Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0F030608.263ON50050026070.0
TBLA0G01630singletonON50050019510.0
KLLA0F19162g8.263ON52849416600.0
KNAG0G020408.263ON59149616380.0
KAFR0B05520singletonON51049916280.0
KAFR0B055308.263ON51449716150.0
SAKL0H17006g8.263ON53149316130.0
CAGL0L12254g8.263ON57449916140.0
Skud_12.1578.263ON59249416110.0
YLR089C (ALT1)8.263ON59249416050.0
Smik_12.1488.263ON59249415990.0
ZYRO0C01628g8.263ON53449215920.0
Suva_10.1738.263ON59249615890.0
TDEL0F039008.263ON55949715730.0
NCAS0B038408.263ON49750015660.0
KNAG0M012108.263ON52150215680.0
NCAS0B050208.263ON56849815680.0
KLTH0G13662g8.263ON51948815510.0
NDAI0B019908.263ON58849615570.0
Suva_2.2718.263ON50749415460.0
Kpol_392.58.263ON51249115440.0
Skud_4.3728.263ON50749415380.0
Smik_4.3578.263ON50750115280.0
YDR111C (ALT2)8.263ON50749415260.0
Kwal_56.237918.263ON51848815250.0
KAFR0B027308.263ON53949315240.0
NDAI0J013608.263ON50149715160.0
Kpol_543.398.263ON49249614980.0
TPHA0J007508.263ON52250014720.0
TBLA0E044408.263ON56249914710.0
TPHA0A018008.263ON49849814640.0
Ecym_43078.263ON53449314290.0
AGR085W8.263ON52149314250.0
Ecym_62921.321ON4302621036e-04
AEL170C1.321ON458214990.002
NCAS0A092001.321ON445321990.002
ADL249W2.252ON387179980.002
Suva_6.1361.321ON444137970.003
YJL060W (BNA3)1.321ON444137960.004
TPHA0O014501.321ON443140960.004
KLTH0H10648g1.321ON443393950.005
Smik_10.1801.321ON444140950.006
Skud_10.1561.321ON460148930.008
KLTH0G09614g2.252ON389193930.009
KLLA0F10021g3.511ON497356930.010
NDAI0G057601.321ON448134910.017
Kwal_23.48882.252ON389198900.019
Kpol_1039.222.252ON386177880.029
KLTH0G02002g3.511ON496124890.030
Ecym_6319singletonON354236880.031
KNAG0E018502.252ON384192880.036
Kpol_1035.231.321ON444145880.037
SAKL0D06886g1.321ON44793870.046
SAKL0E08492g2.252ON384131870.047
TDEL0C040902.252ON383131850.068
ZYRO0G20636g1.321ON453140850.089
Ecym_32902.252ON386189840.089
TPHA0F012602.252ON392206840.11
Kwal_14.25741.321ON443143830.13
SAKL0F02156g3.511ON498224820.20
Kwal_47.189823.511ON496326810.23
TDEL0D019001.321ON44365810.25
CAGL0J05126g1.321ON433171800.29
KLLA0F03509g2.252ON387220800.31
KNAG0B006603.511ON496122790.43
KNAG0B053201.321ON43373790.44
KAFR0J015802.252ON383131780.50
Suva_9.782.252ON386192770.63
Kwal_34.160181.472ON379171770.64
YIL116W (HIS5)2.252ON385125770.68
SAKL0D11528g1.472ON383161770.72
KAFR0A017101.321ON435168770.79
ZYRO0A01672g2.252ON386127741.4
Smik_16.3183.372ON680121751.6
KLTH0G19646g1.472ON379133732.0
KLLA0F01617g1.321ON44476732.5
CAGL0C01243g2.252ON383125722.6
Skud_9.552.252ON385124722.8
NCAS0B064402.252ON385103723.0
NDAI0B037302.252ON386198723.1
KNAG0G005501.472ON38754713.6
Kpol_480.11.472ON38055714.0
KLTH0G19624gsingletonON46870714.1
NDAI0G023908.359ON96571714.6
Kwal_26.9050singletonON364142695.8
KLTH0B00176g8.204ON44832696.2
Smik_9.532.252ON388134697.0
Kwal_47.17462na 1ON492152697.5
NCAS0G040501.472ON38454687.6
ZYRO0C06028g3.511ON496160697.9
Suva_16.4033.372ON68028689.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0F03060
         (500 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0F03060 Chr6 (743646..745148) [1503 bp, 500 aa] {ON} Anc_8.2...  1008   0.0  
TBLA0G01630 Chr7 (428016..429518) [1503 bp, 500 aa] {ON}              756   0.0  
KLLA0F19162g Chr6 complement(1775240..1776826) [1587 bp, 528 aa]...   644   0.0  
KNAG0G02040 Chr7 complement(463058..464833) [1776 bp, 591 aa] {O...   635   0.0  
KAFR0B05520 Chr2 (1130297..1131829) [1533 bp, 510 aa] {ON} Anc_8...   631   0.0  
KAFR0B05530 Chr2 (1132895..1134439) [1545 bp, 514 aa] {ON}            626   0.0  
SAKL0H17006g Chr8 (1493272..1494867) [1596 bp, 531 aa] {ON} high...   625   0.0  
CAGL0L12254g Chr12 complement(1327111..1328835) [1725 bp, 574 aa...   626   0.0  
Skud_12.157 Chr12 complement(301427..303205) [1779 bp, 592 aa] {...   625   0.0  
YLR089C Chr12 complement(318237..320015) [1779 bp, 592 aa] {ON} ...   622   0.0  
Smik_12.148 Chr12 complement(298127..299905) [1779 bp, 592 aa] {...   620   0.0  
ZYRO0C01628g Chr3 (115665..117269) [1605 bp, 534 aa] {ON} simila...   617   0.0  
Suva_10.173 Chr10 complement(323066..324844) [1779 bp, 592 aa] {...   616   0.0  
TDEL0F03900 Chr6 complement(726159..727838) [1680 bp, 559 aa] {O...   610   0.0  
NCAS0B03840 Chr2 (683781..685274) [1494 bp, 497 aa] {ON} Anc_8.2...   607   0.0  
KNAG0M01210 Chr13 (220612..222177) [1566 bp, 521 aa] {ON} Anc_8....   608   0.0  
NCAS0B05020 Chr2 complement(931456..933162) [1707 bp, 568 aa] {O...   608   0.0  
KLTH0G13662g Chr7 (1169989..1171548) [1560 bp, 519 aa] {ON} simi...   602   0.0  
NDAI0B01990 Chr2 complement(493160..494926) [1767 bp, 588 aa] {O...   604   0.0  
Suva_2.271 Chr2 complement(472714..474237) [1524 bp, 507 aa] {ON...   600   0.0  
Kpol_392.5 s392 (6873..8411) [1539 bp, 512 aa] {ON} (6873..8411)...   599   0.0  
Skud_4.372 Chr4 complement(649872..651395) [1524 bp, 507 aa] {ON...   597   0.0  
Smik_4.357 Chr4 complement(639561..641084) [1524 bp, 507 aa] {ON...   593   0.0  
YDR111C Chr4 complement(678241..679764) [1524 bp, 507 aa] {ON}  ...   592   0.0  
Kwal_56.23791 s56 (706946..708502) [1557 bp, 518 aa] {ON} YLR089...   592   0.0  
KAFR0B02730 Chr2 complement(558858..560477) [1620 bp, 539 aa] {O...   591   0.0  
NDAI0J01360 Chr10 (313791..315296) [1506 bp, 501 aa] {ON} Anc_8....   588   0.0  
