-IIFTRVKIRTPFSYRLKSFAYLYFSVVLTSLLVVNFSLAFGLG 477

Query: 480 ILGFAMTAVKTITIHSSMRVRVRNTMHLLLSNPFTSVLLFTYIFDKDIYGIKIFYEFIHS 539
            L F MT V+T +   ++R R++N + LL+SNPF ++ LF    D+++ G+++FY    +
Sbjct: 478 CLAFPMTLVRTTS--GNLRARLKNCVLLLISNPFIAIWLFAICVDRELQGVQVFYGLTSA 535

Query: 540 WNTLNCWTWFIICVGWLPPWILVSISSIQTNTVMQSPD 577
           W  L CWTWF+IC+GWLP W+LV+ S I + +++   D
Sbjct: 536 WKDLGCWTWFVICIGWLPSWLLVAYSGIDSVSIVVPQD 573

>Skud_12.156 Chr12 (299282..301120) [1839 bp, 612 aa] {ON} YLR088W
           (REAL)
          Length = 612

 Score =  691 bits (1783), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/607 (56%), Positives = 435/607 (71%), Gaps = 37/607 (6%)

Query: 1   MALLATIHRRVIDMGLVPKIMKRLPLVSIFLAAIGIVLFLMLPMDGQYRHTYISENALMP 60
           MALL  +HRR++DMGLVP+I+  LP++S   A  G +   +LPMDGQYR TYISENALMP
Sbjct: 1   MALLEKLHRRIVDMGLVPRIIALLPVISTLCALFGFISIAILPMDGQYRRTYISENALMP 60

Query: 61  SQAYSYFRESEWNILRGYRTEIDIFPSMPSRDRNLVMTQWLEEFGTKTSVYHNDEYGDTL 120
           SQAYSYFRESEWN+LRGYR++I+   +M S +RN  M  WL+EFGTKT++Y + +YG+TL
Sbjct: 61  SQAYSYFRESEWNVLRGYRSQIEEMENMTSSERNNQMGSWLQEFGTKTAIYESQQYGETL 120

Query: 121 YGIFNAPRGDGTEAIVLAIPWYNADGEFNTGGAALGIALSRFFSRWPIWSKNIIVVFSEN 180
           YG+ +APRGDGTEA+VLAIPW+N+D EFN GGAALG++L+RFFSRWP+WSKNIIVVFSEN
Sbjct: 121 YGVMHAPRGDGTEAMVLAIPWFNSDDEFNVGGAALGVSLARFFSRWPVWSKNIIVVFSEN 180

Query: 181 PDGALRSWVDAYHHSLDLTGGSIEAAIVMDYPSSSDFFDYVEIYYHGINGELPNLDLLNI 240
           P  ALRSWV+AYH SLDLTGGSIEAA+V+DY S+ DFF+YVEI Y G+NGELPNLDL+NI
Sbjct: 181 PRAALRSWVEAYHTSLDLTGGSIEAAVVLDYSSAEDFFEYVEISYDGLNGELPNLDLVNI 240

Query: 241 AIQITEHEGMQVSLHGLPKESLHQNNYFSRLRTLLLGTKDALLSGIKPRHGNEAFSGFRI 300
           AI ITEHEGM+VSLHGLP + L  N+++SRL+ L LG +D  LSG+K  HGNEAFSG+RI
Sbjct: 241 AISITEHEGMKVSLHGLPYDQLANNDFWSRLKILSLGIRDWALSGVKNPHGNEAFSGWRI 300

Query: 301 QAITLKAKFTPDNNDHDITSFGRIAEASFRSVNNLLEKFHQSFFFYLILAPKYFVSISSY 360
           Q++TLKA     +  HDIT+FGRI EA FRS+NNLLEKFHQSFFFYL+LAP+ FVSISSY
Sbjct: 301 QSVTLKAH---GHGGHDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSY 357

Query: 361 LPSAVTFSVAFAXXXXXXXXXXXXXXXPIFSEYNLLAGLLFTISITFSFFVARLSLLFTE 420
           LPSAV FSVAFA                +FSEYNL+A L++ IS+  SF ++++ LL   
Sbjct: 358 LPSAVAFSVAFAISSLNAFINNAYASISLFSEYNLVALLVWFISLVVSFIISQIFLLVPS 417

Query: 421 PRXXXXXXXXXXXXPHLLGNRFTIPEPLSYRLKSIAFLYISLVLTSLLVLNFSLAFGIGI 480
                         P +L  +  I EPLSYRLK++AFLY SLV TSLL++NF++A  IG 
Sbjct: 418 VGLLMTISLATCFLPLVLSEKVHISEPLSYRLKNVAFLYFSLVSTSLLMINFAMALLIGS 477

Query: 481 LGFAMTAVKTITI------------HSSMRVRVRNTM----------------------H 506
           L F MT ++TI +            H+S++   R+ +                       
Sbjct: 478 LAFPMTFIRTIVVGKSTEHEMGTKSHTSVKTESRDDLFEHHGDTVLEKAKKRQQLKNLLL 537

Query: 507 LLLSNPFTSVLLFTYIFDKDIYGIKIFYEFIHSWNTLNCWTWFIICVGWLPPWILVSISS 566
           L+L+NPF S+ LF  +FD + +G  I  + I +W  L CW WF++C+GWLP W+L+  SS
Sbjct: 538 LVLTNPFISITLFALVFDNEFHGFDIVNKLISAWLDLKCWNWFVLCIGWLPCWLLILASS 597

Query: 567 IQTNTVM 573
            ++ +V+
Sbjct: 598 FESRSVV 604

>Kpol_543.37 s543 (82589..84325) [1737 bp, 578 aa] {ON}
           (82589..84325) [1737 nt, 579 aa]
          Length = 578

 Score =  682 bits (1760), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/583 (55%), Positives = 427/583 (73%), Gaps = 5/583 (0%)

Query: 1   MALLATIHRRVIDMGLVPKIMKRLPLVSIFLAAIGIVLFLMLPMDGQYRHTYISENALMP 60
           M++L  + RR+ID GL+PK +  LP +S+ L ++ ++L L LPMDGQ+R TYISENALMP
Sbjct: 1   MSILENLQRRLIDAGLLPKFLAALPKLSMLLVSVSVMLMLYLPMDGQFRRTYISENALMP 60

Query: 61  SQAYSYFRESEWNILRGYRTEIDIFPSMPSRDRNLVMTQWLEEFGTKTSVYHNDEYGDTL 120
           SQAYSYFRE+EWNILRGYR EI++  S  S +RN +M+ WLEEFG KTSVY N EYGD+L
Sbjct: 61  SQAYSYFRETEWNILRGYRKEIEVLSSHSSIERNAIMSSWLEEFGLKTSVYKNQEYGDSL 120

Query: 121 YGIFNAPRGDGTEAIVLAIPWYNADGEFNTGGAALGIALSRFFSRWPIWSKNIIVVFSEN 180
           YG+FNAPRGDGTE++VLA+PWYNA+ EFN  GAALG++L+RF SRWP+WSKNIIVVFSEN
Sbjct: 121 YGVFNAPRGDGTESMVLAVPWYNAEDEFNVSGAALGVSLARFLSRWPVWSKNIIVVFSEN 180

Query: 181 PDGALRSWVDAYHHSLDLTGGSIEAAIVMDYPSSSDFFDYVEIYYHGINGELPNLDLLNI 240
           P  ALRSWV+AYH SLDLTGGSIEAA+V+DYP  SD+F+Y+E++Y+G NG LPNLDL+NI
Sbjct: 181 PREALRSWVEAYHTSLDLTGGSIEAAVVLDYPGVSDYFEYIEVHYNGYNGVLPNLDLVNI 240

Query: 241 AIQITEHEGMQVSLHGLPKESLHQNNYFSRLRTLLLGTKDALLSGIKPRHGNEAFSGFRI 300
           AI I EHEG++VSLHGL  + +   +Y+SRL+ + LGTK+  L+G++  +GNEAFSG+RI
Sbjct: 241 AISIAEHEGLKVSLHGLTPDEMGNGDYWSRLKMISLGTKNLALTGVREVYGNEAFSGWRI 300

Query: 301 QAITLKAKFTPDNNDHDITSFGRIAEASFRSVNNLLEKFHQSFFFYLILAPKYFVSISSY 360
           QA+TLKA+    + +HD+T+FGR+AEA FRS+NNLLEKFHQSFFFY +LAP+YFVSI SY
Sbjct: 301 QALTLKAR---GDTNHDVTTFGRVAEAMFRSINNLLEKFHQSFFFYFLLAPRYFVSIGSY 357

Query: 361 LPSAVTFSVAFAXXXXXXXXXXXXXXXPIFSEYNLLAGLLFTISITFSFFVARLSLLFTE 420
           LP+AV  S++FA                  S YNLL+ + + +S+   FF+      + +
Sbjct: 358 LPAAVVLSISFAVASIDSFVNNQYVSMVDSSYYNLLSFIFWAVSVIVCFFLGNSFTYYPQ 417

Query: 421 PRXXXXXXXXXXXXPHLLGNRFTIPEPLSYRLKSIAFLYISLVLTSLLVLNFSLAFGIGI 480
           P             P       +I EPL+YRLK+I+F+Y+SLV+TSLLV+NF LAFG+G+
Sbjct: 418 PLLLLLGNVVISTIPLAAPKNLSISEPLAYRLKTISFMYLSLVMTSLLVVNFPLAFGMGL 477

Query: 481 LGFAMTAVKTITIHSSMRVRVRNTMHLLLSNPFTSVLLFTYIFDKDIYGIKIFYEFIHSW 540
             + MT V  +    ++R++ RN++ L +SNPF +  LF  I +  + GI+  Y  + +W
Sbjct: 478 FAYPMTLV-MLNNTDNLRLKTRNSILLAISNPFIAFWLFITIVESKLDGIEAIYGLVDAW 536

