Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0F030708.262ON44544518880.0
SAKL0H17028g8.262ON5503814423e-48
KAFR0B055408.262ON5193704282e-46
ZYRO0C01650g8.262ON5863754013e-42
TDEL0F038908.262ON4763813964e-42
YDR110W (FOB1)8.262ON5663733987e-42
Skud_4.3718.262ON5803733846e-40
Kpol_543.388.262ON4423753743e-39
Smik_4.3568.262ON5763733784e-39
KLTH0G13684g8.262ON5083603755e-39
Ecym_43088.262ON5293633722e-38
Kwal_56.237998.262ON4883603693e-38
NCAS0B038508.262ON5883783611e-36
Suva_2.2708.262ON6323553602e-36
Kpol_392.68.262ON4573713523e-36
NDAI0J013808.262ON6243663496e-35
AGR086C8.262ON5343633432e-34
TPHA0J007408.262ON4081873275e-33
CAGL0B01771g8.262ON5363653263e-32
TPHA0A018108.262ON4573893201e-31
KLLA0F19140g8.262ON5273653202e-31
KNAG0H032408.262ON5192433043e-29
TBLA0E044308.262ON4813632564e-23
KAFR0B06620singletonON118579840.099
Ecym_40085.713ON784121820.18
NDAI0B06160singletonON140379820.22
NDAI0D03010na 1ON778159810.23
Kpol_2000.35singletonON70482800.28
Kpol_544.2singletonON292136790.31
NDAI0G00550singletonON41279780.44
Kpol_1031.7singletonON1665126790.52
TDEL0E00260singletonON124867760.95
TDEL0H04520singletonON61267751.2
Kpol_1035.3singletonON1130118697.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0F03070
         (445 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0F03070 Chr6 complement(745795..747132) [1338 bp, 445 aa] {O...   731   0.0  
SAKL0H17028g Chr8 complement(1495187..1496839) [1653 bp, 550 aa]...   174   3e-48
KAFR0B05540 Chr2 complement(1134547..1136106) [1560 bp, 519 aa] ...   169   2e-46
ZYRO0C01650g Chr3 complement(117323..119083) [1761 bp, 586 aa] {...   159   3e-42
TDEL0F03890 Chr6 (724664..726094) [1431 bp, 476 aa] {ON} Anc_8.2...   157   4e-42
YDR110W Chr4 (676102..677802) [1701 bp, 566 aa] {ON}  FOB1Nucleo...   157   7e-42
Skud_4.371 Chr4 (647726..649468) [1743 bp, 580 aa] {ON} YDR110W ...   152   6e-40
Kpol_543.38 s543 (84712..86040) [1329 bp, 442 aa] {ON} (84712..8...   148   3e-39
Smik_4.356 Chr4 (637418..639148) [1731 bp, 576 aa] {ON} YDR110W ...   150   4e-39
KLTH0G13684g Chr7 complement(1171645..1173171) [1527 bp, 508 aa]...   149   5e-39
Ecym_4308 Chr4 complement(654030..655619) [1590 bp, 529 aa] {ON}...   147   2e-38
Kwal_56.23799 s56 complement(708590..710056) [1467 bp, 488 aa] {...   146   3e-38
NCAS0B03850 Chr2 complement(685424..687190) [1767 bp, 588 aa] {O...   143   1e-36
Suva_2.270 Chr2 (470408..472306) [1899 bp, 632 aa] {ON} YDR110W ...   143   2e-36
Kpol_392.6 s392 complement(8453..9826) [1374 bp, 457 aa] {ON} co...   140   3e-36
NDAI0J01380 Chr10 complement(317185..319059) [1875 bp, 624 aa] {...   139   6e-35
AGR086C Chr7 complement(888758..890362) [1605 bp, 534 aa] {ON} S...   136   2e-34
TPHA0J00740 Chr10 (175036..176262) [1227 bp, 408 aa] {ON} Anc_8....   130   5e-33
CAGL0B01771g Chr2 (163063..164673) [1611 bp, 536 aa] {ON} weakly...   130   3e-32
TPHA0A01810 Chr1 complement(365982..367355) [1374 bp, 457 aa] {O...   127   1e-31
KLLA0F19140g Chr6 (1773327..1774910) [1584 bp, 527 aa] {ON} some...   127   2e-31
KNAG0H03240 Chr8 complement(603920..605479) [1560 bp, 519 aa] {O...   121   3e-29
TBLA0E04430 Chr5 (1136737..1138182) [1446 bp, 481 aa] {ON} Anc_8...   103   4e-23
KAFR0B06620 Chr2 complement(1376088..1379645) [3558 bp, 1185 aa]...    37   0.099
Ecym_4008 Chr4 complement(16717..19071) [2355 bp, 784 aa] {ON} s...    36   0.18 
NDAI0B06160 Chr2 (1494425..1498636) [4212 bp, 1403 aa] {ON}            36   0.22 
NDAI0D03010 Chr4 complement(712188..714524) [2337 bp, 778 aa] {O...    36   0.23 
Kpol_2000.35 s2000 complement(68315..70429) [2115 bp, 704 aa] {O...    35   0.28 
Kpol_544.2 s544 complement(3985..4863) [879 bp, 292 aa] {ON} com...    35   0.31 
NDAI0G00550 Chr7 complement(116985..118223) [1239 bp, 412 aa] {O...    35   0.44 
Kpol_1031.7 s1031 (14919..19916) [4998 bp, 1665 aa] {ON} (14919....    35   0.52 
TDEL0E00260 Chr5 complement(46841..49489,49491..50588) [3747 bp,...    34   0.95 
TDEL0H04520 Chr8 complement(817439..819277) [1839 bp, 612 aa] {O...    33   1.2  
Kpol_1035.3 s1035 complement(5707..9099) [3393 bp, 1130 aa] {ON}...    31   7.0  

>TBLA0F03070 Chr6 complement(745795..747132) [1338 bp, 445 aa] {ON}
           Anc_8.262 YDR110W
          Length = 445

 Score =  731 bits (1888), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/445 (83%), Positives = 371/445 (83%)

Query: 1   MSKARQKXXXXXXXXXXXNEQLIDIDDFFCPPIGXXXXXXXXXXXXXXMLKRGEKETMEF 60
           MSKARQK           NEQLIDIDDFFCPPIG              MLKRGEKETMEF
Sbjct: 1   MSKARQKDALFDDDALDDNEQLIDIDDFFCPPIGDDDEIYYDSYIDSDMLKRGEKETMEF 60

Query: 61  RNTLKKHITSDLYYAMRDESLLEDDAPIPASLKIKTSKKMYLQIRYSKNSDGDLIETKTN 120
           RNTLKKHITSDLYYAMRDESLLEDDAPIPASLKIKTSKKMYLQIRYSKNSDGDLIETKTN
Sbjct: 61  RNTLKKHITSDLYYAMRDESLLEDDAPIPASLKIKTSKKMYLQIRYSKNSDGDLIETKTN 120

Query: 121 KLLCEPKYIYKLTMKAHFMNNHMRSNKLYRNLSMKYCNIPNLLVVLVLQYCSHCNTTGKI 180
           KLLCEPKYIYKLTMKAHFMNNHMRSNKLYRNLSMKYCNIPNLLVVLVLQYCSHCNTTGKI
Sbjct: 121 KLLCEPKYIYKLTMKAHFMNNHMRSNKLYRNLSMKYCNIPNLLVVLVLQYCSHCNTTGKI 180

Query: 181 RDIRSNYGQRNQYIDYLPLERLQIDITKPFNDSDIKIANKYSHILLIRDYHSRYSWIFPL 240
           RDIRSNYGQRNQYIDYLPLERLQIDITKPFNDSDIKIANKYSHILLIRDYHSRYSWIFPL
Sbjct: 181 RDIRSNYGQRNQYIDYLPLERLQIDITKPFNDSDIKIANKYSHILLIRDYHSRYSWIFPL 240

Query: 241 KSPNIKNISTELGKFLVTLPRTPIFLHSIGIPESQLIKILTKILLEYXXXXXXXXXXXXX 300
           KSPNIKNISTELGKFLVTLPRTPIFLHSIGIPESQLIKILTKILLEY             
Sbjct: 241 KSPNIKNISTELGKFLVTLPRTPIFLHSIGIPESQLIKILTKILLEYKIKIRIGIGGIKG 300

Query: 301 XMFLRKGISRLVYXXXXXXXXXXCKSDWYQCIRNTTFKENRRFDRNTGSFANFLIGKQKA 360
            MFLRKGISRLVY          CKSDWYQCIRNTTFKENRRFDRNTGSFANFLIGKQKA
Sbjct: 301 RMFLRKGISRLVYLLNLKENKEKCKSDWYQCIRNTTFKENRRFDRNTGSFANFLIGKQKA 360

Query: 361 ELNKVFENKRDALLSDLLEENVLKIGECGSIIYFDNNNSGKELDEKXXXXXXXXXXXXXX 420
           ELNKVFENKRDALLSDLLEENVLKIGECGSIIYFDNNNSGKELDEK              
Sbjct: 361 ELNKVFENKRDALLSDLLEENVLKIGECGSIIYFDNNNSGKELDEKDVNGGVNENSEEES 420

Query: 421 XXXXXXXXXXXFYTGVKKRKKARVN 445
                      FYTGVKKRKKARVN
Sbjct: 421 DYENDDDDDESFYTGVKKRKKARVN 445

>SAKL0H17028g Chr8 complement(1495187..1496839) [1653 bp, 550 aa]
           {ON} similar to uniprot|O13329 Saccharomyces cerevisiae
           YDR110W FOB1 Nucleolar protein required for DNA
           replication fork blocking and recombinational hotspot
           activities binds to the replication fork barrier site in
           the rDNA region related to retroviral integrases
          Length = 550

 Score =  174 bits (442), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 105/381 (27%), Positives = 192/381 (50%), Gaps = 17/381 (4%)

Query: 26  DDFFCPPIGXXXXXXXXXXXXXXMLKRGEKETMEFRNTLKKHITSDLYYAMRDESLLE-- 83
           +D+  P +G              +L+RG ++ +++  ++K  +T   Y  ++ ++L    
Sbjct: 24  NDYVTPKLGESQVTYSTDLNVE-LLERGGRDFIKYLESVKGQLTQAQYELIKTDTLTLET 82

Query: 84  ----DDAPIPASLKIKTSKKMYLQIRYSKNSDGDLIETK-TNKLLCEPKYIYKLTMKAHF 138
                D  IP++ +   +K ++L+ RY  +SD  + + K  + ++CEP+ +Y+L +  H 
Sbjct: 83  LLAVTDGLIPSNAE---AKYLFLKRRYYVDSDQIVRDHKRDDTIVCEPELMYELIVSGHL 139