Kpol_543.39 s543 complement(86358..87836) [1479 bp, 492 aa] {ON}...   581   0.0  
TPHA0J00750 Chr10 complement(176561..178129) [1569 bp, 522 aa] {...   571   0.0  
TBLA0E04440 Chr5 complement(1138820..1140508) [1689 bp, 562 aa] ...   571   0.0  
TPHA0A01800 Chr1 (364262..365758) [1497 bp, 498 aa] {ON} Anc_8.2...   568   0.0  
Ecym_4307 Chr4 (652209..653813) [1605 bp, 534 aa] {ON} similar t...   555   0.0  
AGR085W Chr7 (887023..888588) [1566 bp, 521 aa] {ON} Syntenic ho...   553   0.0  
Ecym_6292 Chr6 (547563..548855) [1293 bp, 430 aa] {ON} similar t...    44   6e-04
AEL170C Chr5 complement(318032..319408) [1377 bp, 458 aa] {ON} S...    43   0.002
NCAS0A09200 Chr1 complement(1819134..1820471) [1338 bp, 445 aa] ...    43   0.002
ADL249W Chr4 (261227..262390) [1164 bp, 387 aa] {ON} Syntenic ho...    42   0.002
Suva_6.136 Chr6 complement(227366..228700) [1335 bp, 444 aa] {ON...    42   0.003
YJL060W Chr10 (323386..324720) [1335 bp, 444 aa] {ON}  BNA3Kynur...    42   0.004
TPHA0O01450 Chr15 complement(291591..292922) [1332 bp, 443 aa] {...    42   0.004
KLTH0H10648g Chr8 complement(919601..920932) [1332 bp, 443 aa] {...    41   0.005
Smik_10.180 Chr10 (315030..316364) [1335 bp, 444 aa] {ON} YJL060...    41   0.006
Skud_10.156 Chr10 complement(294149..295531) [1383 bp, 460 aa] {...    40   0.008
KLTH0G09614g Chr7 (804939..806108) [1170 bp, 389 aa] {ON} simila...    40   0.009
KLLA0F10021g Chr6 (926569..928062) [1494 bp, 497 aa] {ON} simila...    40   0.010
NDAI0G05760 Chr7 (1427844..1429190) [1347 bp, 448 aa] {ON} Anc_1...    40   0.017
Kwal_23.4888 s23 (907745..908914) [1170 bp, 389 aa] {ON} YIL116W...    39   0.019
Kpol_1039.22 s1039 (68736..69896) [1161 bp, 386 aa] {ON} (68736....    39   0.029
KLTH0G02002g Chr7 (155219..156709) [1491 bp, 496 aa] {ON} highly...    39   0.030
Ecym_6319 Chr6 complement(607599..608663) [1065 bp, 354 aa] {ON}...    39   0.031
KNAG0E01850 Chr5 (381827..382981) [1155 bp, 384 aa] {ON} Anc_2.2...    39   0.036
Kpol_1035.23 s1035 complement(56123..57457) [1335 bp, 444 aa] {O...    39   0.037
SAKL0D06886g Chr4 complement(571478..572821) [1344 bp, 447 aa] {...    38   0.046
SAKL0E08492g Chr5 complement(692049..693203) [1155 bp, 384 aa] {...    38   0.047
TDEL0C04090 Chr3 complement(722310..723461) [1152 bp, 383 aa] {O...    37   0.068
ZYRO0G20636g Chr7 complement(1700506..1701867) [1362 bp, 453 aa]...    37   0.089
Ecym_3290 Chr3 (546773..547933) [1161 bp, 386 aa] {ON} similar t...    37   0.089
TPHA0F01260 Chr6 complement(290133..291311) [1179 bp, 392 aa] {O...    37   0.11 
Kwal_14.2574 s14 complement(818144..819475) [1332 bp, 443 aa] {O...    37   0.13 
SAKL0F02156g Chr6 (185574..187070) [1497 bp, 498 aa] {ON} highly...    36   0.20 
Kwal_47.18982 s47 complement(1051414..1052904) [1491 bp, 496 aa]...    36   0.23 
TDEL0D01900 Chr4 (369434..370765) [1332 bp, 443 aa] {ON} Anc_1.3...    36   0.25 
CAGL0J05126g Chr10 complement(487452..488753) [1302 bp, 433 aa] ...    35   0.29 
KLLA0F03509g Chr6 (327598..328761) [1164 bp, 387 aa] {ON} simila...    35   0.31 
KNAG0B00660 Chr2 (115417..116907) [1491 bp, 496 aa] {ON} Anc_3.5...    35   0.43 
KNAG0B05320 Chr2 (1028845..1030146) [1302 bp, 433 aa] {ON} Anc_1...    35   0.44 
KAFR0J01580 Chr10 complement(287313..288464) [1152 bp, 383 aa] {...    35   0.50 
Suva_9.78 Chr9 (137747..138907) [1161 bp, 386 aa] {ON} YIL116W (...    34   0.63 
Kwal_34.16018 s34 (159210..160349) [1140 bp, 379 aa] {ON} YJL060...    34   0.64 
YIL116W Chr9 (142928..144085) [1158 bp, 385 aa] {ON}  HIS5Histid...    34   0.68 
SAKL0D11528g Chr4 complement(960867..962018) [1152 bp, 383 aa] {...    34   0.72 
KAFR0A01710 Chr1 complement(348198..349505) [1308 bp, 435 aa] {O...    34   0.79 
ZYRO0A01672g Chr1 (136284..137444) [1161 bp, 386 aa] {ON} highly...    33   1.4  
Smik_16.318 Chr16 complement(569893..571935) [2043 bp, 680 aa] {...    33   1.6  
KLTH0G19646g Chr7 complement(1699421..1700560) [1140 bp, 379 aa]...    33   2.0  
KLLA0F01617g Chr6 complement(154025..155359) [1335 bp, 444 aa] {...    33   2.5  
CAGL0C01243g Chr3 (128629..129780) [1152 bp, 383 aa] {ON} highly...    32   2.6  
Skud_9.55 Chr9 (119747..120904) [1158 bp, 385 aa] {ON} YIL116W (...    32   2.8  
NCAS0B06440 Chr2 complement(1218759..1219916) [1158 bp, 385 aa] ...    32   3.0  
NDAI0B03730 Chr2 complement(935131..936291) [1161 bp, 386 aa] {O...    32   3.1  
KNAG0G00550 Chr7 (96823..97986) [1164 bp, 387 aa] {ON} Anc_1.472       32   3.6  
Kpol_480.1 s480 (215..1357) [1143 bp, 380 aa] {ON} (215..1357) [...    32   4.0  
KLTH0G19624g Chr7 complement(1697587..1698993) [1407 bp, 468 aa]...    32   4.1  
NDAI0G02390 Chr7 complement(547355..550252) [2898 bp, 965 aa] {O...    32   4.6  
Kwal_26.9050 s26 (1055019..1056113) [1095 bp, 364 aa] {ON} YCR10...    31   5.8  
KLTH0B00176g Chr2 (10791..12137) [1347 bp, 448 aa] {ON} similar ...    31   6.2  
Smik_9.53 Chr9 (120672..121838) [1167 bp, 388 aa] {ON} YIL116W (...    31   7.0  
Kwal_47.17462 s47 (413555..415033) [1479 bp, 492 aa] {ON} YGL202...    31   7.5  
NCAS0G04050 Chr7 complement(753216..754370) [1155 bp, 384 aa] {O...    31   7.6  
ZYRO0C06028g Chr3 (457564..459054) [1491 bp, 496 aa] {ON} highly...    31   7.9  
Suva_16.403 Chr16 complement(700071..702113) [2043 bp, 680 aa] {...    31   9.2  