Query: 541 NTLNCWTWFIICVGWLPPWILVSISSIQTNTVMQSPDYGKKQL 583
           N L  WTWFI C+GW P WILV+IS+++   V   P+  KK L
Sbjct: 537 NKLGSWTWFIFCIGWFPSWILVAISALKVEQVQTEPN-SKKHL 578

>TDEL0F03880 Chr6 (722770..724509) [1740 bp, 579 aa] {ON} Anc_8.261
           YLR088W
          Length = 579

 Score =  680 bits (1754), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/582 (55%), Positives = 433/582 (74%), Gaps = 6/582 (1%)

Query: 1   MALLATIHRRVIDMGLVPKIMKRLPLVSIFLAAIGIVLFLMLPMDGQYRHTYISENALMP 60
           M+L+  +HRRVID+GLVPKI+  LPL+S+  A + +    +LP++G+YR TYISENAL+P
Sbjct: 1   MSLIGKLHRRVIDLGLVPKIVAALPLLSMLFAVVSVGWLALLPLEGRYRRTYISENALLP 60

Query: 61  SQAYSYFRESEWNILRGYRTEIDIFPSMPSRDRNLVMTQWLEEFGTKTSVYHNDEYGDTL 120
           SQAYSYFRE+EWN LRGYRT+I+   +  SR+RN  +  WL EFG KT++Y ++++GDTL
Sbjct: 61  SQAYSYFRETEWNTLRGYRTQIERLANSTSRERNEEVAGWLREFGVKTAIYQDEKHGDTL 120

Query: 121 YGIFNAPRGDGTEAIVLAIPWYNADGEFNTGGAALGIALSRFFSRWPIWSKNIIVVFSEN 180
           YG+ +A RGDGTEA++LA PW NADG  N  G ++GIAL+RFFSRWP+WSKNIIVV SEN
Sbjct: 121 YGVLHAQRGDGTEAVILAAPWTNADGMVNLSGVSIGIALTRFFSRWPVWSKNIIVVLSEN 180

Query: 181 PDGALRSWVDAYHHSLDLTGGSIEAAIVMDYPSSSDFFDYVEIYYHGINGELPNLDLLNI 240
           P G++RSWV+AYH SLDLTGGSIEAA+V+DYP  +D+FD+VEI+Y G+NGE PNLDL+NI
Sbjct: 181 PKGSMRSWVEAYHTSLDLTGGSIEAAVVLDYPGVNDYFDHVEIHYDGLNGEEPNLDLVNI 240

Query: 241 AIQITEHEGMQVSLHGLPKESLHQNNYFSRLRTLLLGTKDALLSGIKPRHGNEAFSGFRI 300
           AI ITEHEGM+VSLHG+  + +  N+++SRL  +L G K+A LSG++  +GNEAFSG+RI
Sbjct: 241 AISITEHEGMKVSLHGVSCDKISDNDFWSRLLIMLTGIKNAALSGLRKVNGNEAFSGWRI 300

Query: 301 QAITLKAKFTPDNNDHDITSFGRIAEASFRSVNNLLEKFHQSFFFYLILAPKYFVSISSY 360
           QA+TLKA  T     HD+T+FGRI EA FRS+NNLLEKFHQSFFFY++LAP+YFVSISSY
Sbjct: 301 QAVTLKAHGT--EGRHDVTTFGRIPEAMFRSINNLLEKFHQSFFFYILLAPRYFVSISSY 358

Query: 361 LPSAVTFSVAFAXXXXXXXXXXXXXXXPIFSEYNLLAGLLFTISITFSFFVARLSLLFTE 420
           LP AVT S++FA               P+ S YNLL+  ++ IS+   F +A+L L F  
Sbjct: 359 LPCAVTLSISFALASLDAMINNNYKKLPLSSTYNLLSLSMWCISLLGCFGIAQLFLRFDA 418

Query: 421 PRXXXXXXXXXXXXPHLLGNRFTIPEPLSYRLKSIAFLYISLVLTSLLVLNFSLAFGIGI 480
           P             P LL  +  I EPL+YRLKS+AFL+ SLVLTSLL++NF LAF +G+
Sbjct: 419 PTILISFSALISFLPLLLKKK--IAEPLAYRLKSVAFLFFSLVLTSLLMVNFFLAFAMGL 476

Query: 481 LGFAMTAVKTITIHS-SMRVRVRNTMHLLLSNPFTSVLLFTYIFDKDIYGIKIFYEFIHS 539
             F MT V+T ++++ S+R++++N++ LLLSNPF +  +F   F+ D+ G  +F EF  +
Sbjct: 477 TAFPMTLVRTSSLNNYSLRIKLKNSILLLLSNPFIASYIFCQCFEPDLPGFTVFTEFATA 536

Query: 540 WNTLNCWTWFIICVGWLPPWILVSISSIQTNTVMQSPDYGKK 581
           W  L CWTWF+IC+GWLP W++V++S++ T    Q  D  KK
Sbjct: 537 WKELGCWTWFVICIGWLPSWLMVALSTLNTQPA-QLDDRKKK 577

>KLTH0G13706g Chr7 complement(1173326..1175080) [1755 bp, 584 aa]
           {ON} similar to uniprot|P39012 Saccharomyces cerevisiae
           YLR088W GAA1 Subunit of the GPI:protein transamidase
           complex removes the GPI-anchoring signal and attaches
           GPI (glycosylphosphatidylinositol) to proteins in the ER
          Length = 584

 Score =  679 bits (1751), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/571 (56%), Positives = 427/571 (74%), Gaps = 13/571 (2%)

Query: 1   MALLATIHRRVIDMGLVPKIMKRLPLVSIFLAAIGIV-LFLMLPMDGQYRHTYISENALM 59
           MAL+  + RR+ID+GL+P+I++ LP +SI    +GI  L L+LP++GQYRHTYISENALM
Sbjct: 1   MALIEKLQRRIIDLGLLPRIVRFLPKLSILCGILGICWLTLLLPLEGQYRHTYISENALM 60

Query: 60  PSQAYSYFRESEWNILRGYRTEIDIFPSMPSRDRNLVMTQWLEEFGTKTSVYHNDEYGDT 119
           PSQAYSYFRE+EWNILRGYRT+I +     S++RN V+  W +EFG KT+ Y +D +G+T
Sbjct: 61  PSQAYSYFRETEWNILRGYRTQIQVLEEKSSKERNEVVASWFQEFGAKTAFYEDDLHGNT 120

Query: 120 LYGIFNAPRGDGTEAIVLAIPWYNADGEFNTGGAALGIALSRFFSRWPIWSKNIIVVFSE 179
           +YG+ +APRGDGTEA+VLA PWYN DGE+N GGAAL  ALSRFFSRWP+WSKNII+VFS+
Sbjct: 121 MYGVLHAPRGDGTEAMVLAAPWYNGDGEYNIGGAALATALSRFFSRWPVWSKNIIIVFSD 180

Query: 180 NPDGALRSWVDAYHHSLDLTGGSIEAAIVMDYPSSSDFFDYVEIYYHGINGELPNLDLLN 239
           +P+ +LRSWV AYH SLDLTGGSIE+A+V+DYP S+DFF YVEIYY G+NGELPNLDL+N
Sbjct: 181 DPEASLRSWVHAYHTSLDLTGGSIESAVVLDYPGSNDFFKYVEIYYAGLNGELPNLDLVN 240

Query: 240 IAIQITEHEGMQVSLHGLPKESLHQNNYFSRLRTLLLGTKDALLSGIKPRHGNEAFSGFR 299
           +A+ ITEHEGM+VSL+G+ +E + + NYFS+++T+++G K   LSG++  +GNEAFSG+R
Sbjct: 241 VAVHITEHEGMKVSLNGVSEEEMEKRNYFSKMKTMMVGVKKMALSGVQSCYGNEAFSGWR 300

Query: 300 IQAITLKAKFTPDNNDHDITSFGRIAEASFRSVNNLLEKFHQSFFFYLILAPKYFVSISS 359
           IQAI L+A+ T  +   DIT+FGRI EA+FRSVNNLLEKFHQSFFFYL+LAP+YFVSI+S
Sbjct: 301 IQAIVLRARGT--DGPFDITTFGRIPEATFRSVNNLLEKFHQSFFFYLLLAPRYFVSIAS 358

Query: 360 YLPSAVTFSVAFAXXXXXXXXXXXXXXXPIFSEYNLLAGLLFTISITFSFFVARLSLLFT 419
           YLP+AV FSV+F                P FS +NL A + FT+++  SF    LS+LF+
Sbjct: 359 YLPAAVAFSVSFIVATLDCVLKSGASNTPAFSVHNLSAVIGFTVALLLSF---ALSILFS 415

Query: 420 E---PRXXXXXXXXXXXXPHLLGNRFTIPEPLSYRLKSIAFLYISLVLTSLLVLNFSLAF 476
                             P + G R  I    SY+ KS+AFLY+S+VLTSLLV+NF+LAF
Sbjct: 416 HWQYSSLLISCNAVIAVLPAIFG-RQGIEASHSYQFKSVAFLYLSVVLTSLLVINFALAF 474

Query: 477 GIGILGFAMTAVKTITIHSSMRVRVRNTMHLLLSNPFTSVLLFTYIFDKDIYGIKIFYEF 536
           GIG+L F +  VK      + R RV+NT+ L+LSNPF S LLF   F+  + G+++F+  
Sbjct: 475 GIGLLAFPLILVKAPM---TSRQRVKNTILLILSNPFISTLLFVNTFEPQLSGLQLFHRL 531