Query: 139 MNNHMRSNKLYRNLSMKYCNIPNLLVVLVLQYCSHCNTTGKIRDIRSNYGQRNQYIDYLP 198
           +NNH+   KL+R L  +Y NI    V +  +YCS CN   +++   + +   N Y   LP
Sbjct: 140 LNNHLHWRKLHRFLKSQYSNITRDFVQMCARYCSECNPQEEVKPF-TKFKHTNAYQGLLP 198

Query: 199 LERLQIDITKPFNDSDIKIANKYSHILLIRDYHSRYSWIFPLKSPNIKNISTELGKFLVT 258
           LER+ ++I KPF   ++ I  KYSH+L  RDYHSR+ W+ PL     + +  +L +FL++
Sbjct: 199 LERIHVEIFKPFGTDEL-IEEKYSHVLYCRDYHSRFVWLSPLTGITFQELVPQLTEFLLS 257

Query: 259 LPRTPIFLHSIGIPESQLIKILTKILLEYXXXXXXXXXXXXXXMFLRKGISRLVYXXXXX 318
           LPR PIFL +  +    +  +   I  +Y               F + GI R+ Y     
Sbjct: 258 LPRLPIFLETTTLDRQDMFDMCEYIARKYQLAIGLGLNNSSH--FYKNGIERMKY--LLQ 313

Query: 319 XXXXXCKSDWYQCIRNTTFKENRRFDRNTGSFANFLIGKQKAELNKVFENKRDALLSDLL 378
                C  DW  C++  ++  N  ++     F+N L+  + +   K F+ KR+ ++ +L 
Sbjct: 314 TNKKKCAKDWGMCLKYGSYHNNTAYNPRIMGFSNDLLCNEVSSCGKKFKLKREKIIHELF 373

Query: 379 EENVLKIGECGSIIYFDNNNS 399
             NV+ + + G ++Y +N NS
Sbjct: 374 AHNVVTLKDTGGMVYVENENS 394

>KAFR0B05540 Chr2 complement(1134547..1136106) [1560 bp, 519 aa]
           {ON} Anc_8.262 YDR110W
          Length = 519

 Score =  169 bits (428), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 106/370 (28%), Positives = 181/370 (48%), Gaps = 11/370 (2%)

Query: 20  EQLIDIDDFFCPPIGXXXXXXXXXXXXXXMLKRGEKETMEFRNTLKKHITSDLYYAMRDE 79
           E ++  + +  P +G              +LKRGE+E  +F+ ++  H+T + Y  +R +
Sbjct: 39  ENIVIKESYIVPRMGESYTSYTDSFMNLELLKRGEREVFKFQQSINGHLTEETYDLIRTD 98

Query: 80  SLLEDD--APIPASLKIKTSKK-MYLQIRYSKNSDGDLIET-KTNKLLCEPKYIYKLTMK 135
           SL  +   +  P   KI    + ++L+ RY ++++G + +  + +K++CEP Y++ + M 
Sbjct: 99  SLTPETLASTNPKWTKITAEPRYLFLKRRYYRDNNGLIHDHLRKDKIVCEPVYVFDMIMG 158

Query: 136 AHFMNNHMRSNKLYRNLSMKYCNIPNLLVVLVLQYCSHCNTTGKIRDIRSNYGQRNQYID 195
            H MNNH    K++ +LS  Y NI   L +  L++CS CN   KI  +   +  RN Y +
Sbjct: 159 CHLMNNHGFVKKIHHSLSTFYSNITRDLCLKALKFCSVCNPEQKIGKLE-KFKHRNIYNE 217

Query: 196 YLPLERLQIDITKPFNDSDIKIANKYSHILLIRDYHSRYSWIFPLKSPNIKNISTELGKF 255
            +PLER+ I+I +PF +   KI  KYSHIL  RDYHSRY W+ PLK+   K++   +   
Sbjct: 218 LMPLERVHIEIFEPFPNE--KIEKKYSHILYCRDYHSRYIWMLPLKNTKFKHLVPTMASL 275

Query: 256 LVTLPRTPIFLHSIGIPESQLIKILTKILLEYXXXXXXXXXXXXXXMFLRKGISRLVYXX 315
            ++  R PIF+ +  +    +  I  KI  EY               F   GI ++    
Sbjct: 276 FLSFIRQPIFIETASLDWQDMFDICEKIAFEYDLQIGLGTSKPNT--FHAAGIRQM--KA 331

Query: 316 XXXXXXXXCKSDWYQCIRNTTFKENRRFDRNTGSFANFLIGKQKAELNKVFENKRDALLS 375
                   C   W  C++  ++  N R +   G     L+  Q  E +  F+ K   +L 
Sbjct: 332 KLEAHREECLLSWNLCLKYGSYDHNIRHNDRAGGVPGDLLSSQIQECSLKFKEKIIQILE 391

Query: 376 DLLEENVLKI 385
           + + E+VL++
Sbjct: 392 NAVSESVLRV 401

>ZYRO0C01650g Chr3 complement(117323..119083) [1761 bp, 586 aa] {ON}
           some similarities with uniprot|O13329 Saccharomyces
           cerevisiae YDR110W FOB1 Nucleolar protein required for
           DNA replication fork blocking and recombinational
           hotspot activities binds to the replication fork barrier
           site in the rDNA region related to retroviral integrases
          Length = 586

 Score =  159 bits (401), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 101/375 (26%), Positives = 179/375 (47%), Gaps = 13/375 (3%)

Query: 27  DFFCPPIGXXXXXXXXXXXXXXMLKRGEKETMEFRNTLKKHITSDLYYAMRDESLLEDDA 86
           +F  PP+               +L++G +E+++F+ T+   +T  +Y  +R ++L   + 
Sbjct: 37  EFIVPPMNQKFVSCLQLGMNLNLLEQGAEESLQFQGTVAGQLTQQIYELIRSDTLSIANL 96

Query: 87  PIPASLKIKTSK--KMYLQIRYSKNSDGDLI--ETKTNKLLCEPKYIYKLTMKAHFMNNH 142
                 K ++S+    YL+ RY  + +  ++    + ++++CEP  ++ L M +H  NNH
Sbjct: 97  ERCHKWKGESSEIEYYYLRSRYFVSEENGMVCDRKRDDRIVCEPASMFHLVMCSHLQNNH 156

Query: 143 MRSNKLYRNLSMKYCNIPNLLVVLVLQYCSHCNTTGKIRDIRSNYGQRNQYIDYLPLERL 202
           + S  ++RNL   Y NI    +V  + YCS CN   K +  +     +N Y + LPLER+
Sbjct: 157 VTSYNIHRNLVKTYANITRDYIVTAISYCSKCNPDLKAKPFQKKR-HKNVYWELLPLERV 215

Query: 203 QIDITKPFNDSDIKIANKYSHILLIRDYHSRYSWIFPLKSPNIKNISTELGKFLVTLPRT 262
            I++ +PF+    KI  ++SH+L  RDY SRY WI PL++   K++   +  FL+ LPR 
Sbjct: 216 HIEVFEPFDGE--KIQGRFSHLLYFRDYFSRYVWILPLQNDKRKHMIRAMSSFLLGLPRI 273

Query: 263 PIFLHSIGIPESQLIKILTKILLEYXXXXXXXXXXXXXXMFLRKGISRLVYXXXXXXXXX 322
           PIFL S  I    L  +  +I   Y               F   GI  +           
Sbjct: 274 PIFLESTTIDREHLFDLCGQIAEHYSLKLGLGVKNSQR--FHNNGIKDM--KELLGSHKE 329

Query: 323 XCKSDWYQCIRNTTFKENRRFDRNTGSFANFLIGKQKAELNKVFENKRDALLSDLLEENV 382
            C  DW  C++   F  N+  + ++      L+     + N+ F  KR+ ++ D   + V
Sbjct: 330 ECLQDWNLCLKYGPFHINQNINVSSDGRPGDLLFTSVPDCNRKFVKKRNDVILDTPSQQV 389

Query: 383 LKIGECGSIIYFDNN 397
           + +GE   +++ +NN
Sbjct: 390 VHLGE--GVLFLENN 402

>TDEL0F03890 Chr6 (724664..726094) [1431 bp, 476 aa] {ON} Anc_8.262
           YDR110W
          Length = 476

 Score =  157 bits (396), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 104/381 (27%), Positives = 179/381 (46%), Gaps = 24/381 (6%)

Query: 28  FFCPPIGXXXXXXXXXXXXXXMLKRGEKETMEFRNTLKKHITSDLYYAMRDESLLEDDAP 87
           F  P +G              +L+RGE++ ++++ ++   +   +Y  +R  SL      
Sbjct: 39  FLAPSMGESYKEYANSYMNMELLERGEQDLLKYQESINGQVLHPIYELIRTNSL------ 92

Query: 88  IPASLKIKT---------SKKMYLQIRYSKNSDGDLIETKTNKLLCEPKYIYKLTMKAHF 138
            P +L   +         SK M+L  RY   +       K +K++CEP  I+ L M AH 
Sbjct: 93  TPETLASNSDKWDKDSAESKYMFLMRRYYAENGIVRDRRKGDKIVCEPLCIFDLIMCAHL 152

Query: 139 MNNHMRSNKLYRNLSMKYCNIPNLLVVLVLQYCSHCNTTGKIRDIRSNYGQRNQYIDYLP 198
           MN+HM    +Y  L+  Y NI    V + ++YCS CN  G  R +   Y  +N +   LP
Sbjct: 153 MNDHMTYRPIYTCLNKIYSNITRDFVQMAVRYCSSCNPDGHFRPLEK-YRHKNIFKGLLP 211

Query: 199 LERLQIDITKPFNDSDIKIANKYSHILLIRDYHSRYSWIFPLKSPNIKNISTELGKFLVT 258
           LER+ I+I + F++    I+NK++++L  RDYH+R+ W+ PLK+   K++ + +G  L+ 
Sbjct: 212 LERVHIEIFEVFDNE--SISNKFTNVLYCRDYHTRFVWLAPLKNTKFKHLVSAVGTLLLG 269

Query: 259 LPRTPIFLHSIGIPESQLIKILTKILLEYXXXXXXXXXXXXXXMFLRKGISRLVYXXXXX 318
           +   PIF+ S  + +  L  I  ++  +Y               F   GI R+       
Sbjct: 270 MTYVPIFMESSTLDKQDLFDICEQLCGKY--NMKLGLGANSSSQFHINGIKRM--KKLLN 325