>TBLA0F03060 Chr6 (743646..745148) [1503 bp, 500 aa] {ON} Anc_8.263
           YDR111C
          Length = 500

 Score = 1008 bits (2607), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 491/500 (98%), Positives = 491/500 (98%)

Query: 1   MTMNQKTFLPAPKFSLNDINESILKAEYAIRGTIPNRAEELDIQLLENSKSLPFAKIVYA 60
           MTMNQKTFLPAPKFSLNDINESILKAEYAIRGTIPNRAEELDIQLLENSKSLPFAKIVYA
Sbjct: 1   MTMNQKTFLPAPKFSLNDINESILKAEYAIRGTIPNRAEELDIQLLENSKSLPFAKIVYA 60

Query: 61  NIGNPQQLDQQPLTFQRQVMSLVQFPDLLKSKDILLAQKIYSKDSIERATKLLNSIGGSV 120
           NIGNPQQLDQQPLTFQRQVMSLVQFPDLLKSKDILLAQKIYSKDSIERATKLLNSIGGSV
Sbjct: 61  NIGNPQQLDQQPLTFQRQVMSLVQFPDLLKSKDILLAQKIYSKDSIERATKLLNSIGGSV 120

Query: 121 GAYSSSQGVLDIRKNVARFILKRDLHHDPTQDLIDETASNVFLTAGASTAVDHILPLFAK 180
           GAYSSSQGVLDIRKNVARFILKRDLHHDPTQDLIDETASNVFLTAGASTAVDHILPLFAK
Sbjct: 121 GAYSSSQGVLDIRKNVARFILKRDLHHDPTQDLIDETASNVFLTAGASTAVDHILPLFAK 180

Query: 181 DESCGVLLPIPQYPLYTAAVTLQKSKLLPYYLNESNNWSTDPKQIEQIVIDAIKQNIKPT 240
           DESCGVLLPIPQYPLYTAAVTLQKSKLLPYYLNESNNWSTDPKQIEQIVIDAIKQNIKPT
Sbjct: 181 DESCGVLLPIPQYPLYTAAVTLQKSKLLPYYLNESNNWSTDPKQIEQIVIDAIKQNIKPT 240

Query: 241 TLVVINPGNPTGAILTKDSXXXXXXXXXEYGIVIIADEVYQENVYEAFEFHSFKKVLSEL 300
           TLVVINPGNPTGAILTKDS         EYGIVIIADEVYQENVYEAFEFHSFKKVLSEL
Sbjct: 241 TLVVINPGNPTGAILTKDSIIDIIDIAAEYGIVIIADEVYQENVYEAFEFHSFKKVLSEL 300

Query: 301 RKNYPSKYDNVQLASLHSISKGVNGECGQRGGYMEITGFSNDVKKVLLKVASISICSVVT 360
           RKNYPSKYDNVQLASLHSISKGVNGECGQRGGYMEITGFSNDVKKVLLKVASISICSVVT
Sbjct: 301 RKNYPSKYDNVQLASLHSISKGVNGECGQRGGYMEITGFSNDVKKVLLKVASISICSVVT 360

Query: 361 GQILVDLMVNPPQPGDESYELDQLERSVIHSNLILKSNTLYDVFTRLPGISCQKPQGAMY 420
           GQILVDLMVNPPQPGDESYELDQLERSVIHSNLILKSNTLYDVFTRLPGISCQKPQGAMY
Sbjct: 361 GQILVDLMVNPPQPGDESYELDQLERSVIHSNLILKSNTLYDVFTRLPGISCQKPQGAMY 420

Query: 421 LFPRLHLSENAINAATELNLKPDEFYCLKLLENTGICTVPGSGFGQYPGTYHLRTTFLPP 480
           LFPRLHLSENAINAATELNLKPDEFYCLKLLENTGICTVPGSGFGQYPGTYHLRTTFLPP
Sbjct: 421 LFPRLHLSENAINAATELNLKPDEFYCLKLLENTGICTVPGSGFGQYPGTYHLRTTFLPP 480

Query: 481 GIEWINSWEKFHLEFMEKYK 500
           GIEWINSWEKFHLEFMEKYK
Sbjct: 481 GIEWINSWEKFHLEFMEKYK 500

>TBLA0G01630 Chr7 (428016..429518) [1503 bp, 500 aa] {ON} 
          Length = 500

 Score =  756 bits (1951), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 365/500 (73%), Positives = 422/500 (84%), Gaps = 2/500 (0%)

Query: 3   MNQKTFLPAPKFSLNDINESILKAEYAIRGTIPNRAEELDIQLLENSKSLPFAKIVYANI 62
           M+ K   PAPKFSLNDI++SIL  EYAIRGTIP RA+EL  QL  +   LPF KI+YANI
Sbjct: 1   MSAKDCTPAPKFSLNDISQSILDTEYAIRGTIPTRADELQEQLNISPNQLPFKKIIYANI 60

Query: 63  GNPQQLDQQPLTFQRQVMSLVQFPDLLKSKDILLAQKIYSKDSIERATKLLNSIGGSVGA 122
           GNPQQL+Q+PLTFQRQV+SLV++P+L+ SK+IL+  KIY+ D+I+RA  +LNSIGGSVGA
Sbjct: 61  GNPQQLEQEPLTFQRQVLSLVEYPNLVNSKNILVENKIYAPDAIKRAETILNSIGGSVGA 120

Query: 123 YSSSQGVLDIRKNVARFILKRDLHHDPTQD--LIDETASNVFLTAGASTAVDHILPLFAK 180
           YSSSQG+L IRKNVA+ IL+RD       D  LI+ETASN+FLT GA+TAV +ILPLFAK
Sbjct: 121 YSSSQGILSIRKNVAKCILQRDNDELCCNDEELINETASNIFLTDGATTAVSYILPLFAK 180

Query: 181 DESCGVLLPIPQYPLYTAAVTLQKSKLLPYYLNESNNWSTDPKQIEQIVIDAIKQNIKPT 240
           DE+CGVLLPIPQYPLYTAAVTLQ SKLLPYYLNE  NWSTDP++IE I+ DAI +NIKPT
Sbjct: 181 DENCGVLLPIPQYPLYTAAVTLQNSKLLPYYLNEDENWSTDPEEIETIIKDAISRNIKPT 240