Query: 537 IHSWNTLNCWTWFIICVGWLPPWILVSISSI 567
           + +W  L CWTW ++C+GWLP W+LV+ S I
Sbjct: 532 VQAWQKLGCWTWSVVCIGWLPSWLLVACSGI 562

>Suva_10.172 Chr10 (320928..322772) [1845 bp, 614 aa] {ON} YLR088W
           (REAL)
          Length = 614

 Score =  678 bits (1750), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 334/609 (54%), Positives = 429/609 (70%), Gaps = 39/609 (6%)

Query: 1   MALLATIHRRVIDMGLVPKIMKRLPLVSIFLAAIGIVLFLMLPMDGQYRHTYISENALMP 60
           MALL  +HRRV+DMGLVP+++  LP++S   A  G +   +LPMDGQYR TYISENALMP
Sbjct: 1   MALLEKLHRRVVDMGLVPRVIALLPVISTLCALFGFISIAILPMDGQYRRTYISENALMP 60

Query: 61  SQAYSYFRESEWNILRGYRTEIDIFPSMPSRDRNLVMTQWLEEFGTKTSVYHNDEYGDTL 120
           SQAYSYFRE+EWNILRGYR++I+   +M S +RN +M  WL+EFGTKT++Y N++YG+TL
Sbjct: 61  SQAYSYFRETEWNILRGYRSQIEETVNMTSTERNNLMGSWLQEFGTKTAIYENEQYGETL 120

Query: 121 YGIFNAPRGDGTEAIVLAIPWYNADGEFNTGGAALGIALSRFFSRWPIWSKNIIVVFSEN 180
           YG+ +APRGDGTEA+VLAIPW+N++ EFN GGA+LG++L+RFFSRWP+WSKNIIVVFSEN
Sbjct: 121 YGVMHAPRGDGTEAMVLAIPWFNSEKEFNVGGASLGVSLARFFSRWPVWSKNIIVVFSEN 180

Query: 181 PDGALRSWVDAYHHSLDLTGGSIEAAIVMDYPSSSDFFDYVEIYYHGINGELPNLDLLNI 240
           P  ALRSWV+AYH SLDLTGGSIEAA+V+DY S+ DFF+YVE+ Y G+NGELPNLDL+N+
Sbjct: 181 PHAALRSWVEAYHTSLDLTGGSIEAAVVLDYSSAEDFFEYVEVSYDGLNGELPNLDLVNV 240

Query: 241 AIQITEHEGMQVSLHGLPKESLHQNNYFSRLRTLLLGTKDALLSGIKPRHGNEAFSGFRI 300
           AI I EHEGM+VSLHGLP E L  N++FSRL+ L LG +D  LSG+K  HGNEAFSG+RI
Sbjct: 241 AISIIEHEGMKVSLHGLPYEQLGDNDFFSRLKILCLGIRDWALSGVKNPHGNEAFSGWRI 300

Query: 301 QAITLKAKFTPDNNDHDITSFGRIAEASFRSVNNLLEKFHQSFFFYLILAPKYFVSISSY 360
           Q++TLKA     +  HDIT+FGRI EA FRS+NNLLEKFHQSFFFYL+LAP+ FVSISSY
Sbjct: 301 QSVTLKAH---GHGGHDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSY 357

Query: 361 LPSAVTFSVAFAXXXXXXXXXXXXXXXPIFSEYNLLAGLLFTISITFSFFVARLSLLFTE 420
           LPSAV  SVAFA                +FSEYNL+A L++ I++  SF +++L L    
Sbjct: 358 LPSAVALSVAFAMSSLNAFINNDYASISLFSEYNLVAVLVWFIAMVVSFVISQLFLSVLP 417

Query: 421 PRXXXXXXXXXXXXPHLLGNRFTIPEPLSYRLKSIAFLYISLVLTSLLVLNFSLAFGIGI 480
                         P  L  +  I EPLSYRLK++AFLY SLV TSLL++NF++A  IG 
Sbjct: 418 AGLLMTISLAICFLPIALSGKVHISEPLSYRLKNVAFLYFSLVSTSLLMINFAMALLIGT 477

Query: 481 LGFAMTAVKTITIHS------------SMRVRVRNTMHL--------------------- 507
           L F MT +KTI +              S++    +   L                     
Sbjct: 478 LAFPMTFIKTIAVERPAEPETGTRSNISIKTEPNDETQLNKHYKEGTLEKNQQRQKLKNL 537

Query: 508 ---LLSNPFTSVLLFTYIFDKDIYGIKIFYEFIHSWNTLNCWTWFIICVGWLPPWILVSI 564
              +L+NPF S+ +F  +FD +  G  I  + + +W  L CW+WFI+C+GWLP W+L+  
Sbjct: 538 LLLILTNPFISITVFGLLFDDEFQGFDIINKLVSAWIDLKCWSWFILCLGWLPCWLLILA 597

Query: 565 SSIQTNTVM 573
           SS ++ +V+
Sbjct: 598 SSFESKSVV 606

>KLLA0F19118g Chr6 (1771250..1772986) [1737 bp, 578 aa] {ON} similar
           to uniprot|P39012 Saccharomyces cerevisiae YLR088W GAA1
           Subunit of the GPI:protein transamidase complex removes
           the GPI-anchoring signal and attaches GPI
           (glycosylphosphatidylinositol) to proteins in the ER
          Length = 578

 Score =  659 bits (1700), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/578 (55%), Positives = 423/578 (73%), Gaps = 6/578 (1%)

Query: 1   MALLATIHRRVIDMGLVPKIMKRLPLVSIFLAAIGIV-LFLMLPMDGQYRHTYISENALM 59
           MAL+  +HRR+I +GL+PK + +L  +S+    IG+  L  MLP DGQ+R TYISENAL+
Sbjct: 1   MALVEKLHRRIISIGLIPKFISKLSQLSLLCCVIGLGWLVFMLPSDGQFRRTYISENALL 60

Query: 60  PSQAYSYFRESEWNILRGYRTEIDIFPSMPS-RDRNLVMTQWLEEFGTKTSVYHNDEYGD 118
           PSQAYSYFRESEWNILRGYRT++D+F  + +  D N  +++WL+EFG KT++Y +++YG+
Sbjct: 61  PSQAYSYFRESEWNILRGYRTQLDLFQYVSTTHDSNAEVSKWLQEFGVKTAIYDDEQYGE 120

Query: 119 TLYGIFNAPRGDGTEAIVLAIPWYNADGEFNTGGAALGIALSRFFSRWPIWSKNIIVVFS 178
           TLYGIF+APRGDGTEA+V+A PWYN + E+NTGGAAL I+L RFFSRWP+WSKNII+V S
Sbjct: 121 TLYGIFHAPRGDGTEAMVIAAPWYNENREYNTGGAALAISLVRFFSRWPVWSKNIIIVLS 180

Query: 179 ENPDGALRSWVDAYHHSLDLTGGSIEAAIVMDYPSSSDFFDYVEIYYHGINGELPNLDLL 238
           E+P  +LRSWV AYH SLDLTGGSIE+AIV+DYP +SD FDY+EI+Y G+NGE PNLDL+
Sbjct: 181 EDPKASLRSWVTAYHTSLDLTGGSIESAIVLDYPGTSDRFDYMEIHYDGLNGETPNLDLV 240

Query: 239 NIAIQITEHEGMQVSLHGLPKESLHQNNYFSRLRTLLLGTKDALLSGIKPRHGNEAFSGF 298
           N+A+ I EHEG++VSLHGLP   L +N+Y SRL+T+LLG KD++LSGIK  +GNEAFSG+
Sbjct: 241 NVAVHIAEHEGIKVSLHGLPFSELDRNDYNSRLKTMLLGIKDSVLSGIKNCYGNEAFSGW 300

Query: 299 RIQAITLKAKFTPDNNDHDITSFGRIAEASFRSVNNLLEKFHQSFFFYLILAPKYFVSIS 358
           RIQ++TLKAK    +  HDIT+FGR+ EA  RSVNNLLEKFHQSFFFYL+LAP+YF+SI 
Sbjct: 301 RIQSLTLKAKGI--DGPHDITTFGRVPEALSRSVNNLLEKFHQSFFFYLLLAPRYFISIG 358

Query: 359 SYLPSAVTFSVAFAXXXXXXXXXXXXXXXPIFSEYNLLAGLLFTISITFSFFVARLSLLF 418
           +YL +AV  SVAF                P+ S YN+ + L F IS+ F+F  ++L + F
Sbjct: 359 TYLATAVAVSVAFVFAALNQILNNKYGELPLLSIYNIWSILTFCISLVFAFATSQLFVYF 418

Query: 419 TEPRXXXXXXXXXXXXPHLLGNRFTIPEPLSYRLKSIAFLYISLVLTSLLVLNFSLAFGI 478
             PR            P L   R  I EP SYR K+ A++Y+++VLTSLLVLNFSLA  +
Sbjct: 419 PLPRVLLGLSGIFSVLPLLSRTRLRIQEPFSYRFKAFAYIYMAIVLTSLLVLNFSLAIVM 478

Query: 479 GILGFAMTAVKTITIHSSMRVRVRNTMHLLLSNPFTSVLLFTYIFDKDIYGIKIFYEFIH 538
           G+L F MT   TI I S++R+ ++N + L++SNPF +        +  + G K+FY  I 
Sbjct: 479 GLLAFPMTRTTTI-IESNLRLSIKNLVLLIISNPFIATWAVVNFVEPRLSGFKVFYALIE 537

Query: 539 SWNTLNCWTWFIICVGWLPPWILVSISSIQTNTVMQSP 576
           +   L CWTW+IIC+GW P W+LV+ +SI    V Q+P
Sbjct: 538 ASQQLGCWTWYIICLGWYPSWLLVTYASIDAIEV-QTP 574