Query: 319 XXXXXCKSDWYQCIRNTTFKENRRFDRNTGSFANFLIGKQKAELNKVFENKRDALLSDLL 378
                C SDW  C+R   +  NRR +   G   N L+        K F  K++ ++ +L 
Sbjct: 326 TRKVDCISDWNMCLRYGPYHLNRRHNTLAGGIPNDLLYHSDHTNRKHFRPKQEMIIDELP 385

Query: 379 EENVLKIGECGSIIYFDNNNS 399
            +NV+ + +   ++Y ++ NS
Sbjct: 386 AQNVVHVNK--GLLYLEDENS 404

>YDR110W Chr4 (676102..677802) [1701 bp, 566 aa] {ON}  FOB1Nucleolar
           protein that binds the rDNA replication fork barrier
           (RFB) site; required for replication fork blocking,
           recombinational hotspot activity, condensin recruitment
           to RFB and rDNA repeat segregation; related to
           retroviral integrases
          Length = 566

 Score =  157 bits (398), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 105/373 (28%), Positives = 182/373 (48%), Gaps = 11/373 (2%)

Query: 31  PPIGXXXXXXXXXXXXXXMLKRGEKETMEFRNTLKKHITSDLYYAMRDESLLEDDAPIPA 90
           P +G              +L+RGE+ET  F  +L + +T  +Y  ++ +SL  D     +
Sbjct: 49  PSMGESYTEYVDSYLNLELLERGERETPIFLESLTRQLTQKIYELIKTKSLTADTLQQIS 108

Query: 91  S---LKIKTSKKMYLQIRYSKNSDGDLIETKTN-KLLCEPKYIYKLTMKAHFMNNHMRSN 146
                 +  +K ++LQ +Y  + +G++ + + N K+ CEPK++Y + M  H MN H+R  
Sbjct: 109 DKYDGVVAENKLLFLQRQYYVDDEGNVRDGRNNDKIYCEPKHVYDMVMATHLMNKHLRGK 168

Query: 147 KLYRNLSMKYCNIPNLLVVLVLQYCSHCNTTGKIRDIRSNYGQRNQYIDYLPLERLQIDI 206
            L+  L   + NI + ++  V Q+CS CN  GKI+ ++  Y + + Y   LP+ER+ I++
Sbjct: 169 TLHSFLFSHFANISHAIIDWVQQFCSKCNKKGKIKPLK-EYKRPDMYDKLLPMERIHIEV 227

Query: 207 TKPFNDSDIKIANKYSHILLIRDYHSRYSWIFPLKSPNIKNISTELGKFLVTLPRTPIFL 266
            +PFN     I  KYS++LL RDY S + W+ PLKS   K++   +    +T  R PIF+
Sbjct: 228 FEPFNGE--AIEGKYSYVLLCRDYRSSFMWLLPLKSTKFKHLIPVVSSLFLTFARVPIFV 285

Query: 267 HSIGIPESQLIKILTKILLEYXXXXXXXXXXXXXXMFLRKGISRLVYXXXXXXXXXXCKS 326
            S  + +  L  I  +I  +Y               F   GI  L            C +
Sbjct: 286 TSSTLDKDDLYDICEEIASKYGLRIGLGLKSSAR--FHTGGI--LCIQYALNSYKKECLA 341

Query: 327 DWYQCIRNTTFKENRRFDRNTGSFANFLIGKQKAELNKVFENKRDALLSDLLEENVLKIG 386
           DW +C+R   ++ NRR ++ T      ++  +    N  FE KR+ ++ +    N+ K+ 
Sbjct: 342 DWGKCLRYGPYRFNRRRNKRTKRKPVQVLLSEVPGHNAKFETKRERVIENTYSRNMFKMA 401

Query: 387 ECGSIIYFDNNNS 399
               +IY ++ N+
Sbjct: 402 GGKGLIYLEDVNT 414

>Skud_4.371 Chr4 (647726..649468) [1743 bp, 580 aa] {ON} YDR110W
           (REAL)
          Length = 580

 Score =  152 bits (384), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 102/373 (27%), Positives = 180/373 (48%), Gaps = 11/373 (2%)

Query: 31  PPIGXXXXXXXXXXXXXXMLKRGEKETMEFRNTLKKHITSDLYYAMRDESLLEDDAPIPA 90
           P +G              +L+RGE+ET  F  +L + +T  +Y  ++ +SL  D     +
Sbjct: 52  PSMGESYTAYVDSYLNLELLERGERETPIFLESLTRQLTQQIYELIKTKSLTADTLQQIS 111

Query: 91  S---LKIKTSKKMYLQIRYSKNSDGDLIETKTN-KLLCEPKYIYKLTMKAHFMNNHMRSN 146
                 +  +K ++LQ +Y  +++G++ + + N K+ CEPK+IY + M  H MN H+R  
Sbjct: 112 DKYDGVVAENKLLFLQRQYYVDNEGNVRDGRNNDKIYCEPKHIYDMVMATHLMNKHLRGK 171

Query: 147 KLYRNLSMKYCNIPNLLVVLVLQYCSHCNTTGKIRDIRSNYGQRNQYIDYLPLERLQIDI 206
            L+  L   + N  + ++  V Q+CS CN  GKI+ ++  Y + + Y   LP+ER+ I++
Sbjct: 172 TLHSFLFSHFANTSHAIIDWVQQFCSKCNKKGKIKPLK-EYKRPDMYDKLLPMERIHIEV 230

Query: 207 TKPFNDSDIKIANKYSHILLIRDYHSRYSWIFPLKSPNIKNISTELGKFLVTLPRTPIFL 266
            +PF      I  KY ++LL RDY S + W+ PLKS   K++   +    ++  R PIF+
Sbjct: 231 FEPFTGG--AIEGKYPYVLLCRDYRSSFMWLLPLKSTKFKHLIPVISSLFLSFARVPIFV 288

Query: 267 HSIGIPESQLIKILTKILLEYXXXXXXXXXXXXXXMFLRKGISRLVYXXXXXXXXXXCKS 326
            S  + +  L  I  +I  +Y               F   GI  L            C +
Sbjct: 289 TSSTLDKDDLYDICEEIASKYGLCIGLGLKSSAR--FHTGGI--LCIQYALNSYKEECLA 344

Query: 327 DWYQCIRNTTFKENRRFDRNTGSFANFLIGKQKAELNKVFENKRDALLSDLLEENVLKIG 386
           DW +C+R   ++ NRR ++ T      ++  +    N  FE KR+ ++ +    N+ K+ 
Sbjct: 345 DWGKCLRYGPYRFNRRRNKRTKRKPAQVLLSEVPGHNAKFETKRERVIENTYSRNMFKMA 404

Query: 387 ECGSIIYFDNNNS 399
               +IY ++ N+
Sbjct: 405 GGKGLIYLEDVNT 417

>Kpol_543.38 s543 (84712..86040) [1329 bp, 442 aa] {ON}
           (84712..86040) [1329 nt, 443 aa]
          Length = 442

 Score =  148 bits (374), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 105/375 (28%), Positives = 175/375 (46%), Gaps = 22/375 (5%)

Query: 28  FFCPPIGXXXXXXXXXXXXXXMLKRGEKETMEFRNTLKKHITSDLYYAMRDESLLEDDAP 87
           F  P +G               L+ G     E+ +++   ++  +Y  +RD+ LL+ D  
Sbjct: 43  FDYPKVGATLYEYIDSSYSVPFLEFGRGAAKEYLDSIIGTLSQTVYELIRDD-LLDVD-- 99

Query: 88  IPASLKIKT--------SKKMYLQIRYSKNSDGDLIE-TKTNKLLCEPKYIYKLTMKAHF 138
              +L  KT        +K +YL+ RY     G +I+ T+ NK++ EP   Y   +  H 
Sbjct: 100 ---TLSEKTRWSRINANAKCLYLKRRYKLTKKGTVIDLTRENKIVYEPDLRYDYIISTHI 156

Query: 139 MNNHMRSNKLYRNLSMKYCNIPNLLVVLVLQYCSHCNTTGKIRDIRSNYGQRNQYIDYLP 198
           +N H+    +++ L   Y N+    + +VL +CSHCN    I ++       N Y  YLP
Sbjct: 157 LNRHLGYQGIHKRLKAIYSNLSRDYIKMVLDFCSHCNPDKVIPNLEKTV-HMNIYEKYLP 215

Query: 199 LERLQIDITKPFNDSDIKIANKYSHILLIRDYHSRYSWIFPLKSPNIKNISTELGKFLVT 258
           LER+Q+DI +PF +   KI N+YSHI+ IRDY SR+ WI+PLK+   K +++E+G  L+ 
Sbjct: 216 LERVQLDIFEPFENE--KIQNRYSHIIYIRDYRSRFVWIYPLKNTKFKTLASEIGMLLLD 273

Query: 259 LPRTPIFLHSIGIPESQLIKILTKILLEYXXXXXXXXXXXXXXMFLRKGISRLVYXXXXX 318
           LPR PI++ +  I    ++ I  +I  +Y               F   G+SRL       
Sbjct: 274 LPRIPIYIDTTTIERRDMLAICKRIAEKYEISLGIGTIEPSS--FYSIGLSRL--KCLLN 329

Query: 319 XXXXXCKSDWYQCIRNTTFKENRRFDRNTGSFANFLIGKQKAELNKVFENKRDALLSDLL 378
                C  DW  C++  ++  N++         + L   +       FE+KR  +++ L 
Sbjct: 330 ENKDKCLKDWNMCLKLGSYYYNKKSITTARGVPSELFLDEMECSATTFESKRTEIINSLP 389

Query: 379 EENVLKIGECGSIIY 393
            +N  K      ++Y
Sbjct: 390 IQNSYKTSTNKGLVY 404

>Smik_4.356 Chr4 (637418..639148) [1731 bp, 576 aa] {ON} YDR110W
           (REAL)
          Length = 576

 Score =  150 bits (378), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 103/373 (27%), Positives = 180/373 (48%), Gaps = 11/373 (2%)

Query: 31  PPIGXXXXXXXXXXXXXXMLKRGEKETMEFRNTLKKHITSDLYYAMRDESLLEDDAPIPA 90
           P +G              +L+RGE+ET  F  +L + +T  +Y  ++ +SL  D     +
Sbjct: 51  PSMGESYTEYVDSYLNLELLERGERETPIFLESLTRQLTQKIYELIKTKSLTADTLQQIS 110