Query: 241 TLVVINPGNPTGAILTKDSXXXXXXXXXEYGIVIIADEVYQENVYEAFEFHSFKKVLSEL 300
           TLV+INPGNPTGAIL+ +S         +YGIVIIADEVYQ N+Y+ F+FHSFKK+L+ L
Sbjct: 241 TLVIINPGNPTGAILSVESITQIINIAAKYGIVIIADEVYQNNIYQDFKFHSFKKILNSL 300

Query: 301 RKNYPSKYDNVQLASLHSISKGVNGECGQRGGYMEITGFSNDVKKVLLKVASISICSVVT 360
           +  YP KYDNVQLASLHSISKGVNGECGQRGGY E+ GFS+++KK++LK+ASI ICSVVT
Sbjct: 301 KLQYPKKYDNVQLASLHSISKGVNGECGQRGGYFELLGFSDEIKKIILKLASIDICSVVT 360

Query: 361 GQILVDLMVNPPQPGDESYELDQLERSVIHSNLILKSNTLYDVFTRLPGISCQKPQGAMY 420
           GQILVDLM  PP+ GD SY+LDQ ER+ I SNLILKSNTLYD+F+RLPGISCQKPQGAMY
Sbjct: 361 GQILVDLMSKPPEKGDYSYKLDQRERNNIQSNLILKSNTLYDLFSRLPGISCQKPQGAMY 420

Query: 421 LFPRLHLSENAINAATELNLKPDEFYCLKLLENTGICTVPGSGFGQYPGTYHLRTTFLPP 480
           LFPRLHL+ N IN A   NL+PDEFYCLKLLENTGICTVPGSGFGQ  GTYH+RTTFLP 
Sbjct: 421 LFPRLHLTSNMINEAKLNNLEPDEFYCLKLLENTGICTVPGSGFGQKEGTYHVRTTFLPS 480

Query: 481 GIEWINSWEKFHLEFMEKYK 500
           GIEWI  WEKFHLEFM +YK
Sbjct: 481 GIEWIKLWEKFHLEFMNQYK 500

>KLLA0F19162g Chr6 complement(1775240..1776826) [1587 bp, 528 aa]
           {ON} similar to uniprot|P52893 Saccharomyces cerevisiae
           YLR089C ALT1 putative alanine transaminase (glutamyc
           pyruvic transaminase)
          Length = 528

 Score =  644 bits (1660), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/494 (62%), Positives = 381/494 (77%), Gaps = 8/494 (1%)

Query: 7   TFLPAPKFSLNDINESILKAEYAIRGTIPNRAEELDIQLLENSKSLPFAKIVYANIGNPQ 66
           T  PAPK SL+D+NE++LKA+YA+RG IP RAEEL  QL ++  SLPF+KI+ ANIGNPQ
Sbjct: 42  TVKPAPKLSLDDVNENVLKAKYAVRGRIPMRAEELRDQLKKDPSSLPFSKIISANIGNPQ 101

Query: 67  QLDQQPLTFQRQVMSLVQFPDLLKSKDILLAQKIYSKDSIERATKLLNSIGGSVGAYSSS 126
           QLDQ+PLTF R+V+SL+Q P+LL+  D  L Q +Y  DSI+RA +LL+ +GGSVGAYS S
Sbjct: 102 QLDQKPLTFYREVLSLLQHPELLEEADEAL-QTLYKTDSIKRAKRLLSEVGGSVGAYSQS 160

Query: 127 QGVLDIRKNVARFILKRDLHHDPTQDLIDETASNVFLTAGASTAVDHILPLFAKDESCGV 186
           QGV  IR+ VA FI KRD       D       +++LTAGAS AV +IL +  K  + GV
Sbjct: 161 QGVQGIRETVADFITKRD-------DGEISYPEDIYLTAGASAAVSYILSILCKGPNTGV 213

Query: 187 LLPIPQYPLYTAAVTLQKSKLLPYYLNESNNWSTDPKQIEQIVIDAIKQNIKPTTLVVIN 246
           L+PIPQYPLYTA++ L  S+ LPYYL E  NWSTDP++IEQ+V+DAI++ IKPT LVVIN
Sbjct: 214 LIPIPQYPLYTASLALNNSRPLPYYLREEQNWSTDPEEIEQVVLDAIQKGIKPTCLVVIN 273

Query: 247 PGNPTGAILTKDSXXXXXXXXXEYGIVIIADEVYQENVYEAFEFHSFKKVLSELRKNYPS 306
           PGNPTGAIL++ S         +YGIV+IADEVYQENV++  +F+S KKVL  L+K Y  
Sbjct: 274 PGNPTGAILSEQSIQKIFEVAAKYGIVVIADEVYQENVFKGSKFYSMKKVLRNLQKTYHG 333

Query: 307 KYDNVQLASLHSISKGVNGECGQRGGYMEITGFSNDVKKVLLKVASISICSVVTGQILVD 366
           +YDN+QLASLHS SKGV+GECGQRGGYME+ GF++D+++V LK+ASIS+C VVTGQ LVD
Sbjct: 334 QYDNIQLASLHSTSKGVSGECGQRGGYMELVGFNHDIRQVFLKLASISLCPVVTGQALVD 393

Query: 367 LMVNPPQPGDESYELDQLERSVIHSNLILKSNTLYDVFTRLPGISCQKPQGAMYLFPRLH 426
           LMV+PPQPGDESYE DQ ER  IH  L  +++ L++ F+RL GI C+KPQGAMYL+P+L 
Sbjct: 394 LMVSPPQPGDESYEQDQQEREDIHDALDERASKLFETFSRLEGIECRKPQGAMYLYPKLD 453

Query: 427 LSENAINAATELNLKPDEFYCLKLLENTGICTVPGSGFGQYPGTYHLRTTFLPPGIEWIN 486
           L    I  A  L ++PDEFYC  LLENTGICTVPGSGFGQ PGTYHLRTTFLPPG EW+ 
Sbjct: 454 LPYKVIQEAQHLEMEPDEFYCKALLENTGICTVPGSGFGQVPGTYHLRTTFLPPGTEWVE 513

Query: 487 SWEKFHLEFMEKYK 500
           +WEKFH  F +KY+
Sbjct: 514 TWEKFHKAFFDKYR 527

>KNAG0G02040 Chr7 complement(463058..464833) [1776 bp, 591 aa] {ON}
           Anc_8.263 YDR111C
          Length = 591

 Score =  635 bits (1638), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/496 (60%), Positives = 385/496 (77%), Gaps = 10/496 (2%)

Query: 8   FLPAPKFSLNDINESILKAEYAIRGTIPNRAEELDIQLLENSKSLPFAKIVYANIGNPQQ 67
           F PA +  + D+NE++LKA+YA+RG+IP RAE+L  QL E+ +SLPF KI+ ANIGNPQQ
Sbjct: 102 FTPAAQVKIADLNENVLKAKYAVRGSIPMRAEQLQHQLQEDPRSLPFDKIINANIGNPQQ 161