>NDAI0J01390 Chr10 complement(319754..321505) [1752 bp, 583 aa] {ON}
           Anc_8.261 YLR088W
          Length = 583

 Score =  647 bits (1669), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/586 (52%), Positives = 421/586 (71%), Gaps = 7/586 (1%)

Query: 1   MALLATIHRRVIDMGLVPKIMKRLPLVSIFLAAIGIVLFLMLPMDGQYRHTYISENALMP 60
           M LL  + R ++  GL+PKIM +LP +SI   AI I++  +LPMDGQYR+TYISENALMP
Sbjct: 1   MGLLERVQRVIVSRGLIPKIMAQLPKISIIFVAISILMIAILPMDGQYRNTYISENALMP 60

Query: 61  SQAYSYFRESEWNILRGYRTEIDIFPSMPSRDRNLVMTQWLEEFGTKTSVYHNDEYGDTL 120
           SQAYSYFRE+EWNI+RGYR E+    +  SR+RN +M  WL EFG KT +Y N +  + L
Sbjct: 61  SQAYSYFRETEWNIVRGYRNELVHMENSTSRERNQIMESWLNEFGVKTQIYENRD-NEVL 119

Query: 121 YGIFNAPRGDGTEAIVLAIPWYNADGEFNTGGAALGIALSRFFSRWPIWSKNIIVVFSEN 180
           YG+F+APRGDGTEAIVLA+PW+N DGEFNT GAA+G+AL+R+FSRWP+WSKNIIVVFSEN
Sbjct: 120 YGVFHAPRGDGTEAIVLAVPWFNVDGEFNTNGAAVGVALARYFSRWPVWSKNIIVVFSEN 179

Query: 181 PDGALRSWVDAYHHSLDLTGGSIEAAIVMDYPSSSDFFDYVEIYYHGINGELPNLDLLNI 240
           PD ALRSWV+AY+ SLDLTGGSIEAAIV+D P  +D+FDY+E+YY G+NGELPNLDL+NI
Sbjct: 180 PDSALRSWVEAYYTSLDLTGGSIEAAIVLDSPGENDYFDYLEVYYDGLNGELPNLDLVNI 239

Query: 241 AIQITEHEGMQVSLHGLPKESLHQNNYFSRLRTLLLGTKDALLSGIKPRHGNEAFSGFRI 300
            I I EHEGM+VSLHG P + + +NNY++RL+ L+   + +  SG+   HGNEAFSG+RI
Sbjct: 240 GIYIAEHEGMRVSLHGTPFDQIKENNYWTRLKILVASIQSSAFSGLTKTHGNEAFSGWRI 299

Query: 301 QAITLKAKFTPDNNDHDITSFGRIAEASFRSVNNLLEKFHQSFFFYLILAPKYFVSISSY 360
           Q+ITLK K   ++   DIT FGR+ EA FRS+NNLLEKFHQSFFFYL+LAP+ FVSISSY
Sbjct: 300 QSITLKTK--GNSGPLDITCFGRVPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSY 357

Query: 361 LPSAVTFSVAFAXXXXXXXXXXXXXXXPIFSEYNLLAGLLFTISITFSFFVARLSLLFTE 420
           LPSAV  SVAF                P FS Y L+  +++T+++   F +A+L L+   
Sbjct: 358 LPSAVILSVAFVIAFMDSYINNPSFALPFFSNYTLIPAIVWTVTLVACFILAQLFLILPI 417

Query: 421 PRXXXXXXXXXXXXPHLLGNRFTIPEPLSYRLKSIAFLYISLVLTSLLVLNFSLAFGIGI 480
           P               ++ N+      +S RL+S AFL++SL+LTSLL++NF L+F IG+
Sbjct: 418 PSLLLLINIVISISSIIIQNKKLFKPAVSNRLRSFAFLHLSLILTSLLMVNFPLSFMIGL 477

Query: 481 LGFAMTAVKTITIHSSMRVRVRNTMHLLLSNPFTSVLLFTYIFD----KDIYGIKIFYEF 536
           + F MT V++IT +++ ++++ N + L++SNPF +++++  +      + + G+++    
Sbjct: 478 MAFPMTKVRSITANTAPQIKLENIILLMISNPFIALIIYNNVSSNSGLQGLQGLRVINRL 537

Query: 537 IHSWNTLNCWTWFIICVGWLPPWILVSISSIQTNTVMQSPDYGKKQ 582
           I +W  + CWTWF++C+GWLP WI+V+IS I+      S D  K +
Sbjct: 538 ISAWKDMRCWTWFVLCLGWLPSWIMVAISVIENEREPTSHDVKKNE 583

>AGR087C Chr7 complement(890706..892439) [1734 bp, 577 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR088W
           (GAA1)
          Length = 577

 Score =  646 bits (1666), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/570 (54%), Positives = 415/570 (72%), Gaps = 5/570 (0%)

Query: 1   MALLATIHRRVIDMGLVPKIMKRLPLVSIFLAAIGIV-LFLMLPMDGQYRHTYISENALM 59
           MA+L  +HR+V+DMGLVPKI+  L  +S     + +  L L LPM+GQYR TYISENALM
Sbjct: 1   MAVLEKLHRKVVDMGLVPKIIFSLAKISYVTTLLSVAWLTLFLPMEGQYRRTYISENALM 60

Query: 60  PSQAYSYFRESEWNILRGYRTEIDIFPSMPSRDRNLVMTQWLEEFGTKTSVYHNDEYGDT 119
           PSQAYSYFRESEWNILRGYR+EID   ++ + +RN ++  W+EE+G K +VY++D +G+T
Sbjct: 61  PSQAYSYFRESEWNILRGYRSEIDGMRTLTADERNRIVASWMEEYGAKAAVYNDDRHGET 120

Query: 120 LYGIFNAPRGDGTEAIVLAIPWYNADGEFNTGGAALGIALSRFFSRWPIWSKNIIVVFSE 179
           LY + +A RGDGTEA+VLA PW   +G++NTGG AL +A+ R+FSRWP+WSKNII+V SE
Sbjct: 121 LYAVLHATRGDGTEAMVLAAPWETVEGQYNTGGVALAVAMGRYFSRWPVWSKNIIIVLSE 180

Query: 180 NPDGALRSWVDAYHHSLDLTGGSIEAAIVMDYPSSSDFFDYVEIYYHGINGELPNLDLLN 239
           +P  +LRSWV AYH  LDLTGGSIEAAIV+DYP ++D+F +VEI Y G+NG +PNLDLLN
Sbjct: 181 DPHASLRSWVQAYHTKLDLTGGSIEAAIVLDYPGTNDYFQHVEISYEGLNGGMPNLDLLN 240

Query: 240 IAIQITEHEGMQVSLHGLPKESLHQNNYFSRLRTLLLGTKDALLSGIKPRHGNEAFSGFR 299
           +A+ ITEHEGM+V+LHG P E L  + YFSR+R LL G KD  LSGIK   GNEAFSG+R
Sbjct: 241 VAVHITEHEGMKVALHGTPWEELGTDTYFSRMRLLLKGIKDMALSGIKRTSGNEAFSGWR 300

Query: 300 IQAITLKAKFTPDNNDHDITSFGRIAEASFRSVNNLLEKFHQSFFFYLILAPKYFVSISS 359
           IQ++TLKA+ T  N   DIT+FGR+ EA FRSVNNLLEKFHQSFFFYL+LAP+YFVSI S
Sbjct: 301 IQSVTLKARGT--NGSFDITTFGRVPEAMFRSVNNLLEKFHQSFFFYLLLAPRYFVSIGS 358

Query: 360 YLPSAVTFSVAFAXXXXXXXXXXXXXXXPIFSEYNLLAGLLFTISITFSFFVARLSLLFT 419
           YLP+AV  S++FA               P+ S YN+ A L F++++  S   A +     
Sbjct: 359 YLPAAVGLSISFAVMACDSVLNNEFASLPLISIYNIWALLAFSVALLVSAITAEVFFYLP 418

Query: 420 EPRXXXXXXXXXXXXPHLLGNRFTIPEPLSYRLKSIAFLYISLVLTSLLVLNFSLAFGIG 479
            P             P  L  ++ I +P S+R K+ A+LY S VL+SLLV+NF LAF +G
Sbjct: 419 APALLLAFNVVVSFMPFAL-VKYKIQKPFSHRFKAAAYLYFSTVLSSLLVMNFQLAFMVG 477

Query: 480 ILGFAMTAVKTITIHSSMRVRVRNTMHLLLSNPFTSVLLFTYIFDKDIYGIKIFYEFIHS 539
           +L F MT V+T T+H+S+R +++N++ LLLSNPF S+ +F ++F+ ++ G  +FY  I +
Sbjct: 478 LLAFPMTFVRT-TVHASVRQKMKNSLLLLLSNPFISICVFVHLFEPELTGFSVFYSLIDA 536

Query: 540 WNTLNCWTWFIICVGWLPPWILVSISSIQT 569
           WN L CWTW+++C+GW P WI+V+ SSI +
Sbjct: 537 WNDLGCWTWYVLCLGWYPAWIMVAYSSIDS 566

>Kwal_56.23804 s56 complement(710216..711952) [1737 bp, 578 aa] {ON}
           YLR088W (GAA1) - Possible component of GPI:protein
           transamidase [contig 173] FULL
          Length = 578

 Score =  640 bits (1652), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/572 (54%), Positives = 423/572 (73%), Gaps = 7/572 (1%)

Query: 1   MALLATIHRRVIDMGLVPKIMKRLPLVSIFLAAIGIV-LFLMLPMDGQYRHTYISENALM 59
           MAL+  + R+VID+GL+P+I++ LP +S+    IGI  + L+LP++GQYRHTYISENALM
Sbjct: 1   MALIERLQRKVIDLGLLPRIVRFLPKLSVLCGIIGIFWVTLLLPLEGQYRHTYISENALM 60