Query: 91  S---LKIKTSKKMYLQIRYSKNSDGDLIETKTN-KLLCEPKYIYKLTMKAHFMNNHMRSN 146
                 +  +K ++LQ +Y  + +G++ + + N K+ CEP +IY + M  H +N H+R  
Sbjct: 111 DKYDGVVAENKLLFLQRQYYVDDEGNVRDGRNNDKIYCEPNHIYDMVMATHLINKHLRGK 170

Query: 147 KLYRNLSMKYCNIPNLLVVLVLQYCSHCNTTGKIRDIRSNYGQRNQYIDYLPLERLQIDI 206
            L+  L   + NI + ++  V Q+CS CN  GKI+ ++  Y + + Y   LP+ER+ I++
Sbjct: 171 TLHSFLFSYFANISHAIIDWVQQFCSKCNKKGKIKPLK-EYKRPDMYDKLLPMERIHIEV 229

Query: 207 TKPFNDSDIKIANKYSHILLIRDYHSRYSWIFPLKSPNIKNISTELGKFLVTLPRTPIFL 266
            +PF  S   I  KYS++LL RDY S + W+ PLKS   K++   +    ++  R PIF+
Sbjct: 230 FEPF--SGETIEGKYSYVLLCRDYRSSFMWLLPLKSTKFKHLIPVISSLFLSFARVPIFV 287

Query: 267 HSIGIPESQLIKILTKILLEYXXXXXXXXXXXXXXMFLRKGISRLVYXXXXXXXXXXCKS 326
            S  + +  L  I  +I  +Y               F   GI  L            C +
Sbjct: 288 TSSTLDKDDLYDICEEIASKYGLRIGLGLKSSAR--FHTGGI--LCIHYALNSYKEECLA 343

Query: 327 DWYQCIRNTTFKENRRFDRNTGSFANFLIGKQKAELNKVFENKRDALLSDLLEENVLKIG 386
           DW +C+R   ++ NRR ++ T      ++  +    N  FE KR+ ++ +    N+ K  
Sbjct: 344 DWGKCLRYGPYRFNRRRNKRTKRKPAQVLLSEIPGHNAKFETKRERVIENTYSRNMFKTA 403

Query: 387 ECGSIIYFDNNNS 399
               +IY ++ N+
Sbjct: 404 GGKGLIYLEDVNT 416

>KLTH0G13684g Chr7 complement(1171645..1173171) [1527 bp, 508 aa]
           {ON} weakly similar to uniprot|O13329 Saccharomyces
           cerevisiae YDR110W FOB1 Nucleolar protein required for
           DNA replication fork blocking and recombinational
           hotspot activities binds to the replication fork barrier
           site in the rDNA region related to retroviral integrases
          Length = 508

 Score =  149 bits (375), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 99/360 (27%), Positives = 174/360 (48%), Gaps = 17/360 (4%)

Query: 49  MLKRGEKETMEFRNTLKKHITSDLYYAMRDESLLEDDAPIPASLKIKT----SKKMYLQI 104
           +L+RG  + ++++ ++K  +T D +  +R  SL ED+  +  S K+      +K + L+ 
Sbjct: 39  LLERGRLDFIKYQESVKGQLTQDQFDLVRSCSLTEDNL-MTTSDKLHAGNVETKFLLLKR 97

Query: 105 RYSKNSDGDLIETK-TNKLLCEPKYIYKLTMKAHFMNNHMRSNKLYRNLSMKYCNIPNLL 163
           RY  ++DG + + K ++ ++CEP+ ++ L M  H  N H+   +L+  L   Y N     
Sbjct: 98  RYYVDADGIVRDYKCSDTVVCEPELMFDLIMCGHLKNGHLHWRRLHSYLRHNYANTTRAF 157

Query: 164 VVLVLQYCSHCNTTGKIRDIRSNYGQRNQYIDYLPLERLQIDITKPFNDSDIKIANKYSH 223
             + ++YCS CN   ++R  +  +   N Y   LPLER+ ++I  PF+++   I   YSH
Sbjct: 158 AQICVKYCSQCNPEEELRPYK-KFRHTNIYSGLLPLERVHVEIISPFSEA---IEGTYSH 213

Query: 224 ILLIRDYHSRYSWIFPLKSPNIKNISTELGKFLVTLPRTPIFLHSIGIPESQLIKILTKI 283
           +L  RDY+SR+ W+ PLK  ++++I+  L   L+ LPR PIF+ +  I    L +    +
Sbjct: 214 VLFFRDYYSRFVWMQPLKGDDVRDITKGLLATLLLLPRIPIFIETSTIDRQDLFEACEDV 273

Query: 284 LLEYXXXXXXXXXXXXXXMFLRKGISRLVYXXXXXXXXXXCKSDWYQCIRNTTFKENRRF 343
             +Y               F + G+ RL Y          C   WY C++      N  +
Sbjct: 274 AGQY--SLYIGLGMSQSSTFQKNGVERLRY--LLQRNEEQCLRSWYMCLKYGATNHNLNY 329

Query: 344 DRNTGSFANFLIGKQKAELNKVFENKRDALLSDLLEENVLKIGECG---SIIYFDNNNSG 400
           +         L+     +  + FE KR+ L+  L   NV++I   G    IIY ++  S 
Sbjct: 330 NARILGVPGNLLHSTVCDYGRQFELKREDLIEKLFARNVVEIKVSGRRRGIIYLEDETSA 389

>Ecym_4308 Chr4 complement(654030..655619) [1590 bp, 529 aa] {ON}
           similar to Ashbya gossypii AGR086C
          Length = 529

 Score =  147 bits (372), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 99/363 (27%), Positives = 175/363 (48%), Gaps = 15/363 (4%)

Query: 50  LKRGEKETMEFRNTLKKHITSDLYY-----AMRDESLLEDDAPIPASLKIKTSKKMYLQI 104
           L  G  E ++  NT+K  +T D+Y       +  ++LLE    + A      +K + L+ 
Sbjct: 56  LDTGRNELIKLINTVKGQLTQDIYELISSNTLSTQTLLECCDKVTAG--TVENKFVLLKR 113

Query: 105 RYSKNSDGDLIETKTNKL-LCEPKYIYKLTMKAHFMNNHMRSNKLYRNLSMKYCNIPNLL 163
           RYS    G++++ K   L + EP  ++ + M AH +N H+   K++++L   Y N+    
Sbjct: 114 RYSI-LQGNVVDHKREDLPVIEPDLVFDVIMAAHLINGHLPWRKIHQHLKNLYANVTRDF 172

Query: 164 VVLVLQYCSHCNTTGKIRDIRSNYGQRNQYIDYLPLERLQIDITKPFND-SDIKIANKYS 222
             LV  YCSHCNT   ++     Y   N Y   +PLER  ++I  PF+D  + KI +KYS
Sbjct: 173 TNLVTLYCSHCNTDRNMKRFL-RYKHYNVYDKVMPLERCHVEIFAPFDDDGNEKIEDKYS 231

Query: 223 HILLIRDYHSRYSWIFPLKSPNIKNISTELGKFLVTLPRTPIFLHSIGIPESQLIKILTK 282
           H+L  RDYHSR+ W+ PL+    +++   L + L ++ R PIFL +  +    +  +   
Sbjct: 232 HVLYCRDYHSRFVWMLPLEGITFRDLVPALTQLLCSMIRLPIFLETATLDRQDMFDVCEY 291

Query: 283 ILLEYXXXXXXXXXXXXXXMFLRKGISRLVYXXXXXXXXXXCKSDWYQCIRNTTFKENRR 342
           I  +Y               F R G++R+            C  +W  C+R    + N+ 
Sbjct: 292 IARKYKLKIGLGLNSGTD--FQRNGVTRI--KNLFAEHKEQCIKEWNMCLRLVLTRVNQN 347

Query: 343 FDRNTGSFANFLIGKQKAELNKVFENKRDALLSDLLEENVLKIGECGSIIYFDNNNSGKE 402
           +        + L+  + + +   F+ K+  ++ +L   +V++  E G +IY +++NS   
Sbjct: 348 YSDRVRGIPSDLLCNEISNIAHKFKLKQRKIIDELYAHHVVQFREAGGMIYLEDDNSAFV 407

Query: 403 LDE 405
           +DE
Sbjct: 408 VDE 410

>Kwal_56.23799 s56 complement(708590..710056) [1467 bp, 488 aa] {ON}
           YDR110W (FOB1) - DNA replication fork blocking protein
           [contig 173] FULL
          Length = 488

 Score =  146 bits (369), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 94/360 (26%), Positives = 171/360 (47%), Gaps = 17/360 (4%)

Query: 49  MLKRGEKETMEFRNTLKKHITSDLYYAMRDESLLEDDAPIPASLKIKT----SKKMYLQI 104
           +L RG  + ++++ ++K  +T + +  +R  +L  ++  +  S K+ +    +K + L+ 
Sbjct: 39  LLARGRLDFIKYQESVKGQLTQEQFDLVRSSALTAENL-MSTSDKLHSGNIETKFLLLKR 97

Query: 105 RYSKNSDGDLIETKTN-KLLCEPKYIYKLTMKAHFMNNHMRSNKLYRNLSMKYCNIPNLL 163
           R+  ++DG + + K +  ++CEP+ ++ L M  H  N H+   +L+  L  KY N     
Sbjct: 98  RFYVDADGTVRDFKCDDTVVCEPESLFDLIMCGHLKNGHIHWRRLHHYLRRKYANTTRAF 157

Query: 164 VVLVLQYCSHCNTTGKIRDIRSNYGQRNQYIDYLPLERLQIDITKPFNDSDIKIANKYSH 223
             + ++YCS CN    +R  R  +   N Y   LPLER+ ++I  PF      I   YSH
Sbjct: 158 AQICVRYCSECNPEEVLRPYR-KFRHTNIYSGLLPLERVHVEIIAPFPK---LIEGLYSH 213

Query: 224 ILLIRDYHSRYSWIFPLKSPNIKNISTELGKFLVTLPRTPIFLHSIGIPESQLIKILTKI 283
           +L +RDY+SR+ W+ PL S  +  I+     FL++LPR PIF+ +  +    L ++   I
Sbjct: 214 VLYLRDYYSRFVWMQPLASERVSEITKAFLTFLLSLPRVPIFVETSTLKRQDLFEVCENI 273

Query: 284 LLEYXXXXXXXXXXXXXXMFLRKGISRLVYXXXXXXXXXXCKSDWYQCIRNTTFKENRRF 343
             +Y               F R G+ RL Y          C   W+ C++      N  +
Sbjct: 274 ASQYGLSIGLGMSRSTT--FQRNGVERLRY--LLQQNEEPCLKSWHMCLKFGVTNHNMTY 329