Query: 68  LDQQPLTFQRQVMSLVQFPDLLKS--KDILLAQKIYSKDSIERATKLLNSIGGSVGAYSS 125
           L+Q+PL+F RQV+SL+QFP+LL S  ++   A  +Y  D++ RA KLL  IGGSVGAYS+
Sbjct: 162 LNQKPLSFYRQVLSLLQFPELLNSLKENPAAATSLYKADAVRRAEKLLEDIGGSVGAYST 221

Query: 126 SQGVLDIRKNVARFILKRDLHHDPTQDLIDETASNVFLTAGASTAVDHILPLFAKDESCG 185
           SQGV+ IRK VA FI +RD +++P          ++FLTAGAS AV ++L +F K E  G
Sbjct: 222 SQGVMGIRKTVADFITRRD-NNEPA------YPEDIFLTAGASAAVSYLLSIFCKGEKTG 274

Query: 186 VLLPIPQYPLYTAAVTLQKSKLLPYYLNESNNWSTDPKQIEQIVIDAIKQNIKPTTLVVI 245
           VL+PIPQYPLYTA + L  S  LPYYL+E + WST+ K+I+ +V+DAI +NIKP+ LVVI
Sbjct: 275 VLIPIPQYPLYTATLALNNSHTLPYYLDEKSGWSTNTKEIDSVVLDAIDRNIKPSVLVVI 334

Query: 246 NPGNPTGAILTKDSXXXXXXXXXEYGIVIIADEVYQENVY-EAFEFHSFKKVLSELRKNY 304
           NPGNPTGA+L++ +         +YGIV+IADEVYQEN++ E  +FHS KKVL +L++ +
Sbjct: 335 NPGNPTGAVLSEKAIAEIFEIAAKYGIVVIADEVYQENIFDEDVKFHSMKKVLRKLQQEH 394

Query: 305 PSKYDNVQLASLHSISKGVNGECGQRGGYMEITGFSNDVKKVLLKVASISICSVVTGQIL 364
           P K+D VQLASLHS SKGV+GECGQRGG+ME+TGFS+++++V+LK+ASIS+C VVTGQ L
Sbjct: 395 PGKFDEVQLASLHSTSKGVSGECGQRGGFMELTGFSHEIRQVILKLASISLCPVVTGQAL 454

Query: 365 VDLMVNPPQPGDESYELDQLERSVIHSNLILKSNTLYDVFTRLPGISCQKPQGAMYLFPR 424
           VDLMV+PPQ G+ESYELDQ ERS IHS L  ++N L++ F RL GI CQKPQGAMYLFPR
Sbjct: 455 VDLMVHPPQEGEESYELDQAERSHIHSELHKRANKLWETFNRLEGIQCQKPQGAMYLFPR 514

Query: 425 LHLSENAINAATELNLKPDEFYCLKLLENTGICTVPGSGFGQYPGTYHLRTTFLPPGIEW 484
           L+L   A+  A  + +  DEFYC +LLENTGICTVPGSGFGQ PGTYHLRTTFL PG EW
Sbjct: 515 LNLPFKAVQKAQHMEMTADEFYCKELLENTGICTVPGSGFGQVPGTYHLRTTFLAPGTEW 574

Query: 485 INSWEKFHLEFMEKYK 500
           I+ WEKFH EF  KY+
Sbjct: 575 IDLWEKFHKEFYNKYR 590

>KAFR0B05520 Chr2 (1130297..1131829) [1533 bp, 510 aa] {ON}
           Anc_8.263 YDR111C
          Length = 510

 Score =  631 bits (1628), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/499 (60%), Positives = 382/499 (76%), Gaps = 10/499 (2%)

Query: 4   NQKTFLPAPKFSLNDINESILKAEYAIRGTIPNRAEELDIQLLENSK--SLPFAKIVYAN 61
           N   F PAPK S+ D+N+ I+ AEYA+RG+I  RAEEL+ +L   ++  S PF +I+YAN
Sbjct: 20  NTHDFEPAPKISVADLNQKIINAEYAVRGSIAMRAEELEFELYHKTQPHSFPFERIIYAN 79

Query: 62  IGNPQQLDQQPLTFQRQVMSLVQFPDLLKSKDILLAQKIYSKDSIERATKLLNSIGGSVG 121
           IGNPQQLDQ+PLTF RQVMS++++P LLK KD+LL+Q IY KD++ERA  L + IG SVG
Sbjct: 80  IGNPQQLDQKPLTFSRQVMSILEYPGLLKFKDVLLSQGIYKKDALERAELLQSQIGASVG 139

Query: 122 AYSSSQGVLDIRKNVARFILKRDLHHDPTQDLIDETASNVFLTAGASTAVDHILPLFAKD 181
           AYS +QGV  IR+  ARFI KRD       +    +A ++FLT GAS AV +++    ++
Sbjct: 140 AYSLAQGVYGIRETTARFISKRD-------NCEAASADDIFLTDGASKAVTYLMMALCQN 192

Query: 182 ESCGVLLPIPQYPLYTAAVTLQKSKLLPYYLNESNNWSTDPKQIEQIVIDAIKQNIKPTT 241
           E  G+L+PIPQYPLYTA++ +  +K+LPYYL+E + WST  ++IE  VI+AI+  IKP+ 
Sbjct: 193 EHTGILIPIPQYPLYTASICIHNAKMLPYYLDEESGWSTKVEEIENSVINAIENGIKPSA 252

Query: 242 LVVINPGNPTGAILTKDSXXXXXXXXXEYGIVIIADEVYQENVYEAFEFHSFKKVLSELR 301
           +VVINPGNPTGA+L+ D          +YGIV+IADEVYQ+N++   EFHS KK+L +L+
Sbjct: 253 MVVINPGNPTGAVLSVDVIQRIITVAAKYGIVLIADEVYQDNIFNG-EFHSMKKILRQLQ 311

Query: 302 KNYPSKYDNVQLASLHSISKGVNGECGQRGGYMEITGFSNDVKKVLLKVASISICSVVTG 361
           K YP KYDNVQLASLHS SKGV+GECGQRGGYMEI GFS++V+ +LLK+ASI+ICSVVTG
Sbjct: 312 KKYPGKYDNVQLASLHSTSKGVSGECGQRGGYMEIVGFSDEVRHLLLKLASINICSVVTG 371

Query: 362 QILVDLMVNPPQPGDESYELDQLERSVIHSNLILKSNTLYDVFTRLPGISCQKPQGAMYL 421
           Q LVDLMV+PP  GDESYE DQ ER+ IHS L  +++ LYD F+ L GI CQKPQGAMYL
Sbjct: 372 QALVDLMVDPPHVGDESYEKDQEERNEIHSTLKKRADKLYDTFSNLEGIECQKPQGAMYL 431

Query: 422 FPRLHLSENAINAATELNLKPDEFYCLKLLENTGICTVPGSGFGQYPGTYHLRTTFLPPG 481
           FPRL L + AI  A +L ++ DEFYC KLLENTGICTVPGSGFGQ  GTYH+RTTFL PG
Sbjct: 432 FPRLILPDRAIEEAKKLQMEADEFYCHKLLENTGICTVPGSGFGQREGTYHVRTTFLSPG 491