Query: 60  PSQAYSYFRESEWNILRGYRTEIDIFPSMPSRDRNLVMTQWLEEFGTKTSVYHNDEYGDT 119
           PSQAYSYFRE+EWNILRGYRT+I    +  S +RN ++  WL+EFG KT++Y ++  G+T
Sbjct: 61  PSQAYSYFRETEWNILRGYRTQIQTLENKSSLERNEILGSWLQEFGVKTALYEDESCGNT 120

Query: 120 LYGIFNAPRGDGTEAIVLAIPWYNADGEFNTGGAALGIALSRFFSRWPIWSKNIIVVFSE 179
           LYG+ +APRGDGTEA+VL+ PW+N DGEFN GG AL +AL+R+FSRWP+WSKNIIVVFS+
Sbjct: 121 LYGVLHAPRGDGTEAMVLSAPWFNGDGEFNKGGTALVVALARYFSRWPVWSKNIIVVFSD 180

Query: 180 NPDGALRSWVDAYHHSLDLTGGSIEAAIVMDYPSSSDFFDYVEIYYHGINGELPNLDLLN 239
           +P  +LRSWV AYH SLDLTGGSIE+A+V+DYP  +DFF YVEIYY G+NGELPNLDL+N
Sbjct: 181 DPKASLRSWVQAYHTSLDLTGGSIESAVVLDYPGVNDFFKYVEIYYAGLNGELPNLDLVN 240

Query: 240 IAIQITEHEGMQVSLHGLPKESLHQNNYFSRLRTLLLGTKDALLSGIKPRHGNEAFSGFR 299
           +AI +TEHEGM+VSL+G+P++ +   +YF+R++T+++G K   LSG++  +GNEAFSG+R
Sbjct: 241 VAIHVTEHEGMKVSLNGIPEDEMQNRDYFARMKTMVVGIKKMALSGVQRCYGNEAFSGWR 300

Query: 300 IQAITLKAKFTPDNNDHDITSFGRIAEASFRSVNNLLEKFHQSFFFYLILAPKYFVSISS 359
           IQA+ L+A+   D+   DIT+FGR+ EA FRSVNNLLEKFHQSFFFYL+LAP+YFVSI+S
Sbjct: 301 IQAVVLRAR--GDHGPFDITTFGRVPEAVFRSVNNLLEKFHQSFFFYLLLAPRYFVSIAS 358

Query: 360 YLPSAVTFSVAFAXXXXXXXXXXXXXXXPIFSEYNLLAGLLFTISITFSFFVARLSLLFT 419
           YLP+AV FSV+F                      N+ A + FT+++ FSF V+     F 
Sbjct: 359 YLPAAVAFSVSFIVAALDNVLCQGASTSQSGILPNIAAVVGFTVALLFSFTVSVTFARFH 418

Query: 420 EPRXXXXXXXXXXXXPHLLGNRFTIPEPLSYRLKSIAFLYISLVLTSLLVLNFSLAFGIG 479
            P             P LL NR  I    ++RLK++A+LY+S+VLTSLLV+NF+LAFGIG
Sbjct: 419 HPVILISWSVMTALAPILL-NRVRIQSSYAHRLKAVAYLYLSVVLTSLLVVNFALAFGIG 477

Query: 480 ILGFAMTAVKTITIHSSMRVRVRNTMHLLLSNPFTSVLLFTYIFDKDIYGIKIFYEFIHS 539
           +L F +  VK  T   + R+  +N++ LLLSNPF S  LF Y F+  + G++I  + + +
Sbjct: 478 LLAFPLILVKNST---TPRLLFKNSLLLLLSNPFISTCLFAYFFEPLLPGLQILEQLVQA 534

Query: 540 WNTLNCWTWFIICVGWLPPWILVSISSIQTNT 571
           WN   CWTW ++C+GWLP W+L++ SS+ T+ 
Sbjct: 535 WNEFGCWTWCVVCIGWLPSWLLIAYSSMITDV 566

>ZYRO0C01672g Chr3 complement(119344..121053) [1710 bp, 569 aa] {ON}
           similar to uniprot|P39012 Saccharomyces cerevisiae
           YLR088W GAA1 Subunit of the GPI:protein transamidase
           complex removes the GPI-anchoring signal and attaches
           GPI (glycosylphosphatidylinositol) to proteins in the ER
          Length = 569

 Score =  639 bits (1647), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/582 (53%), Positives = 411/582 (70%), Gaps = 13/582 (2%)

Query: 1   MALLATIHRRVIDMGLVPKIMKRLPLVSIFLAAIGIVLFLMLPMDGQYRHTYISENALMP 60
           MAL+  + RRV++MGLVPKI+  LPLVS+  A I  +    LP++GQ+R TYISENALMP
Sbjct: 1   MALIEQLQRRVVEMGLVPKIIALLPLVSMICAMISSLWLATLPIEGQFRRTYISENALMP 60

Query: 61  SQAYSYFRESEWNILRGYRTEIDIFPSMPSRDRNLVMTQWLEEFGTKTSVYHNDEYGDTL 120
           SQAYSYFRESEWNILRGYR++I+ F  + + +RN  M +WL+EFG KTS+Y+N+EYGD+L
Sbjct: 61  SQAYSYFRESEWNILRGYRSQIEHFGEISNNERNEQMAEWLQEFGAKTSIYNNEEYGDSL 120

Query: 121 YGIFNAPRGDGTEAIVLAIPWYNADGEFNTGGAALGIALSRFFSRWPIWSKNIIVVFSEN 180
           YGI +A RGDGTEAI+LA+PWYNA+G+ N GGA+LGI+LSRFFSRWP+WSKNII+VFSEN
Sbjct: 121 YGILHAERGDGTEAILLAVPWYNAEGDLNVGGASLGISLSRFFSRWPVWSKNIIIVFSEN 180

Query: 181 PDGALRSWVDAYHHSLDLTGGSIEAAIVMDYPSSSDFFDYVEIYYHGINGELPNLDLLNI 240
           P+ ALRSWV AYH SLDLTGGSIEAAIV+DYP ++D+FDY EI Y G+NGELPNLDL+NI
Sbjct: 181 PNVALRSWVQAYHTSLDLTGGSIEAAIVLDYPGTNDYFDYAEISYGGLNGELPNLDLVNI 240

Query: 241 AIQITEHEGMQVSLHGLPKESLHQNNYFSRLRTLLLGTKDALLSGIKPRHGNEAFSGFRI 300
           A+ ITEHEG+ VSLHG+  ES++  +Y+SRL+ LL G      +G++P  GNEAFSG+RI
Sbjct: 241 AVSITEHEGVHVSLHGMTPESINDESYWSRLKILLCGIYRDAFAGLEPLQGNEAFSGWRI 300

Query: 301 QAITLKAKFTPDNNDHDITSFGRIAEASFRSVNNLLEKFHQSFFFYLILAPKYFVSISSY 360
           Q++T+KA    +  ++DIT+FGRI EA FRS+NNLLEKFHQS+FFY+++AP+YFVSISSY
Sbjct: 301 QSVTIKAH-GKEGGNNDITTFGRIPEAMFRSINNLLEKFHQSYFFYMLVAPRYFVSISSY 359

Query: 361 LPSAVTFSVAFAXXXXXXXXXXXXXXXPIFSEYNLLAGLLFTISITFSFFVARLSLLFTE 420
           LP+ V  +  FA                 +S YNL A L + +SI  SF  ++L L    
Sbjct: 360 LPATVVLTAGFALASLNSLLANQYSNLSFYSHYNLKALLFWLVSILVSFVFSQLFLYVPS 419

Query: 421 PRXXXXXXXXXXXXPHLLGNRFTIPEPLSYRLKSIAFLYISLVLTSLLVLNFSLAFGIGI 480
                         P   G  +TI EPLS+RL+  AFLY+SLV+TSL+++NF+LAF +GI
Sbjct: 420 TILLVAFIVVMLLLPLAAGRLWTITEPLSHRLQMYAFLYMSLVVTSLMMVNFTLAFVVGI 479

Query: 481 LGFAMTAVKTITIHSSMRVRVRNTMHLLLSNPFTSVLLFTYIFDKDIYGIKIFYEFIHSW 540
           L F MTAV T        +  +    L++SNP  S  +            ++  + I +W
Sbjct: 480 LAFPMTAVGT-----QRSLTFKKYALLIISNPLVSFFIVK-------PHPQLLQKLISAW 527

Query: 541 NTLNCWTWFIICVGWLPPWILVSISSIQTNTVMQSPDYGKKQ 582
             L CWTWF++C+GWLP W L+++S+  +  +       K+Q
Sbjct: 528 QDLGCWTWFVLCLGWLPSWTLIALSACSSTNLDPVATSKKEQ 569

>TPHA0A01820 Chr1 complement(367804..369549) [1746 bp, 581 aa] {ON}
           Anc_8.261 YLR088W
          Length = 581

 Score =  636 bits (1641), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/576 (54%), Positives = 412/576 (71%), Gaps = 15/576 (2%)

Query: 1   MALLATIHRRVIDMGLVPKIMKRLPLVSIFLAAIGIVLFLMLPMDGQYRHTYISENALMP 60
           MAL+  +HRR   +GL+PK++ +L +VS  L  I I L L LP+DGQYR TYISENAL+P
Sbjct: 1   MALIEVLHRRATKLGLLPKVIGKLSIVSNILVLISIGLILCLPLDGQYRRTYISENALLP 60