Query: 344 DRNTGSFANFLIGKQKAELNKVFENKRDALLSDLLEENVLKI---GECGSIIYFDNNNSG 400
           +         L+    ++  + FE KR+ L+  L   NV+++   G    +IY ++ +S 
Sbjct: 330 NARVLGLPGNLLHSTVSDYGRQFELKREELIEKLFASNVVELRNEGRRRGMIYLEDESSA 389

>NCAS0B03850 Chr2 complement(685424..687190) [1767 bp, 588 aa] {ON}
           Anc_8.262 YDR110W
          Length = 588

 Score =  143 bits (361), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 103/378 (27%), Positives = 173/378 (45%), Gaps = 19/378 (5%)

Query: 28  FFCPPIGXXXXXXXXXXXXXXMLKRGEKETMEFRNTLKKHITSDLYYAMRDESLLEDDAP 87
           +  P IG               ++RGE+E  EF+ T+   +    Y  ++  SL ++   
Sbjct: 82  YLIPNIGEKYKDYVDEDMDLAFVQRGEREFFEFQKTINGQLNESTYELIKTNSLTQETLS 141

Query: 88  IPASLKI----KTSKKMYLQIRYSKNSDGDLIET-KTNKLLCEPKYIYKLTMKAHFMNNH 142
             A LK+      S+ ++L  RY  +  G++ +  + N+++CEP +IY + M  H +N+H
Sbjct: 142 ATA-LKMDKFRAASRLVFLNRRYGLDEQGNVRDKLRQNRMVCEPVFIYDMIMTWHLINDH 200

Query: 143 MRSNKLYRNLSMKYCNIPNLLVVLVLQYCSHCNTTGKIRDIRSNYGQRNQYIDYLPLERL 202
            R  K ++ L   Y NI    V  + Q+CS CN + +    +  Y   N +   LPLER+
Sbjct: 201 GRPRKCHQLLGPMYSNITRFFVERICQFCSVCNPSKETIPFKK-YKHINWFKGLLPLERV 259

Query: 203 QIDITKPFNDSDIKIANKYSHILLIRDYHSRYSWIFPLKSPNIKNISTELGKFLVTLPRT 262
           Q+++ +PF     K+  KY  IL  RDY SR+ W+ PL++    ++   + K + ++ R 
Sbjct: 260 QVEVFEPFPGE--KLGGKYPQILYFRDYRSRFIWMVPLRNSKFGHLVDLISKMIFSMIRI 317

Query: 263 PIFLHSIGIPESQLIKILTKILLEYXXXXXXXXXXXXXXMFLRKGISRLVYXXXXXXXXX 322
           PIF  +  I       I  KI+ +Y                L  G+ ++           
Sbjct: 318 PIFFETTTIENQDFFDIFEKIVEKYQINIGLGTKLGGKR--LTNGLPQI--RKLLGPHKE 373

Query: 323 XCKSDWYQCIR--NTTFKENRRFDRNTGSFANFLIGKQKAELNKVFENKRDALLSDLLEE 380
            C +DW  C++    TF  N+  DR  G   + L G       K + +K + +L DL  E
Sbjct: 374 ECLADWIMCLKYGPHTFN-NKMNDRACGVPGDLLTGDIPDLYTKSY-DKIEQILQDLPTE 431

Query: 381 NVLKIGECGSIIYFDNNN 398
           N++KIG     IY ++ N
Sbjct: 432 NIVKIGR--GCIYLEDRN 447

>Suva_2.270 Chr2 (470408..472306) [1899 bp, 632 aa] {ON} YDR110W
           (REAL)
          Length = 632

 Score =  143 bits (360), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 96/355 (27%), Positives = 176/355 (49%), Gaps = 11/355 (3%)

Query: 49  MLKRGEKETMEFRNTLKKHITSDLYYAMRDESLLEDDAPIPAS---LKIKTSKKMYLQIR 105
           +L+RGE+ET  F  +L + +T  +Y  ++ +SL  +     +         +K ++L+ +
Sbjct: 120 LLERGERETPIFLESLTRQLTQKIYELIKTKSLTAETLQQISDKYDGVAAENKLLFLERQ 179

Query: 106 YSKNSDGDLIETKTN-KLLCEPKYIYKLTMKAHFMNNHMRSNKLYRNLSMKYCNIPNLLV 164
           Y  +++G++ + + N K+ CEPK+IY + M  H MN H+R   L+  L   + N  + ++
Sbjct: 180 YYVDNEGNVRDRRNNDKIYCEPKHIYDMVMATHLMNKHLRGKTLHSFLFSHFANTSHAII 239

Query: 165 VLVLQYCSHCNTTGKIRDIRSNYGQRNQYIDYLPLERLQIDITKPFNDSDIKIANKYSHI 224
             V Q+CS CN  GKI+ ++  Y + + Y   LP+ER+ I++ +P+    I+   KY ++
Sbjct: 240 DWVQQFCSKCNKKGKIKPLK-EYKRPDMYDKLLPMERIHIEVFEPYGGKAIE--GKYPYV 296

Query: 225 LLIRDYHSRYSWIFPLKSPNIKNISTELGKFLVTLPRTPIFLHSIGIPESQLIKILTKIL 284
           LL RDY S + W+ PLKS   K++   +    ++  R PIF+ S  + +  L  I  +I 
Sbjct: 297 LLCRDYRSSFMWLLPLKSTKFKHLIPVVSSLFLSFARIPIFVTSSTLDKDDLYDICEEIA 356

Query: 285 LEYXXXXXXXXXXXXXXMFLRKGISRLVYXXXXXXXXXXCKSDWYQCIRNTTFKENRRFD 344
            +Y               F   GI  L            C +DW +C+R   ++ NRR +
Sbjct: 357 SKYGLRIGLGLKSSAR--FHTGGI--LCIQYALNSYKEECLADWGKCLRYGPYRFNRRRN 412

Query: 345 RNTGSFANFLIGKQKAELNKVFENKRDALLSDLLEENVLKIGECGSIIYFDNNNS 399
           + T      ++  +    N  FE KR+ ++ +    N+  +     +IY ++ N+
Sbjct: 413 KRTKRKPTQVLLSEVPGHNAKFETKRERVIENTYARNMFTMAGGKGLIYLEDVNT 467

>Kpol_392.6 s392 complement(8453..9826) [1374 bp, 457 aa] {ON}
           complement(8453..9826) [1374 nt, 458 aa]
          Length = 457

 Score =  140 bits (352), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 99/371 (26%), Positives = 179/371 (48%), Gaps = 26/371 (7%)

Query: 49  MLKRGEKETMEFRNTLKKHITSDLYYAMRDESLLEDDAPIPASL---KIKTSKK-----M 100
           +  RG ++  +F++T+  +++  +Y       L+  D   P  +   K+K + K      
Sbjct: 81  LFNRGHQDLAKFQSTINGYLSQRIY------DLILTDKLTPKKVSREKVKWANKSNEKYY 134

Query: 101 YLQIRYSKNSDGDLIETKTN--KLLCEPKYIYKLTMKAHFMNNHMRSNKLYRNLSMKYCN 158
           +L+ RY  +  G  +  + N  K+LC P  + ++ +  H +N H     ++RNL  +Y N
Sbjct: 135 FLKNRYYVSDKGTTVRDRRNDDKILCPPNKVLEVVLCTHLINEHAAHKSVHRNLHKRYAN 194

Query: 159 IPNLLVVLVLQYCSHCNTTGKIRDIRSNYGQRNQ-YIDYLPLERLQIDITKPFNDSDIKI 217
           I   +  + L YCS CN +  ++ ++ +  ++N+ Y   LP ER+ I+I KPF D  + I
Sbjct: 195 ISRTITRISLLYCSFCNPSEHVKPLKKS--KKNEVYEGLLPFERIHIEIFKPFGDEKL-I 251

Query: 218 ANKYSHILLIRDYHSRYSWIFPLKSPNIKNISTELGKFLVTLPRTPIFLHSIGIPESQLI 277
              YSHIL IRDY+SRY W++PLK    K ++  L  +  T+ +TPI++ S  I  + LI
Sbjct: 252 EGTYSHILYIRDYYSRYVWLYPLKKTAFKELTQTLVTYFFTITKTPIYIESSTINRNDLI 311

Query: 278 KILTKILLEYXXXXXXXXXXXXXXMFLRKGISRLVYXXXXXXXXXXCKSDWYQCIR-NTT 336
            ++ KI L+Y               F   G+  +            C  DW  C++    
Sbjct: 312 AMVQKIALKY--DLRIGIGIGNSSYFHYNGLETM--KQLLLLHEDECLGDWGMCLKYGKN 367

Query: 337 FKENRRFDRNTGSFANFLIGKQKAELNKVFENKRDALLSDLLEENVLKIGECGSIIYFDN 396
              N +  +  G   N L+    +E +  +++K++ ++ +    N++ +    S IY ++
Sbjct: 368 LHNNLKNRKVLGMPINLLLNSGISECSIKYKSKKNTVIDETFPHNMIVLDNGKSEIYLED 427

Query: 397 N-NSGKELDEK 406
           N  S   +DEK
Sbjct: 428 NLTSTPVIDEK 438

>NDAI0J01380 Chr10 complement(317185..319059) [1875 bp, 624 aa] {ON}
           Anc_8.262 YDR110W
          Length = 624

 Score =  139 bits (349), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 97/366 (26%), Positives = 170/366 (46%), Gaps = 11/366 (3%)

Query: 28  FFCPPIGXXXXXXXXXXXXXXMLKRGEKETMEFRNTLKKHITSDLYYAMRDESLLEDDAP 87
           +  P +G              +LKRGE   + F+ ++   +   +Y  +R +SL E+   
Sbjct: 91  YLIPNVGESYMDYVDPEVDVDLLKRGEVTFLNFQRSIHGQLDEVVYELIRTKSLTEETLA 150

Query: 88  IPASLKIKTSKKMYLQIRYSKNSDGDLIET-KTNKLLCEPKYIYKLTMKAHFMNNHMRSN 146
                    ++    + RY  +++G + +  + N+++C+P  +Y++ M  H MN+H +  
Sbjct: 151 ANFPHFHAPTRCALFKRRYVADNEGRVRDQLRGNRIVCDPVLLYEMMMTCHLMNDHAQYR 210

Query: 147 KLYRNLSMKYCNIPNLLVVLVLQYCSHCNTTGKIRDIRSNYGQRNQYIDYLPLERLQIDI 206
           + +  LS  Y NI    +   +Q+CS CN +  +  +   +   N Y   LPLER+ I+I
Sbjct: 211 RCHVALSSIYANITRDFLYKAVQFCSVCNPSKLVGPLLK-FKHVNYYKGMLPLERVHIEI 269