Query: 482 IEWINSWEKFHLEFMEKYK 500
            EWI+ W+KFH +FM++Y+
Sbjct: 492 TEWIDDWKKFHEKFMKEYQ 510

>KAFR0B05530 Chr2 (1132895..1134439) [1545 bp, 514 aa] {ON} 
          Length = 514

 Score =  626 bits (1615), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/497 (59%), Positives = 376/497 (75%), Gaps = 14/497 (2%)

Query: 8   FLPAPKFSLNDINESILKAEYAIRGTIPNRAEELDIQLLEN--SKSLPFAKIVYANIGNP 65
           F PA K +L+D+N+++LK+EYA+RG+IP RAEEL+ +LL N  S SL F  IV+ANIGNP
Sbjct: 28  FKPAKKITLDDLNQNVLKSEYAVRGSIPRRAEELEFELLNNDSSDSLAFENIVHANIGNP 87

Query: 66  QQLDQQPLTFQRQVMSLVQFPDLLKSKDILLAQKIYSKDSIERATKLLNSIGGSVGAYSS 125
           QQLDQ+PLTF RQV+S++Q+P+LL  ++IL++  I+  D++ERA  LL  IGGSVGAYSS
Sbjct: 88  QQLDQKPLTFSRQVISILQYPELLNQRNILVSTGIFKSDAMERAETLLCHIGGSVGAYSS 147

Query: 126 SQGVLDIRKNVARFILKRDLHHDPTQDLIDETAS--NVFLTAGASTAVDHILPLFAKDES 183
           SQGV  IR+ VA +I  RD           ETAS  ++FLT GAS A  ++L L  KD++
Sbjct: 148 SQGVYGIRETVANYITARD---------NGETASPDDIFLTEGASKAASYLLSLLCKDKN 198

Query: 184 CGVLLPIPQYPLYTAAVTLQKSKLLPYYLNESNNWSTDPKQIEQIVIDAIKQNIKPTTLV 243
            GVL+PIPQYPLYTA +TL  +K+LPYYLNE + WST+  +IE++V+DAI  N+KP+ +V
Sbjct: 199 TGVLIPIPQYPLYTATITLCDAKMLPYYLNEESGWSTNTNEIEKVVLDAIADNVKPSVMV 258

Query: 244 VINPGNPTGAILTKDSXXXXXXXXXEYGIVIIADEVYQENVYEAFEFHSFKKVLSELRKN 303
           VINPGNPTG++L+KD          +YGIV+IADEVYQEN+++  EFHS KKVL  L+K 
Sbjct: 259 VINPGNPTGSVLSKDDIIHIINIGAKYGIVLIADEVYQENIFDG-EFHSMKKVLRSLQKQ 317

Query: 304 YPSKYDNVQLASLHSISKGVNGECGQRGGYMEITGFSNDVKKVLLKVASISICSVVTGQI 363
           YP KYD VQLASLHS SKGV+GECGQRGGYME+ GF +++++ +LK+ASIS+CSV+TGQ 
Sbjct: 318 YPGKYDAVQLASLHSTSKGVSGECGQRGGYMELVGFKDEIRQAILKLASISLCSVITGQA 377

Query: 364 LVDLMVNPPQPGDESYELDQLERSVIHSNLILKSNTLYDVFTRLPGISCQKPQGAMYLFP 423
           LVDLMVNPP+ GDESYELD  ER  IH  L  ++  LY++F +L G+ CQKPQGAMYLFP
Sbjct: 378 LVDLMVNPPKKGDESYELDNFERKNIHETLKERAEKLYNLFCQLKGVECQKPQGAMYLFP 437

Query: 424 RLHLSENAINAATELNLKPDEFYCLKLLENTGICTVPGSGFGQYPGTYHLRTTFLPPGIE 483
           +LH  +  I  A   N+ PDEFYC  LLE TGICTVPGSGFGQ  GTYHLRTTFL PG +
Sbjct: 438 KLHFPQTLITEAINQNMSPDEFYCHALLEATGICTVPGSGFGQKEGTYHLRTTFLAPGNQ 497

Query: 484 WINSWEKFHLEFMEKYK 500
           W   W+ FH EF  KY+
Sbjct: 498 WTEKWKLFHEEFFSKYQ 514

>SAKL0H17006g Chr8 (1493272..1494867) [1596 bp, 531 aa] {ON} highly
           similar to gnl|GLV|KLLA0F19162g Kluyveromyces lactis
           KLLA0F19162g and similar to YLR089C uniprot|P52893
           Saccharomyces cerevisiae YLR089C ALT1 putative alanine
           transaminase (glutamyc pyruvic transaminase)
          Length = 531

 Score =  625 bits (1613), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/493 (60%), Positives = 373/493 (75%), Gaps = 7/493 (1%)

Query: 8   FLPAPKFSLNDINESILKAEYAIRGTIPNRAEELDIQLLENSKSLPFAKIVYANIGNPQQ 67
           F PA K SL D+NE++L+A+YA+RG IP +AEEL  QL  + KSLPF +I+ ANIGNPQQ
Sbjct: 45  FQPADKLSLEDLNENVLRAKYAVRGKIPQKAEELKNQLARDPKSLPFDRIINANIGNPQQ 104

Query: 68  LDQQPLTFQRQVMSLVQFPDLLKSKDILLAQKIYSKDSIERATKLLNSIGGSVGAYSSSQ 127
           LDQ+PLTF RQV+SL+Q PD+L+        +IY  D+I+RA +LL++IGGSVGAYS SQ
Sbjct: 105 LDQKPLTFYRQVLSLLQNPDMLEEIPREQLSQIYKPDAIDRAARLLSNIGGSVGAYSHSQ 164

Query: 128 GVLDIRKNVARFILKRDLHHDPTQDLIDETASNVFLTAGASTAVDHILPLFAKDESCGVL 187
           GV   RK VA FI KRD   +         A ++FLTAGAS AV +IL +  +    GVL
Sbjct: 165 GVYGFRKTVADFITKRDGGEE-------AYAEDIFLTAGASAAVSYILSILCRGPQTGVL 217

Query: 188 LPIPQYPLYTAAVTLQKSKLLPYYLNESNNWSTDPKQIEQIVIDAIKQNIKPTTLVVINP 247
           +PIPQYPLYTA++ L  S  LPYYL+E +NWST+P++IE++V ++I + ++P  LVVINP
Sbjct: 218 IPIPQYPLYTASLALNNSHALPYYLDEESNWSTNPEEIEKVVTNSIAKGVEPKCLVVINP 277

Query: 248 GNPTGAILTKDSXXXXXXXXXEYGIVIIADEVYQENVYEAFEFHSFKKVLSELRKNYPSK 307
           GNPTGAIL+ +S         +YGIV+IADEVYQENV+   EFHS +KVL +L++ +  K
Sbjct: 278 GNPTGAILSPESIEKIFEVAAKYGIVVIADEVYQENVFNGAEFHSMRKVLKDLQRKHHGK 337