Query: 61  SQAYSYFRESEWNILRGYRTEIDIFPSMPSRDRNLVMTQWLEEFGTKTSVYHNDEYGDTL 120
           SQAYSYFRESEWNILRGYRT I+     P+R RN V++ WL +FG K +VY N   GDTL
Sbjct: 61  SQAYSYFRESEWNILRGYRTAIEALIDKPARVRNEVISSWLTDFGMKHAVYDNAADGDTL 120

Query: 121 YGIFNAPRGDGTEAIVLAIPWYNADGEFNTGGAALGIALSRFFSRWPIWSKNIIVVFSEN 180
           YG++N+ RGDGTEAIVLA+PWYN D E N GGAALGI+LSR+FSRWPIWSKNII+V SEN
Sbjct: 121 YGVYNSQRGDGTEAIVLAVPWYNTDNEVNIGGAALGISLSRYFSRWPIWSKNIILVISEN 180

Query: 181 PDGALRSWVDAYHHSLDLTGGSIEAAIVMDYPSSSDFFDYVEIYYHGINGELPNLDLLNI 240
           P  A++SWVDAYH+SLDLTGGS+EAAIV+D+PS S++F++VE+Y++GINGELPNLD++N+
Sbjct: 181 PHKAMKSWVDAYHNSLDLTGGSLEAAIVLDFPSKSEYFEFVELYFNGINGELPNLDIVNV 240

Query: 241 AIQITEHEGMQVSLHGLPKESLHQNNYFSRLRTLLLGTKDALLSGIKPRHGNEAFSGFRI 300
           AI + EHEG++VSL GL    ++ ++YF+RL+TLL G K++ LSG +  +GNEAFSG RI
Sbjct: 241 AISVIEHEGVKVSLQGLNLSEMYTSSYFNRLKTLLFGVKNSALSGTRKLYGNEAFSGRRI 300

Query: 301 QAITLKAKFTPDNNDHDITSFGRIAEASFRSVNNLLEKFHQSFFFYLILAPKYFVSISSY 360
           QA+TLKA  T     HDIT+FGRI EA FRSVNNLLEKFHQSFFFY ++AP++FVSI SY
Sbjct: 301 QALTLKACGT---EGHDITTFGRIPEAIFRSVNNLLEKFHQSFFFYFLVAPRHFVSIGSY 357

Query: 361 LPSAVTFSVAFAXXXXXXXXXXXXXXXPIFSEYNLLAGLLFTISITFSFFVARLSLLFTE 420
           LPSAV  S++F                P+    ++LA ++F  SI  SF   +++  F +
Sbjct: 358 LPSAVCLSISFGISAAHSYINNQYITVPLSDNSSILALIIFFGSIAISFIFLQINETFLQ 417

Query: 421 PRXXXXXXXXXXXXPHLLGNRFTIPEP-------LSYRLKSIAFLYISLVLTSLLVLNFS 473
           P             P  L N   IP+P       LSYRLKS AF+YISLVLTSLLV+NF+
Sbjct: 418 PHLMILAFLLISFLP--LTN---IPQPLITIQPCLSYRLKSFAFIYISLVLTSLLVMNFA 472

Query: 474 LAFGIGILGFAMTAVKTITIHSSMRVRVRNTMHLLLSNPFTSVLLFTYIFDKDIYGIKIF 533
           LAFG+G+L F +T  K+ +   + + +V N  +L +SNPF ++ +F  IF+ DI   ++F
Sbjct: 473 LAFGMGLLAFPLTFTKSCSEMITFKSKVINCFYLAISNPFIAIFIFVSIFEDDITNFEVF 532

Query: 534 YEFIHSWNTLNCWTWFIICVGWLPPWILVSISSIQT 569
            + I S+  +  WTW I C+GW   W +V I+++ T
Sbjct: 533 SDLISSFKYMGNWTWAITCIGWFTTWQMVYIANLDT 568

>NCAS0B03860 Chr2 complement(687424..689175) [1752 bp, 583 aa] {ON}
           Anc_8.261 YLR088W
          Length = 583

 Score =  632 bits (1630), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/585 (54%), Positives = 423/585 (72%), Gaps = 5/585 (0%)

Query: 1   MALLATIHRRVIDMGLVPKIMKRLPLVSIFLAAIGIVLFLMLPMDGQYRHTYISENALMP 60
           M L   + R+VI  GL+PK++  LPL+S     +GIV+  +LP +GQYR+TYISENALMP
Sbjct: 1   MGLFERVQRQVIARGLIPKVISLLPLISTLCIVLGIVIIGILPFEGQYRNTYISENALMP 60

Query: 61  SQAYSYFRESEWNILRGYRTEIDIFPSMPSRDRNLVMTQWLEEFGTKTSVYHNDEYGDTL 120
           SQAYSYFRESEWNI+RGYR++I    +  + +RN +M++WL++FGTKT +Y N E GDTL
Sbjct: 61  SQAYSYFRESEWNIVRGYRSQIVELRNASAVERNAIMSEWLQQFGTKTDIYQNHETGDTL 120

Query: 121 YGIFNAPRGDGTEAIVLAIPWYNADGEFNTGGAALGIALSRFFSRWPIWSKNIIVVFSEN 180
           YG+F+APRGDGTE++VLAIPW+NADGEFN  GAALG+AL+R+FSRWP+WSKNIIVVF+EN
Sbjct: 121 YGVFHAPRGDGTESMVLAIPWFNADGEFNVNGAALGVALARYFSRWPVWSKNIIVVFTEN 180

Query: 181 PDGALRSWVDAYHHSLDLTGGSIEAAIVMDYPSSSDFFDYVEIYYHGINGELPNLDLLNI 240
           P  ALRSWV+AYH SLDLTGGSIEAAIV+D+    D FDY+EIYY G+NGELPNLD++NI
Sbjct: 181 PKAALRSWVEAYHTSLDLTGGSIEAAIVLDFAGEGDLFDYMEIYYDGLNGELPNLDMVNI 240

Query: 241 AIQITEHEGMQVSLHGLPKESLHQNNYFSRLRTLLLGTKDALLSGIKPRHGNEAFSGFRI 300
            +   EHEGM+VSLHG P + + ++  FSRL+ L+   K++ LSG+K  +GNEAFSG+RI
Sbjct: 241 GVFTAEHEGMKVSLHGTPFDKIKEDTLFSRLKILMSSIKNSALSGVKKTYGNEAFSGWRI 300

Query: 301 QAITLKAKFTPDNNDHDITSFGRIAEASFRSVNNLLEKFHQSFFFYLILAPKYFVSISSY 360
           Q++TL+A+    N   D+TSFGR+ EA FRS+NNLLEKFHQSFFFYL+LAP++FVSISSY
Sbjct: 301 QSVTLRAR--GQNGPFDVTSFGRVPEAMFRSINNLLEKFHQSFFFYLMLAPRHFVSISSY 358

Query: 361 LPSAVTFSVAFAXXXXXXXXXXXXXXXPIFSEYNLLAGLLFTISITFSFFVARLSLLFTE 420
           LPS V  S+ FA               P FS Y LL+ L + +S+  +F V+ + +    
Sbjct: 359 LPSTVAISIGFALASLNSYFNNPYYTLPFFSLYTLLSILFWFVSLVVTFIVSNIFIYSPF 418

Query: 421 PRXXXXXXXXXXXXPHLLGNRFTIPEPLSYRLKSIAFLYISLVLTSLLVLNFSLAFGIGI 480
           P             P +L     + + LSYRL+S AFL++SL+LTSLL++NF LAFG+G+
Sbjct: 419 PTILLAVNIIICLYPAILKGNAFMKDLLSYRLRSTAFLFMSLLLTSLLMVNFPLAFGMGL 478

Query: 481 LGFAMTAVKTITIHSSM--RVRVRNTMHLLLSNPFTSVLLFTYIFDKDIYGIKIFYEFIH 538
           L F MT VKTIT  +    R RV+N++ LL+SNPF +  LF+ + D +  G+ +F   + 
Sbjct: 479 LSFPMTQVKTITSDTPTISRTRVKNSVLLLVSNPFIATWLFSLLCDNEFSGLDVFERLVS 538

Query: 539 SWNTLNCWTWFIICVGWLPPWILVSISSIQTNTVMQ-SPDYGKKQ 582
           +   L CWTW ++CVGW  PW+LV+IS++ T  +   S D+ K+Q
Sbjct: 539 ASRELGCWTWLVLCVGWWTPWLLVAISALDTVKLSNDSEDFKKQQ 583

>KNAG0H03250 Chr8 complement(605885..607642) [1758 bp, 585 aa] {ON}
           Anc_8.261 YLR088W
          Length = 585

 Score =  627 bits (1617), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/576 (54%), Positives = 419/576 (72%), Gaps = 11/576 (1%)

Query: 1   MALLATIHRRVIDMGLVPKIMKRLPLVSIFLAAIGIVLFLMLPMDGQYRHTYISENALMP 60
           M L  T+ R+ + +GL+PK++  LPL+S   A + +V+ L++PM+GQYR+TYISENALMP
Sbjct: 1   MGLFETLQRKAVKLGLLPKLLAALPLLSALTAVVSVVMILIIPMNGQYRNTYISENALMP 60

Query: 61  SQAYSYFRESEWNILRGYRTEIDIFPS--MPSRDRNLVMTQWLEEFGTKTSVYHNDEYGD 118
           SQAYSYFRE+EWNILRGYRTEI++  S  + + DR  ++  WL EFG KT+VY N+E GD
Sbjct: 61  SQAYSYFRETEWNILRGYRTEIEVLNSRGVSASDRYDIVAGWLNEFGAKTAVYRNEEMGD 120