Query: 207 TKPFNDSDIKIANKYSHILLIRDYHSRYSWIFPLKSPNIKNISTELGKFLVTLPRTPIFL 266
            +PFN    KI  KYSH++  RDY SRY  + PLK+   KN+ + + K L  LPR PIF+
Sbjct: 270 FEPFNGK--KIEGKYSHVIYCRDYRSRYIMLEPLKNTKFKNLVSAIAKLLFNLPRIPIFI 327

Query: 267 HSIGIPESQLIKILTKILLEYXXXXXXXXXXXXXXMFLRKGISRLVYXXXXXXXXXXCKS 326
            ++ +       I   I+ +Y               F  +G+ ++            C +
Sbjct: 328 ETVSLNTQDAFDIFEAIVEKYQINVGLGMKTAKR--FHTRGVKQM--KILLEGHRKECLN 383

Query: 327 DWYQCIRNTTFKENRRF-DRNTGSFANFLIGKQKAELNKVFENKRDALLSDLLEENVLKI 385
           DW  C++      N +  DR  G   + L    K   +K  E K + ++  L ++N+++I
Sbjct: 384 DWTMCLKYGPHNYNTKHNDRACGVPVDLLTCNVKDVTHKSIE-KYEQIIRTLPKDNIVQI 442

Query: 386 GECGSI 391
           G  GSI
Sbjct: 443 GN-GSI 447

>AGR086C Chr7 complement(888758..890362) [1605 bp, 534 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR110W
           (FOB1)
          Length = 534

 Score =  136 bits (343), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 93/363 (25%), Positives = 164/363 (45%), Gaps = 15/363 (4%)

Query: 50  LKRGEKETMEFRNTLKKHITSDLYYAMRDESLLED------DAPIPASLKIKTSKKMYLQ 103
           + RG  E  +   T+K  +T ++Y  +  ++L         D   P +++   +K + L+
Sbjct: 50  IDRGRGELRKIMKTVKGQLTQEIYDLIASDTLSTQKLLECCDKVTPNTVE---NKYVLLK 106

Query: 104 IRYSKNSDGDLIETKTNKLLCEPKYIYKLTMKAHFMNNHMRSNKLYRNLSMKYCNIPNLL 163
            RY       +   + +  + EP  ++ + M AH +N+HM   K+Y+++   Y N+   L
Sbjct: 107 RRYVAKGGIVIDRKRKDAPVIEPDSLFDMIMSAHLINDHMPWRKVYQHMKGLYANVTREL 166

Query: 164 VVLVLQYCSHCNTTGKIRDIRSNYGQRNQYIDYLPLERLQIDITKPFNDSDI-KIANKYS 222
             +V  YCSHCN    +R   S Y   N +   +PLER  +++  PF+D  + KI  KYS
Sbjct: 167 TNMVTGYCSHCNMDRSVRRF-SRYKHYNVHEKLMPLERCHVEVFAPFDDEGVEKIQGKYS 225

Query: 223 HILLIRDYHSRYSWIFPLKSPNIKNISTELGKFLVTLPRTPIFLHSIGIPESQLIKILTK 282
           H L  RDYHSR+ W+ PL+    + +   L + L T+ R PIFL +  +    +  I   
Sbjct: 226 HFLYCRDYHSRFIWLLPLEGIAFRYLLPALAQLLCTMIRVPIFLETATLDRQDMFDICEV 285

Query: 283 ILLEYXXXXXXXXXXXXXXMFLRKGISRLVYXXXXXXXXXXCKSDWYQCIRNTTFKENRR 342
           I   Y               F + GI R+            C+ DW  C+R    + N+ 
Sbjct: 286 IARRYKFKIGLGLNSGTE--FQKNGIKRV--KQLLSEYKEECQDDWNMCLRLVLSRVNQT 341

Query: 343 FDRNTGSFANFLIGKQKAELNKVFENKRDALLSDLLEENVLKIGECGSIIYFDNNNSGKE 402
           +        + L+  +   ++  F+ K+  ++  L   +V+   E G +IY ++  S   
Sbjct: 342 YADRVRGIPSDLLCNEIPNISMKFKQKQKKIIDQLYAHHVVHFKEAGGMIYLEDEESAFV 401

Query: 403 LDE 405
           +D+
Sbjct: 402 MDD 404

>TPHA0J00740 Chr10 (175036..176262) [1227 bp, 408 aa] {ON} Anc_8.262
           YDR110W
          Length = 408

 Score =  130 bits (327), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 70/187 (37%), Positives = 108/187 (57%), Gaps = 4/187 (2%)

Query: 98  KKMYLQIRYSKNSDGDLIETKTN-KLLCEPKYIYKLTMKAHFMNNHMRSNKLYRNLSMKY 156
           K M ++ RY  N  G + + + + KL+  P  IY L M  HF+N+H+ S K++ +L  KY
Sbjct: 101 KFMLMEDRYQLNELGQITDKRNDYKLIVPPNQIYDLIMHCHFLNDHLGSTKIHHSLREKY 160

Query: 157 CNIPNLLVVLVLQYCSHCNTTGKIRDIRSNYGQRNQYIDYLPLERLQIDITKPFNDSDIK 216
            NI   LV L LQ CSHCN     + I   Y +          E++ ++I +PF D D  
Sbjct: 161 SNISRALVRLSLQNCSHCNPKSTYKHIE--YTRHFSCDKNFAFEKIHVEIFQPFEDVDT- 217

Query: 217 IANKYSHILLIRDYHSRYSWIFPLKSPNIKNISTELGKFLVTLPRTPIFLHSIGIPESQL 276
            ANK+SH++ IRDY +RY W++PL+  ++K ++  L   L+   R PI++ S+ + ES L
Sbjct: 218 FANKFSHVIYIRDYFTRYVWLYPLEKISVKELANTLATHLLLSLRIPIYIESLTLDESNL 277

Query: 277 IKILTKI 283
           +KIL +I
Sbjct: 278 LKILKRI 284

>CAGL0B01771g Chr2 (163063..164673) [1611 bp, 536 aa] {ON} weakly
           similar to uniprot|O13329 Saccharomyces cerevisiae
           YDR110w FOB1 DNA replication fork blocking protein
          Length = 536

 Score =  130 bits (326), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 96/365 (26%), Positives = 155/365 (42%), Gaps = 22/365 (6%)

Query: 49  MLKRGEKETMEFRNTLKKHITSDLYYAMRDESLLEDDAPIPASL---KIKTSKKMYLQIR 105
            LKRGEK+   F   L   +T + Y  + + +L  +      ++       +K   L  R
Sbjct: 84  FLKRGEKDMRRFAEGLAGKLTQETYTLLMNNNLTMETVMKAMNIWPPNAAETKYSNLIKR 143

Query: 106 YSKNSDGDLIETKT-NKLLCEPKYIYKLTMKAHFMNNHMRSNKLYRNLSMKYCNIPNLLV 164
           + K+ +G++ + K  N ++ EP  ++ L + AH  N H+++  L++ L   Y N     V
Sbjct: 144 FYKDKEGNIRDAKVDNNIVLEPDKLFNLILTAHLKNGHLKTAVLFQCLREVYANCTRDFV 203

Query: 165 VLVLQYCSHCNTTGKIRDIRSNYGQRNQYIDYLPLERLQIDITKPFNDSD---------- 214
              L YC+ CN    I+ I      RN   + LPLER+ I++  PF   +          
Sbjct: 204 QTALFYCNRCNPDRYIKPIEK-VRHRNINEELLPLERVHIEVFAPFEKEEGDIKQEDSQN 262

Query: 215 --IKIANKYSHILLIRDYHSRYSWIFPLKSPNIKNISTELGKFLVT-LPRTPIFLHSIGI 271
             IKI  KYSH+   RD+ +RY W FPLK+   K +   +  F +T L   PIF+ S  I
Sbjct: 263 PYIKIEGKYSHVFYCRDFRTRYVWCFPLKNMKFKTLVDNIATFFMTVLYDPPIFVESSTI 322

Query: 272 PESQLIKILTKILLEYXXXXXXXXXXXXXXMFLRKGISRLVYXXXXXXXXXXCKSDWYQC 331
               L +I    LL                 F  +GI R  +          C  DW  C
Sbjct: 323 DRDDLKEIFE--LLASKYGLKLGLGFANFTKFHAQGIKR--FKTHLHRAKSECADDWLMC 378

Query: 332 IRNTTFKENRRFDRNTGSFANFLIGKQKAELNKVFENKRDALLSDLLEENVLKIGECGSI 391
           ++  T+  NR  +R  G  +N L  +   +  +    K+   +     EN+    + G  
Sbjct: 379 LKQGTYSANRVIERQLGKASNILFTELMGQFERDMRKKKLKYIEQSFSENIKTYPKSGGC 438

Query: 392 IYFDN 396
           I+ ++
Sbjct: 439 IFIEH 443

>TPHA0A01810 Chr1 complement(365982..367355) [1374 bp, 457 aa] {ON}
           Anc_8.262 YDR110W
          Length = 457

 Score =  127 bits (320), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 92/389 (23%), Positives = 179/389 (46%), Gaps = 28/389 (7%)

Query: 28  FFCPPIGXXXXXXXXXXXXXXMLKRGEKETMEFRNTLKKHITSDLYYAMRDESLLEDDAP 87
           +  P IG              +L++GE   +   N+   +++ +LY  ++++ L   +  
Sbjct: 31  YIIPRIGQKYDSLITPLLDKQLLQKGE---IAVANSKTNYLSKELYDLVKNDDLTRKNVA 87

Query: 88  IPASLKIKTSKKMYLQIRYSKNSDGDLI---ETKTNKLLCEPKYIYKLTMKAHFMNNHMR 144
           +  +L  K +    + +++    D  L+    +K NK++ +P + +++ M  H +N+H+ 
Sbjct: 88  VALNLDEKNAITRLIPLKHRYYRDSKLMVHDRSKQNKIVIDPAHRFRMVMTTHLLNDHLT 147

Query: 145 SNKLYRNLSMKYCNIPNLLVVLVLQYCSHCNTTGK-IRDIRSNYGQRNQYIDYLPLERLQ 203
              +YR LS  + N+ +  +   ++YCS CN+  K IR  R    Q +   D L  ERL 
Sbjct: 148 RGAIYRTLSKCFANLSDPFIKTSIEYCSICNSNKKNIR--RKKEPQLSNSPDILFYERLI 205