Query: 308 YDNVQLASLHSISKGVNGECGQRGGYMEITGFSNDVKKVLLKVASISICSVVTGQILVDL 367
           +DN+QLASLHS SKGV+GECGQRGGYME+ GFS+DV++V LK+ASIS+C VVTGQ LVDL
Sbjct: 338 FDNIQLASLHSTSKGVSGECGQRGGYMELLGFSHDVRQVFLKLASISLCPVVTGQALVDL 397

Query: 368 MVNPPQPGDESYELDQLERSVIHSNLILKSNTLYDVFTRLPGISCQKPQGAMYLFPRLHL 427
           MV PP+PGD SYE DQ ERS IH  L  +++ LY+ F RL GI CQKPQGAMYLFPRL L
Sbjct: 398 MVCPPKPGDASYEQDQKERSEIHDALDARASMLYETFNRLEGIECQKPQGAMYLFPRLDL 457

Query: 428 SENAINAATELNLKPDEFYCLKLLENTGICTVPGSGFGQYPGTYHLRTTFLPPGIEWINS 487
           S  A+  A  L+L PDEFYC +LLE TGICTVPGSGFGQ PGTYHLRTTFL PG +WI +
Sbjct: 458 SYKAVQKAEHLSLSPDEFYCQELLEATGICTVPGSGFGQVPGTYHLRTTFLAPGTDWIKA 517

Query: 488 WEKFHLEFMEKYK 500
           WE+FH +F  +Y+
Sbjct: 518 WEEFHKKFYNEYR 530

>CAGL0L12254g Chr12 complement(1327111..1328835) [1725 bp, 574 aa]
           {ON} similar to uniprot|P52893 Saccharomyces cerevisiae
           YLR089c
          Length = 574

 Score =  626 bits (1614), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/499 (60%), Positives = 374/499 (74%), Gaps = 8/499 (1%)

Query: 2   TMNQKTFLPAPKFSLNDINESILKAEYAIRGTIPNRAEELDIQLLENSKSLPFAKIVYAN 61
           + N   FLPA + +L D+NE +L A+YA+RG IP RAEEL  QL+EN  SLPF  I+ AN
Sbjct: 83  SHNNLPFLPAEQATLKDVNECVLNAKYAVRGAIPMRAEELKTQLMENPHSLPFNDIINAN 142

Query: 62  IGNPQQLDQQPLTFQRQVMSLVQFPDLLKSKDILLAQKIYSKDSIERATKLLNSIGGSVG 121
           IGNPQQL Q+PL+F RQV+SL+Q+P+L+ + +    Q +  +D+I+RA +LL+ IGGSVG
Sbjct: 143 IGNPQQLKQKPLSFYRQVLSLLQYPELIPTLENN-PQTMIKQDAIDRAKRLLDDIGGSVG 201

Query: 122 AYSSSQGVLDIRKNVARFILKRDLHHDPTQDLIDETASNVFLTAGASTAVDHILPLFAKD 181
           AYSSSQGVL IRK VA FI  RD       D I     ++FLTAGAS+AVD++L +F + 
Sbjct: 202 AYSSSQGVLGIRKTVADFITNRD-------DGIIAYPEDIFLTAGASSAVDYLLSIFCRG 254

Query: 182 ESCGVLLPIPQYPLYTAAVTLQKSKLLPYYLNESNNWSTDPKQIEQIVIDAIKQNIKPTT 241
           E  GVL+PIPQYPLYTA + LQ S  LPYYLNE   WSTDP+++E I++D+I+ NIKP+ 
Sbjct: 255 EETGVLIPIPQYPLYTATLALQNSHALPYYLNEETGWSTDPEELESIILDSIENNIKPSV 314

Query: 242 LVVINPGNPTGAILTKDSXXXXXXXXXEYGIVIIADEVYQENVYEAFEFHSFKKVLSELR 301
           LVVINPGNPTGA+L++++         +YGI++IADEVYQENV+E  +FHS KKVL +L+
Sbjct: 315 LVVINPGNPTGAVLSEEAIEQIFTLAAKYGIIVIADEVYQENVFEDVKFHSMKKVLRQLQ 374

Query: 302 KNYPSKYDNVQLASLHSISKGVNGECGQRGGYMEITGFSNDVKKVLLKVASISICSVVTG 361
              P  YDNVQLASLHS SKGV+GECGQRGGYME+ GF++D+++V+LK+ASIS+C VVTG
Sbjct: 375 MKQPGLYDNVQLASLHSTSKGVSGECGQRGGYMELVGFTHDIRQVVLKLASISLCPVVTG 434

Query: 362 QILVDLMVNPPQPGDESYELDQLERSVIHSNLILKSNTLYDVFTRLPGISCQKPQGAMYL 421
           Q LVDLMV PPQ G+ESYE DQ ER  IH  L  ++  L+D F +L GISCQKPQGAMYL
Sbjct: 435 QALVDLMVCPPQKGEESYEQDQEERRNIHKELHKRATLLHDAFVKLDGISCQKPQGAMYL 494

Query: 422 FPRLHLSENAINAATELNLKPDEFYCLKLLENTGICTVPGSGFGQYPGTYHLRTTFLPPG 481
           FP+L L   AI  A   ++ PDEFYC  LLE TGICTVPGSGFGQ PGTYHLRTTFL PG
Sbjct: 495 FPKLELPYKAIQEALHQDMSPDEFYCKSLLEKTGICTVPGSGFGQEPGTYHLRTTFLAPG 554

Query: 482 IEWINSWEKFHLEFMEKYK 500
            +WI  W  FH EF  K+K
Sbjct: 555 TKWIEDWVDFHQEFYNKFK 573

>Skud_12.157 Chr12 complement(301427..303205) [1779 bp, 592 aa] {ON}
           YLR089C (REAL)
          Length = 592

 Score =  625 bits (1611), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/494 (59%), Positives = 377/494 (76%), Gaps = 8/494 (1%)

Query: 8   FLPAPKFSLNDINESILKAEYAIRGTIPNRAEELDIQLLENSKSLPFAKIVYANIGNPQQ 67
           F PA + +L D+NE++LKA+YA+RG IP RAEEL  QL ++ +SLPF KI+ ANIGNPQQ
Sbjct: 105 FYPAEQLTLEDVNENVLKAKYAVRGAIPMRAEELKAQLEKDPQSLPFDKIINANIGNPQQ 164

Query: 68  LDQQPLTFQRQVMSLVQFPDLL-KSKDILLAQKIYSKDSIERATKLLNSIGGSVGAYSSS 126
           L Q+PLT+ RQV+SL+Q+P+LL +++  L+  K++  D+I+RA  L+  IGGSVGAYSSS
Sbjct: 165 LQQKPLTYYRQVLSLLQYPELLNQNEQQLVDSKLFKLDAIKRAKSLMEDIGGSVGAYSSS 224

Query: 127 QGVLDIRKNVARFILKRDLHHDPTQDLIDETASNVFLTAGASTAVDHILPLFAKDESCGV 186
           QGV  IRK+VA FI KRD       D       ++FLTAGAS AV+++L +F +    GV
Sbjct: 225 QGVEGIRKSVAEFITKRD-------DGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGV 277