Query: 119 TLYGIFNAPRGDGTEAIVLAIPWYNADGEFNTGGAALGIALSRFFSRWPIWSKNIIVVFS 178
           TLYG+ +APRGDGTEA+VL  PW N++GEFN GG+AL IALSR+FSRWP+WSKNIIVVFS
Sbjct: 121 TLYGVLHAPRGDGTEAMVLCAPWNNSEGEFNIGGSALAIALSRYFSRWPVWSKNIIVVFS 180

Query: 179 ENPDGALRSWVDAYHHSLDLTGGSIEAAIVMDYPSSSDFFDYVEIYYHGINGELPNLDLL 238
           +NP  ALRSWV+AYH SLDLTGGSIEAA+++DYPS++D+F+Y EI++ G+NGELPNLDL+
Sbjct: 181 DNPSVALRSWVEAYHTSLDLTGGSIEAAVILDYPSNNDYFNYTEIHFEGLNGELPNLDLV 240

Query: 239 NIAIQITEHEGMQVSLHGLPKESLHQNNYFSRLRTLLLGTKDALLSGIKPRHGNEAFSGF 298
           N+A+ IT+HEGM+VSLHGLP+  L +NNY+SRL+ L LG KD+ L+G+K  HGNE FSG+
Sbjct: 241 NVAVHITQHEGMKVSLHGLPRSELEKNNYWSRLKLLFLGMKDSTLAGMKKAHGNEVFSGW 300

Query: 299 RIQAITLKAKFTPDNNDHDITSFGRIAEASFRSVNNLLEKFHQSFFFYLILAPKYFVSIS 358
           RIQA+TLKA+        DIT+FGRI EA FRS+NNLLEKFHQSFFFY +L+P  FVSIS
Sbjct: 301 RIQAVTLKAR---GEGQIDITTFGRIPEAMFRSINNLLEKFHQSFFFYFLLSPNNFVSIS 357

Query: 359 SYLPSAVTFSVAFAXXXXXXXXXXXXXXXPIFSEYNLLAGLLFTISITFSFFVARLSLL- 417
           SYLPSAV  S+ FA                +   Y LLA L   IS+  SF VA   L  
Sbjct: 358 SYLPSAVLLSITFA-IAAVDATVNNAYASALHITYTLLAALASVISLLVSFLVAHWFLYS 416

Query: 418 FTEPRXXXXXXXXXXXXPHLLG-NRFTIPEPLSYRLKSIAFLYISLVLTSLLVLNFSLAF 476
            T P             P ++  +   + EP+ YR++++ ++Y SL+LTSLL+LNF LAF
Sbjct: 417 TTSPLYLILGSVVLAVSPLVMSRSNNALREPVCYRMRTLGYIYYSLILTSLLMLNFPLAF 476

Query: 477 GIGILGFAMTAVKTITIH--SSMRVRVRNTMHLLLSNPFTSV-LLFTYIFDKDIYGIKIF 533
            IG+ G+ MT VK + I+  S M +++RN++ L++SNPF +  L+ T + + +   + +F
Sbjct: 477 SIGLFGYPMTLVKPLNIYSKSQMSLKLRNSVLLVISNPFVATWLICTVVENSEFPNLDVF 536

Query: 534 YEFIHSWNTLNCWTWFIICVGWLPPWILVSISSIQT 569
                +W  LNCWTWF++C+GWLP W+LV+ SS  +
Sbjct: 537 AALFSAWKDLNCWTWFVLCLGWLPTWLLVTFSSFTS 572

>Ecym_4309 Chr4 complement(656032..657765) [1734 bp, 577 aa] {ON}
           similar to Ashbya gossypii AGR087C
          Length = 577

 Score =  620 bits (1598), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/570 (51%), Positives = 400/570 (70%), Gaps = 5/570 (0%)

Query: 1   MALLATIHRRVIDMGLVPKIMKRLPLVSIFLAAIGIV-LFLMLPMDGQYRHTYISENALM 59
           MA+L  +HRR++DMGLVP+I+  LP +SIF A + I  L L LP++GQYR TYISENALM
Sbjct: 1   MAVLEKLHRRIVDMGLVPRIIASLPKISIFCALLSISWLTLFLPLEGQYRRTYISENALM 60

Query: 60  PSQAYSYFRESEWNILRGYRTEIDIFPSMPSRDRNLVMTQWLEEFGTKTSVYHNDEYGDT 119
           PSQAYSYFRESEWNILRGYR E++    +   +RN ++  W+EE+G KTS+  N++YG+T
Sbjct: 61  PSQAYSYFRESEWNILRGYRRELENLKDLDIHERNTIVASWMEEYGAKTSINTNNQYGET 120

Query: 120 LYGIFNAPRGDGTEAIVLAIPWYNADGEFNTGGAALGIALSRFFSRWPIWSKNIIVVFSE 179
           LYGI +  RGDGTEA+VLA PW   DG +N GGAAL I+L+R+F+RWP+WSKNIIVV S 
Sbjct: 121 LYGIVHTSRGDGTEAMVLAAPWTTTDGLYNNGGAALAISLARYFARWPVWSKNIIVVLSA 180

Query: 180 NPDGALRSWVDAYHHSLDLTGGSIEAAIVMDYPSSSDFFDYVEIYYHGINGELPNLDLLN 239
           +P  +LR+WV AYH  LDLTGGSIE+A+V+DYP ++D+F Y+EI Y+G+NG LPNLDL+N
Sbjct: 181 DPQASLRAWVKAYHTKLDLTGGSIESAVVLDYPGTNDYFKYIEIGYNGLNGGLPNLDLIN 240

Query: 240 IAIQITEHEGMQVSLHGLPKESLHQNNYFSRLRTLLLGTKDALLSGIKPRHGNEAFSGFR 299
            A+ I+EHEGM+VSLHG+P   L Q+ Y  RL+TLL G KD  L+GIK   G+EAF+G+R
Sbjct: 241 TAVHISEHEGMKVSLHGMPFVELSQDTYKLRLKTLLSGIKDMTLAGIKNTTGHEAFNGWR 300

Query: 300 IQAITLKAKFTPDNNDHDITSFGRIAEASFRSVNNLLEKFHQSFFFYLILAPKYFVSISS 359
           IQ++TLKA     +   D+T+FGR+ EA FRSVNNLLEKFHQSFFFYL+L+P+ FVSI S
Sbjct: 301 IQSVTLKAH--GQDGPFDVTTFGRVPEAIFRSVNNLLEKFHQSFFFYLLLSPRSFVSIGS 358

Query: 360 YLPSAVTFSVAFAXXXXXXXXXXXXXXXPIFSEYNLLAGLLFTISITFSFFVARLSLLFT 419
           YLP+A+  S +FA               P+ S YN+ A   F +++  SF  A       
Sbjct: 359 YLPAAIALSASFAIASADSILNNEYSKLPLLSIYNIWALFAFAVALMISFVTAEAFAYMP 418

Query: 420 EPRXXXXXXXXXXXXPHLLGNRFTIPEPLSYRLKSIAFLYISLVLTSLLVLNFSLAFGIG 479
            P                +  ++ I +P SYR K+ A LY S+VLTSLLV+NF+LA  +G
Sbjct: 419 LPSLLLAFNVALSFISFTV-IKYKIQKPFSYRFKAFAHLYFSIVLTSLLVVNFALALAVG 477

Query: 480 ILGFAMTAVKTITIHSSMRVRVRNTMHLLLSNPFTSVLLFTYIFDKDIYGIKIFYEFIHS 539
           +L F M+  KT T +++M+ ++RN++ L+ SNPF +  +   +F+  + G  +F+  I +
Sbjct: 478 VLAFPMSLTKT-TTNATMQQKLRNSLLLMSSNPFIASWILCQLFEAQLAGTSLFHSLIDA 536

Query: 540 WNTLNCWTWFIICVGWLPPWILVSISSIQT 569
           W  L CWTW+++C+GW P WILV+ SSI +
Sbjct: 537 WTQLGCWTWYVLCIGWYPSWILVAYSSIDS 566

>CAGL0L12232g Chr12 (1324754..1326529) [1776 bp, 591 aa] {ON}
           similar to uniprot|P39012 Saccharomyces cerevisiae
           YLR088w required for attachment of GPI anchor onto
           proteins
          Length = 591

 Score =  612 bits (1578), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/582 (53%), Positives = 411/582 (70%), Gaps = 10/582 (1%)

Query: 1   MALLATIHRRVIDMGLVPKIMKRLPLVSIFLAAIGIVLFLMLPMDGQYRHTYISENALMP 60
           M+LL  ++RR+ + G + K++++LP VS  L  + IVL  +LP+DGQYR TYISENALMP
Sbjct: 1   MSLLQKVYRRLSERGAITKLLQQLPRVSNLLVVVAIVLLAILPLDGQYRRTYISENALMP 60

Query: 61  SQAYSYFRESEWNILRGYRTEIDIFPSMPSRDRNLVMTQWLEEFGTKTSVYHNDEYGDTL 120
           SQAYSYFRE+EWNILRGYR++I+         RN V+ +WL+E G KT++Y ++++G TL
Sbjct: 61  SQAYSYFRETEWNILRGYRSQIETLEHSSVDQRNEVVAEWLQEQGLKTALYEHEKWGKTL 120

Query: 121 YGIFNAPRGDGTEAIVLAIPWYNADGEFNTGGAALGIALSRFFSRWPIWSKNIIVVFSEN 180
           YG+ +A RGDGTEA+VLAIPW N D +FN GGAALG++LS+FF RWP+WSKNIIVVFSE+
Sbjct: 121 YGVLHASRGDGTEAMVLAIPWKNVDDQFNLGGAALGVSLSQFFKRWPVWSKNIIVVFSED 180