Query: 204 IDITKPFNDSDIKIANKYSHILLIRDYHSRYSWIFPLKSPNIKNISTELGKFLVTLPRTP 263
           +D+  PF     KI  +Y+HIL I D+H+++ W FPLK+  ++ I +++ +F+V LP  P
Sbjct: 206 LDVVAPFGAK--KIQKRYTHILTITDFHTKFMWSFPLKNLKLRTIISKVTEFIVALPVKP 263

Query: 264 IFLHSIGIPESQLIKILTKILLEYXXXXXXXXXXXXXXMFLRKGISRLVYXXXXXXXXXX 323
           +F+ S  +  + + ++   +  EY                    ++R++           
Sbjct: 264 VFISSFTLSLNDIFELCCYLAREYNISIGLGTRNMQKAYSKNPYVTRIL-----NSHKTE 318

Query: 324 CKSDWYQCIRNTTFKE-NRRFD-----RNTGSFANFLIGKQKAELNKVFENKRDALLSDL 377
           C   W+ C++    ++ N +FD     +N G F+         +  K +E +   ++  L
Sbjct: 319 CLKSWFMCLKWLADRQSNSKFDIRPPNKNYGLFSGM------TDFLKKYEERSKMIIGRL 372

Query: 378 LEENVLKIGECGSIIYFDNNNSGKELDEK 406
             EN + I E    IY ++  S   L EK
Sbjct: 373 PSENFINIDEGSHFIYSEDEFSFDNLVEK 401

>KLLA0F19140g Chr6 (1773327..1774910) [1584 bp, 527 aa] {ON} some
           similarities with uniprot|O13329 Saccharomyces
           cerevisiae YDR110W FOB1 Nucleolar protein required for
           DNA replication fork blocking and recombinational
           hotspot activities binds to the replication fork barrier
           site in the rDNA region related to retroviral integrases
          Length = 527

 Score =  127 bits (320), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 99/365 (27%), Positives = 170/365 (46%), Gaps = 22/365 (6%)

Query: 49  MLKRGEKETMEFRNTLKKHITSDLYYAMRDESLLEDDAPIPASLKIKTS----KKMYLQI 104
           ML  G  +  +  NT+K  +T  +Y  +  ++L +++  + AS K+  S    K + L+ 
Sbjct: 77  MLIEGRLQLEKEINTVKGQLTQPIYDLLHSDALTKENL-LRASDKVTNSTVENKFVLLKR 135

Query: 105 RYSKNSDGDLIETKTNKLLC-EPKYIYKLTMKAHFMNNHMRSNKLYRNLSMKYCNIPNLL 163
           RY    +  L + K   L+  EP  ++ L M  H +N+H+ S  +Y  LS  Y N+    
Sbjct: 136 RYYVQENL-LHDVKRKDLVVYEPNELFDLIMSVHVLNSHVSSKGIYNELSTFYANVTQSF 194

Query: 164 VVLVLQYCSHCNTTGKIRDIRSNYGQRNQYIDYLPLERLQIDITKPF--------NDSDI 215
             LV  +CS CN +G     +  +   N + + +PL R  ++I  PF        N  ++
Sbjct: 195 CKLVTSFCSKCNESGNKISYK-KFKHENIHANLIPLGRCHVEIFAPFDSAYQGNDNTDEL 253

Query: 216 KIANKYSHILLIRDYHSRYSWIFPLKSPNIKNISTELGKFLVTLPRTPIFLHSIGIPESQ 275
           KI  KY  +L  RDY+SRY W+ PLKS  + ++   + K L ++ R PIF+ +  +    
Sbjct: 254 KIEGKYPFVLYCRDYYSRYVWLEPLKSVTLSDLLPVMTKLLFSMIRMPIFIDTCTLDRQD 313

Query: 276 LIKILTKILLEYXXXXXXXXXXXXXXMFLRKGISRLVYXXXXXXXXXXCKSDWYQCIRNT 335
           +  +   I   Y               F + GI R+            C  DW  C++  
Sbjct: 314 MFDVCENIARIYKIKIGLGMNSSTS--FQKTGIKRM--KSLFLQHKEECLHDWNMCLKLV 369

Query: 336 TFKENRRF-DRNTGSFANFLIGKQKAELNKVFENKRDALLSDLLEENVLKIGECGSIIYF 394
             + N+ + DR  G  ++ L   Q+ +L+K F   +  ++S LL  +V++  E G +IY 
Sbjct: 370 VSRLNQNYSDRVRGVPSDLLCSTQQ-DLHKKFRTLQRNVISRLLGHHVVQFEEAGGMIYL 428

Query: 395 DNNNS 399
           ++ NS
Sbjct: 429 EDENS 433

>KNAG0H03240 Chr8 complement(603920..605479) [1560 bp, 519 aa] {ON}
           Anc_8.262 YDR110W
          Length = 519

 Score =  121 bits (304), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 74/243 (30%), Positives = 134/243 (55%), Gaps = 12/243 (4%)

Query: 51  KRGEKETMEFRNTLKKHITSDLYYAMRDESLLEDDAP--IPASLKIKTSKKM-YLQIRYS 107
           KRGE++   +  T    ++ +LY   +++ + +++     P       S+KM Y+  RY 
Sbjct: 57  KRGERDITAYAPTQPGRMSQELYALFKNDDVTKENIARLYPTDRSGDESRKMMYITRRYY 116

Query: 108 KNSDGDLIE-TKTNKLLCEPKYIYKLTMKAHFMNNHMRSNKLYRNLSMKYCNIPNLLVVL 166
           K+++G + + T  N+++ +P + + + M  H MN H+ S ++YR L   Y N   LL+  
Sbjct: 117 KDANGMIRDATMNNRIVYDPIHTFDIIMSCHLMNKHLGSERVYRCLREFYANGGPLLIKR 176

Query: 167 VLQYCSHCNTTGKIRDIRSNYGQRNQYI--DYLPLERLQIDITKPFNDSDIKIANKYSHI 224
            L+YCS CN + K+    +   Q   Y+    LPLER+ I+I +PF +   K+  KYS++
Sbjct: 177 TLEYCSVCNPSLKL----TPKVQPKPYLFEKALPLERITIEIIEPFPNE--KVEGKYSNM 230

Query: 225 LLIRDYHSRYSWIFPLKSPNIKNISTELGKFLVTLPRTPIFLHSIGIPESQLIKILTKIL 284
           ++++D+  R+ W+ PLK+   KNI   + K +++ PR PI++ S  +  S L  I   I+
Sbjct: 231 VVMKDFIGRFEWLEPLKNTKFKNIVPVVAKMILSFPRVPIWVESNTLDWSDLFDIFEMIV 290

Query: 285 LEY 287
            +Y
Sbjct: 291 TKY 293

>TBLA0E04430 Chr5 (1136737..1138182) [1446 bp, 481 aa] {ON}
           Anc_8.262 YDR110W
          Length = 481

 Score =  103 bits (256), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 97/363 (26%), Positives = 163/363 (44%), Gaps = 23/363 (6%)

Query: 49  MLKRGEKETMEFRNTLKKHITSDLYYAMRDESLLEDDAPIPASLKIKTSKKM-----YLQ 103
           +L++G K+ M+  +++K  + +  Y  M +   L  +  I    K+    K      +  
Sbjct: 54  LLEKGYKD-MQRYHSIKAAVLTQEYCDMLNTGTLSPENIIKYDTKLTNHSKALEKYNFTS 112

Query: 104 IRYSKNSDGDLIET-KTNKLLCEPKYIYKLTMKAHFMNNHMRSNKLYRNLSMKYCNIPNL 162
            RY  N D ++I+  K  +++CEPKY+Y + +  H   +   S  +   L   + N+   
Sbjct: 113 RRYYLNEDNNIIDKRKPGRIICEPKYMYDIVIAYHLKLH--SSYAVSERLKKFFSNVGRQ 170

Query: 163 LVVLVLQYCSHC--NTTGKIR---DIRSNYGQRNQYID--YLPLERLQIDITKPFNDSDI 215
            +    +YCS C  + T  ++   D  +    RN  ID    P+ER+ I+I  PF+D  +
Sbjct: 171 YIDYCAKYCSKCFPDETEHMKLFTDDITFKNIRNNIIDRPLFPMERIHIEIFNPFDD--L 228

Query: 216 KIANKYSHILLIRDYHSRYSWIFPLKSPNIKNISTELGKFLVTLP-RTPIFLHSIGIPES 274
           KI NKY  IL IRDY +RY W F LK   +K+I+  L +F +++    PIFL S  I  +
Sbjct: 229 KIENKYQRILYIRDYSTRYIWTFTLKKLKLKHITNILTEFFLSIATNVPIFLQSSTIDNT 288

Query: 275 QLIKILTKILLEYXXXXXXXXXXXXXXMFLRKGISRLVYXXXXXXXXXXCKSDWYQCIRN 334
            L  I  KI  EY                L  GI   ++          C   W   +  
Sbjct: 289 DLFDICEKISREYHISLGLGTNNKHDHFHL-SGIE--MFKQLVNLNKSKCLKSWSNFLVF 345

Query: 335 TTFKENRRFDRNTGSFANFLIG-KQKAELNKVFENKRDALLSDLLEENVLKIGECGSIIY 393
            +   N +F+    S    +I     A+  K F ++R  ++   + +N +K+G   SII+
Sbjct: 346 GSVLHNNKFNSRILSKPIDIINCNNLAQGKKKFRDRRLRIIKQTITDNYVKLGNVASIIF 405

Query: 394 FDN 396
            ++
Sbjct: 406 IED 408

>KAFR0B06620 Chr2 complement(1376088..1379645) [3558 bp, 1185 aa]
           {ON} 
          Length = 1185

 Score = 37.0 bits (84), Expect = 0.099,   Method: Compositional matrix adjust.
 Identities = 20/79 (25%), Positives = 40/79 (50%), Gaps = 5/79 (6%)

Query: 171 CSHCNTTGKIRDIRSNYGQRNQYIDYL-PLERLQIDITKPFNDSDIKIANKYSHILLIRD 229
           C  C   GK+R  +   G R +Y  +  P + +  D+  P +D     A   ++ +   D
Sbjct: 639 CKEC-LAGKMRRHKHTVGSRLKYQQFFEPFQYIHTDLFGPMSDVS---ATTPTYFISFVD 694

Query: 230 YHSRYSWIFPLKSPNIKNI 248
            ++R+ W++PL+S + ++I
Sbjct: 695 ENTRFRWVYPLRSKSAEHI 713

>Ecym_4008 Chr4 complement(16717..19071) [2355 bp, 784 aa] {ON}
           similar to Ashbya gossypii AFR297W
          Length = 784