Query: 181 PDGALRSWVDAYHHSLDLTGGSIEAAIVMDYPSSSDFFDYVEIYYHGINGELPNLDLLNI 240
              ALR+WVDAYH SLDLT GSIEAA+V+DYPS SDFF+YVEI Y G+NGELPNLDL+NI
Sbjct: 181 SGAALRAWVDAYHTSLDLTAGSIEAAVVLDYPSKSDFFEYVEISYDGLNGELPNLDLVNI 240

Query: 241 AIQITEHEGMQVSLHGLPKESLHQNNYFSRLRTLLLGTKDALLSGIKPRHGNEAFSGFRI 300
           A+ ITEHEGM+VSLHGLP   ++  +YF+RL+ + +G K+  LSG+K  HGNEAFSG+RI
Sbjct: 241 AVSITEHEGMKVSLHGLPPNEMYNTDYFARLKIMFVGIKNWALSGVKRIHGNEAFSGWRI 300

Query: 301 QAITLKAKFTPDNNDHDITSFGRIAEASFRSVNNLLEKFHQSFFFYLILAPKYFVSISSY 360
           Q++TL+A    +    DIT FGRI EA FRSVNNLLEKFHQS+FFYL+LAP+ FVSIS+Y
Sbjct: 301 QSVTLRAH--GNEGQLDITCFGRIPEAMFRSVNNLLEKFHQSYFFYLLLAPRNFVSISNY 358

Query: 361 LPSAVTFSVAFAXXXXXXXXXXXXXXXPIFSEYNLLAGLLFTISITFSFFVARLSLLFTE 420
           LPSAV  SVAFA               P  S   L+  ++ + S+  SF ++R+ ++   
Sbjct: 359 LPSAVIISVAFAVISLDSAINNDYLSIPFSSVNTLVPFIILSASVFVSFLISRVLIMLPI 418

Query: 421 PRXXXXXXXXXXXXPHLLGNR--FTIPEPLSYRLKSIAFLYISLVLTSLLVLNFSLAFGI 478
                         P ++  +    I + ++YRLKSI  +Y SL+LTSLL++NF+L F I
Sbjct: 419 VESLLFGSVALTFLPLVMSKKNIHVINQAVAYRLKSIGSIYYSLILTSLLMVNFALTFMI 478

Query: 479 GILGFAMTAVKTITIHS----SMRVRVRNTMHLLLSNPFTSVLLFTYIFDKDIYG--IKI 532
           G+L F +T +  I+  +    S +  ++NT  L ++NPF S+ LFT   D D  G    I
Sbjct: 479 GLLAFPLTKLAVISTKTIADESRKSILKNTFILFITNPFISLWLFTATMDTDFNGSFSVI 538

Query: 533 FYEFIHSWNTLNCWTWFIICVGWLPPWILVSISSIQTNTVMQ 574
           +   I SW+TL CWTWFIIC+GWLP W++  ISSI +  +++
Sbjct: 539 YNRMITSWDTLGCWTWFIICLGWLPYWLISVISSIPSQPIVE 580

>KAFR0B05550 Chr2 complement(1136432..1138099) [1668 bp, 555 aa]
           {ON} Anc_8.261 YLR088W
          Length = 555

 Score =  602 bits (1551), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/552 (56%), Positives = 395/552 (71%), Gaps = 11/552 (1%)

Query: 1   MALLATIHRRVIDMGLVPKIMKRLPLVSIFLAAIGIVLFLMLPMDGQYRHTYISENALMP 60
           M L+  + R+V  MGLVPK+ K LPL S  +A I ++   +LP+DGQYR+TYISENALMP
Sbjct: 1   MGLVERVKRQVAVMGLVPKLKKYLPLFSKIIALISLISIAILPIDGQYRNTYISENALMP 60

Query: 61  SQAYSYFRESEWNILRGYRTEIDIFPSMPSRDRNLVMTQWLEEFGTKTSVYHNDEYGDTL 120
           SQAYSYFRE+EWNILRGYRT+++    +P  +RN +M  WL + G KT  ++N     T+
Sbjct: 61  SQAYSYFRETEWNILRGYRTQVENMVDLPLTERNDIMETWLNDIGAKTDTHNNS----TI 116

Query: 121 YGIFNAPRGDGTEAIVLAIPWYNADGEFNTGGAALGIALSRFFSRWPIWSKNIIVVFSEN 180
           YGIF++PRGDGTEAIVLAIPW+N++G+FNTGGAALG++L+RFF RWPIWSKNIIVVFSE+
Sbjct: 117 YGIFHSPRGDGTEAIVLAIPWHNSEGQFNTGGAALGVSLARFFWRWPIWSKNIIVVFSED 176

Query: 181 PDGALRSWVDAYHHSLDLTGGSIEAAIVMDYPSSSDFFDYVEIYYHGINGELPNLDLLNI 240
              +LRSWV+AYH SLDLTGGSIEAA+++DY S SDFFDYVEI+Y G+NGELPNLDL+NI
Sbjct: 177 TGASLRSWVEAYHTSLDLTGGSIEAAVILDYASESDFFDYVEIHYDGLNGELPNLDLVNI 236

Query: 241 AIQITEHEGMQVSLHGLPKESLHQNNYFSRLRTLLLGTKDALLSGIKPRHGNEAFSGFRI 300
           A+ ITEHEGM+VSLHGLP+E L + + +SR + LL   KD+ L+GIK  HGNEAFSG+RI
Sbjct: 237 AVSITEHEGMKVSLHGLPREELEERSLWSRFKMLLRSIKDSSLAGIKKPHGNEAFSGWRI 296

Query: 301 QAITLKAKFTPDNNDHDITSFGRIAEASFRSVNNLLEKFHQSFFFYLILAPKYFVSISSY 360
           QA+TLKA         DIT+FGRI EA FRS+NNLLEKFHQSFF+YL+LAP+ FVSISSY
Sbjct: 297 QALTLKA---CGEGGIDITTFGRIPEAMFRSINNLLEKFHQSFFYYLLLAPRNFVSISSY 353

Query: 361 LPSAVTFSVAFAXXXXXXXXXXXXXXXPIFSEYNLLAGLLFTISITFSFFVARLSLLFTE 420
           LP+AV  S+AFA               P  S Y L A +++ +SITFSF  A   L +T 
Sbjct: 354 LPAAVGLSLAFACSSLGEFVNDNQDSIPFISSYTLEAIIVWFLSITFSFCFAITYLKYTF 413

Query: 421 PRXXXXXXXXXXXXPHLLGNRFTIPE---PLSYRLKSIAFLYISLVLTSLLVLNFSLAFG 477
           P             P L+     + E    +++R+K+ AF Y SLVLTSLL++NF LA  
Sbjct: 414 PVMLMFICILFSFIP-LISRGLPLAETKITVAHRMKAFAFGYFSLVLTSLLMINFPLALT 472

Query: 478 IGILGFAMTAVKTITIHSSMRVRVRNTMHLLLSNPFTSVLLFTYIFDKDIYGIKIFYEFI 537
           IG+L F MT VK      +    ++N+M LL+SNP+ S+  F+ IFD ++ G+      I
Sbjct: 473 IGVLAFPMTLVKISNTLPTSSQALKNSMLLLVSNPYISICAFSNIFDSELTGLATLDRLI 532

Query: 538 HSWNTLNCWTWF 549
            +WN +NCWTWF
Sbjct: 533 PAWNDMNCWTWF 544

>Kwal_26.7154 s26 (237387..241028) [3642 bp, 1213 aa] {ON} YOL045W -
            Hypothetical ORF [contig 47] FULL
          Length = 1213

 Score = 34.3 bits (77), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 14/44 (31%), Positives = 26/44 (59%), Gaps = 1/44 (2%)

Query: 207  IVMDYPSSSDFFDYVEIYYHGINGELPNLDLLNIAIQITEHEGM 250
            +++D+    D++ Y+E   HG +G +   DL+ +   +TEHE M
Sbjct: 1023 MLLDFFEDDDYY-YIETAVHGTSGSIDLFDLIEMKTDMTEHEAM 1065

>Smik_5.111 Chr5 complement(152669..153961) [1293 bp, 430 aa] {ON}
           YEL002C (REAL)
          Length = 430

 Score = 32.0 bits (71), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 29/60 (48%), Gaps = 2/60 (3%)

Query: 524 DKDIYGIKIFY--EFIHSWNTLNCWTWFIICVGWLPPWILVSISSIQTNTVMQSPDYGKK 581
           DKD+  I+     E+  SW   N W +  +  G +  WI   IS + T++V +  +  KK
Sbjct: 369 DKDVKAIRHLANDEYPRSWEISNSWVYISVVCGVILAWIFFVISFVTTSSVGKELETFKK 428

>KLTH0D02486g Chr4 (247566..251237) [3672 bp, 1223 aa] {ON} similar to
            uniprot|P31374 Saccharomyces cerevisiae YAL017W PSK1 One
            of two (see also PSK2) PAS domain containing S/T protein
            kinases coordinately regulates protein synthesis and
            carbohydrate metabolism and storage in response to a
            unknown metabolite that reflects nutritional status
          Length = 1223

 Score = 31.2 bits (69), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 21/39 (53%), Gaps = 5/39 (12%)

Query: 216  DFFDYVEIYY-----HGINGELPNLDLLNIAIQITEHEG 249
            DFF+  E YY     HG +G +   DL+ +   +TEHE 
Sbjct: 1036 DFFEDDEYYYIETPIHGTSGSVDLFDLIELKTDMTEHEA 1074

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.326    0.140    0.431 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 58,608,361
Number of extensions: 2489057
Number of successful extensions: 7701
Number of sequences better than 10.0: 29
Number of HSP's gapped: 7804
Number of HSP's successfully gapped: 32
Length of query: 583
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 468
Effective length of database: 40,294,809
Effective search space: 18857970612
Effective search space used: 18857970612
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 69 (31.2 bits)