 Score = 36.2 bits (82), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 35/121 (28%), Positives = 56/121 (46%), Gaps = 16/121 (13%)

Query: 110 SDGDLIETKTNKLL--CEPKYIYKLTMKAHFMNNHMRSNKLYRNLSMKYCNIPNLLVVLV 167
           S GD+  +   K L  C  K+   +++  H +NNH  S   Y     ++ N+ + L  + 
Sbjct: 448 SSGDINSSTLVKELIECAKKHCLSISVHQH-INNHYISPASYHQQQKRF-NVASPLGGV- 504

Query: 168 LQYCSHCNT----TGKIRDIRSNYGQRNQYIDYLPLERLQ-IDITKPFNDSDIKIANKYS 222
                 CNT    TG   D+ +++ QRN   D +PLE LQ ++ +  F  S+      YS
Sbjct: 505 ------CNTQDGATGTDFDLHADFLQRNHSFDSIPLETLQRMNTSGYFPSSNQVATAPYS 558

Query: 223 H 223
           H
Sbjct: 559 H 559

>NDAI0B06160 Chr2 (1494425..1498636) [4212 bp, 1403 aa] {ON} 
          Length = 1403

 Score = 36.2 bits (82), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 38/79 (48%), Gaps = 5/79 (6%)

Query: 171 CSHCNTTGKIRDIRSNYGQRNQYI-DYLPLERLQIDITKPFNDSDIKIANKYSHILLIRD 229
           C  C   GKI   +   G R +Y   Y P E +  D+  P +  DI  + KY   +   D
Sbjct: 348 CKDC-LAGKITKHKHIVGSRLKYQKSYEPFEYIHTDLFGPVSGVDI-TSPKY--FISFTD 403

Query: 230 YHSRYSWIFPLKSPNIKNI 248
            ++R+ W+FPLK  +  +I
Sbjct: 404 ENTRFRWVFPLKKKDADHI 422

>NDAI0D03010 Chr4 complement(712188..714524) [2337 bp, 778 aa] {ON} 
          Length = 778

 Score = 35.8 bits (81), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 41/159 (25%), Positives = 64/159 (40%), Gaps = 23/159 (14%)

Query: 98  KKMYLQIRYSKNSDGDLIETKTNK----LLCEPKYIYKLTMKAH--------FMNNHMRS 145
           K+M L  ++    DG L  T  +     + C P  ++ +    H         +  H   
Sbjct: 129 KRMRLTYKFE---DGKLFFTSPHNKKKLIWCPPTLLHYVIACVHENWDCDDYTLRKHRDE 185

Query: 146 NKLYRNLSMKYCNIPNLLVVLVLQYCSHCN--TTGKIRDIRSNYGQRNQYIDYLPLERLQ 203
           N++   L+ KY NI   L+  V+  C  C   ++ K    R N     +Y      +RLQ
Sbjct: 186 NEIQSILAAKYHNISKFLIHDVVAACPDCKPLSSKKFNITRVNVLPLTRY----SFQRLQ 241

Query: 204 IDITKPFNDSDI--KIANKYSHILLIRDYHSRYSWIFPL 240
           + I    + S +  K     + IL I DYHS   W+F L
Sbjct: 242 VKILSAADYSCVCPKDNCTKNAILYIGDYHSGAVWLFAL 280

>Kpol_2000.35 s2000 complement(68315..70429) [2115 bp, 704 aa] {ON}
           complement(68315..70429) [2115 nt, 705 aa]
          Length = 704

 Score = 35.4 bits (80), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 37/82 (45%), Gaps = 10/82 (12%)

Query: 161 NLLVVLVLQYCSHCNTTGKIRDIRSNYGQRNQYIDYLPL-ERLQIDITKPFNDSDIKIAN 219
           NLL++ V++ C  C T  K RDI     +    I  +P+  R  +D   P  D D     
Sbjct: 344 NLLLLDVVKQCPRCETYQKFRDIPIELPE----IRRIPVFSRWHLDFAGPLKDKD----- 394

Query: 220 KYSHILLIRDYHSRYSWIFPLK 241
            Y + LL  DY S    + PL+
Sbjct: 395 GYKYFLLAADYTSNLILVKPLR 416

>Kpol_544.2 s544 complement(3985..4863) [879 bp, 292 aa] {ON}
           complement(3985..4863) [879 nt, 293 aa]
          Length = 292

 Score = 35.0 bits (79), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 35/136 (25%), Positives = 59/136 (43%), Gaps = 20/136 (14%)

Query: 120 NKLLCEPKYIYKLTMKAHFMNNHMRSNKLYRNLSM-----KYCNIPNLLVVL-VLQYCSH 173
           + +L +  YI+K T+       H R +  +R L       KY N  + +++L +++ C H
Sbjct: 138 HHILTDIDYIHKATLV------HNRFHSCHRVLEQTMTQEKYWNPKHSILLLDIVRNCQH 191

Query: 174 CNTTGKIRDIRSNYGQRNQYIDYLPLERLQIDITKPFNDSDIKIANKYSHILLIRDYHSR 233
           C    +  D+     +        PL R   D   PF  S     N Y + +L  DY S 
Sbjct: 192 CEKYQRFIDLPVELPKMKVT---PPLTRWHFDFAGPFPSS-----NDYQYFILAVDYTSN 243

Query: 234 YSWIFPLKSPNIKNIS 249
            +   P+KSP+ + +S
Sbjct: 244 ITVTKPIKSPDSRAVS 259

>NDAI0G00550 Chr7 complement(116985..118223) [1239 bp, 412 aa] {ON} 
          Length = 412

 Score = 34.7 bits (78), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 38/79 (48%), Gaps = 5/79 (6%)

Query: 171 CSHCNTTGKIRDIRSNYGQRNQYIDYL-PLERLQIDITKPFNDSDIKIANKYSHILLIRD 229
           C  C   GK+   +   G R +Y  Y  P E +  D+  P +  DI  + KY   +   D
Sbjct: 263 CKDC-LAGKLTKHKHIVGSRLKYQKYYEPFEYIHTDLFGPVSGVDI-TSPKY--FISFTD 318

Query: 230 YHSRYSWIFPLKSPNIKNI 248
            ++R+ W+FPLK  +  +I
Sbjct: 319 ENTRFRWVFPLKKKDADHI 337

>Kpol_1031.7 s1031 (14919..19916) [4998 bp, 1665 aa] {ON}
            (14919..19916) [4998 nt, 1666 aa]
          Length = 1665

 Score = 35.0 bits (79), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 35/126 (27%), Positives = 56/126 (44%), Gaps = 14/126 (11%)

Query: 122  LLCEPKYIYKLTMKAHFMNNHMRSNKLYRNLSM--KYCNIPNLLVVL-VLQYCSHCNTTG 178
            +L +  YI K T  AH  N    S+++   + +  KY N  + +++L +++ C HC T  
Sbjct: 1262 ILTDIDYIQKAT-SAH--NRFHASHRVLEQIMVQEKYWNPKHSVLLLDIVRNCQHCETYQ 1318

Query: 179  KIRDIRSNYGQRNQYIDYLPLERLQIDITKPFNDSDIKIANKYSHILLIRDYHSRYSWIF 238
            +  D+     +        PL R   D   P   S     N Y + +L  DY S  +   
Sbjct: 1319 RFIDLPVELPKMKVT---PPLTRWHFDFAGPLPSS-----NDYQYFILAVDYTSNITVTK 1370

Query: 239  PLKSPN 244
            P+KSPN
Sbjct: 1371 PIKSPN 1376

>TDEL0E00260 Chr5 complement(46841..49489,49491..50588) [3747 bp,
           1248 aa] {ON} 
          Length = 1248

 Score = 33.9 bits (76), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 18/67 (26%), Positives = 35/67 (52%), Gaps = 6/67 (8%)

Query: 195 DYLPLERLQIDITKPFNDSDIKIANKYSHILLIRDYHSRYSWIFPLKSPNIKNIS---TE 251
           +Y P + +  D+  P     +   N   ++L   D  +RY W+FPL+  + ++I+   +E
Sbjct: 586 EYKPFQFIHTDLFGPVQ---VTAVNVPRYLLAFTDECTRYKWVFPLREKDSQSITARFSE 642

Query: 252 LGKFLVT 258
           L +F+ T
Sbjct: 643 LVRFIET 649

>TDEL0H04520 Chr8 complement(817439..819277) [1839 bp, 612 aa] {ON} 
          Length = 612

 Score = 33.5 bits (75), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 18/67 (26%), Positives = 35/67 (52%), Gaps = 6/67 (8%)

Query: 195 DYLPLERLQIDITKPFNDSDIKIANKYSHILLIRDYHSRYSWIFPLKSPNIKNIS---TE 251
           +Y P + +  D+   F    +   N   ++L   D  +RY W+FPL+  + ++I+   +E
Sbjct: 78  EYKPFQFIHTDL---FGPVQVTAVNVPRYLLAFTDECTRYKWVFPLREKDSQSITARFSE 134

Query: 252 LGKFLVT 258
           L +F+ T
Sbjct: 135 LVRFIET 141

>Kpol_1035.3 s1035 complement(5707..9099) [3393 bp, 1130 aa] {ON}
           complement(5707..9099) [3393 nt, 1131 aa]
          Length = 1130

 Score = 31.2 bits (69), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 30/118 (25%), Positives = 46/118 (38%), Gaps = 20/118 (16%)

Query: 161 NLLVVLVLQYCSHCNTTGKIRDIRSNYGQRNQYIDYLPLERLQIDITKPFNDSDIKIA-- 218
           NLL++ V++ CS C T  K  D              LP+E  +I  T  F+   +  A  
Sbjct: 791 NLLLLDVVRLCSRCETYEKFSD--------------LPIELPEIHRTPVFSRWHLDFAGP 836

Query: 219 ----NKYSHILLIRDYHSRYSWIFPLKSPNIKNISTELGKFLVTLPRTPIFLHSIGIP 272
               N Y + LL  DY S    + PL   +  ++   +     T  R  + +   G P
Sbjct: 837 LPAHNGYKYFLLAADYTSNLILVRPLAEQSFTSVYDLIFDIYATFGRPHMLVTDNGSP 894

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.138    0.404 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 41,613,823
Number of extensions: 1799933
Number of successful extensions: 4975
Number of sequences better than 10.0: 40
Number of HSP's gapped: 5035
Number of HSP's successfully gapped: 40
Length of query: 445
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 332
Effective length of database: 40,524,141
Effective search space: 13454014812
Effective search space used: 13454014812
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 67 (30.4 bits)