Query: 187 LLPIPQYPLYTAAVTLQKSKLLPYYLNESNNWSTDPKQIEQIVIDAIKQNIKPTTLVVIN 246
           L+PIPQYPLYTA + L  S+ LPYYL+E + WST+P++IE +V +AI+  IKPT LVVIN
Sbjct: 278 LIPIPQYPLYTATLALNNSQALPYYLDEQSGWSTNPEEIETVVKEAIQNEIKPTVLVVIN 337

Query: 247 PGNPTGAILTKDSXXXXXXXXXEYGIVIIADEVYQENVYEAFEFHSFKKVLSELRKNYPS 306
           PGNPTGA+L+ +S         +YG V+IADEVYQEN++   +FHS KK+L  L++ +P 
Sbjct: 338 PGNPTGAVLSPESVSQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKKILRTLQREHPG 397

Query: 307 KYDNVQLASLHSISKGVNGECGQRGGYMEITGFSNDVKKVLLKVASISICSVVTGQILVD 366
           K+DNVQLASLHS SKGV+GECGQRGGYME+TGFS+++++V+LK+ASIS+C VVTGQ LVD
Sbjct: 398 KFDNVQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVD 457

Query: 367 LMVNPPQPGDESYELDQLERSVIHSNLILKSNTLYDVFTRLPGISCQKPQGAMYLFPRLH 426
           LMV PP  G+ES+ELDQ ER+ IH  LI ++ TLYD F  L GI CQKPQGAMYLFP++ 
Sbjct: 458 LMVRPPVEGEESFELDQAERNSIHEKLITRAMTLYDTFNSLEGIECQKPQGAMYLFPKID 517

Query: 427 LSENAINAATELNLKPDEFYCLKLLENTGICTVPGSGFGQYPGTYHLRTTFLPPGIEWIN 486
           L   A+  A  L L PDEFYC  LLE+TGICTVPGSGFGQ PGTYHLRTTFL PG+EWI 
Sbjct: 518 LPFKAVQEARHLELTPDEFYCKSLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWIK 577

Query: 487 SWEKFHLEFMEKYK 500
            WE FH EF ++Y+
Sbjct: 578 KWETFHKEFFDQYR 591

>YLR089C Chr12 complement(318237..320015) [1779 bp, 592 aa] {ON}
           ALT1Alanine transaminase (glutamic pyruvic
           transaminase); involved in alanine biosynthetic and
           catabolic processes; the authentic, non-tagged protein
           is detected in highly purified mitochondria in
           high-throughput studies
          Length = 592

 Score =  622 bits (1605), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/494 (59%), Positives = 378/494 (76%), Gaps = 8/494 (1%)

Query: 8   FLPAPKFSLNDINESILKAEYAIRGTIPNRAEELDIQLLENSKSLPFAKIVYANIGNPQQ 67
           F PA + +L D+NE++LKA+YA+RG IP RAEEL  QL ++ +SLPF +I+ ANIGNPQQ
Sbjct: 105 FYPAEQLTLEDVNENVLKAKYAVRGAIPMRAEELKAQLEKDPQSLPFDRIINANIGNPQQ 164

Query: 68  LDQQPLTFQRQVMSLVQFPDLL-KSKDILLAQKIYSKDSIERATKLLNSIGGSVGAYSSS 126
           L Q+PLT+ RQV+SL+Q+P+LL +++  L+  K++  D+I+RA  L+  IGGSVGAYSSS
Sbjct: 165 LQQKPLTYYRQVLSLLQYPELLNQNEQQLVDSKLFKLDAIKRAKSLMEDIGGSVGAYSSS 224

Query: 127 QGVLDIRKNVARFILKRDLHHDPTQDLIDETASNVFLTAGASTAVDHILPLFAKDESCGV 186
           QGV  IRK+VA FI KRD       +       ++FLTAGAS AV+++L +F +    GV
Sbjct: 225 QGVEGIRKSVAEFITKRD-------EGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGV 277

Query: 187 LLPIPQYPLYTAAVTLQKSKLLPYYLNESNNWSTDPKQIEQIVIDAIKQNIKPTTLVVIN 246
           L+PIPQYPLYTA + L  S+ LPYYL+E++ WST+P++IE +V +AI+  IKPT LVVIN
Sbjct: 278 LIPIPQYPLYTATLALNNSQALPYYLDENSGWSTNPEEIETVVKEAIQNEIKPTVLVVIN 337

Query: 247 PGNPTGAILTKDSXXXXXXXXXEYGIVIIADEVYQENVYEAFEFHSFKKVLSELRKNYPS 306
           PGNPTGA+L+ +S         +YG V+IADEVYQEN++   +FHS KK+L  L++ +P 
Sbjct: 338 PGNPTGAVLSPESIAQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKKILRHLQREHPG 397

Query: 307 KYDNVQLASLHSISKGVNGECGQRGGYMEITGFSNDVKKVLLKVASISICSVVTGQILVD 366
           K+DNVQLASLHS SKGV+GECGQRGGYME+TGFS+++++V+LK+ASIS+C VVTGQ LVD
Sbjct: 398 KFDNVQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVD 457

Query: 367 LMVNPPQPGDESYELDQLERSVIHSNLILKSNTLYDVFTRLPGISCQKPQGAMYLFPRLH 426
           LMV PP  G+ES+E DQ ER+ IH  LI ++ TLY+ F  L GI CQKPQGAMYLFP++ 
Sbjct: 458 LMVRPPVEGEESFESDQAERNSIHEKLITRAMTLYETFNSLEGIECQKPQGAMYLFPKID 517

Query: 427 LSENAINAATELNLKPDEFYCLKLLENTGICTVPGSGFGQYPGTYHLRTTFLPPGIEWIN 486
           L   A+  A  L L PDEFYC KLLE+TGICTVPGSGFGQ PGTYHLRTTFL PG+EWI 
Sbjct: 518 LPFKAVQEARHLELTPDEFYCKKLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWIK 577

Query: 487 SWEKFHLEFMEKYK 500
            WE FH EF ++Y+
Sbjct: 578 KWESFHKEFFDQYR 591

>Smik_12.148 Chr12 complement(298127..299905) [1779 bp, 592 aa] {ON}
           YLR089C (REAL)
          Length = 592

 Score =  620 bits (1599), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/494 (59%), Positives = 376/494 (76%), Gaps = 8/494 (1%)

Query: 8   FLPAPKFSLNDINESILKAEYAIRGTIPNRAEELDIQLLENSKSLPFAKIVYANIGNPQQ 67
           F PA + +L+D+NE++LKA+YA+RG IP RAEEL  QL ++ +SLPF KI+ ANIGNPQQ
Sbjct: 105 FYPAEQLTLDDVNENVLKAKYAVRGAIPMRAEELKAQLEKDPQSLPFNKIINANIGNPQQ 164

Query: 68  LDQQPLTFQRQVMSLVQFPDLL-KSKDILLAQKIYSKDSIERATKLLNSIGGSVGAYSSS 126
           L Q+PLT+ RQV+SL+Q+P+LL +++  L+  K++  D+I+RA  L+  IGGSVGAYSSS
Sbjct: 165 LQQKPLTYYRQVLSLLQYPELLNQNEQQLVDSKLFKLDAIKRAKSLMEEIGGSVGAYSSS 224

Query: 127 QGVLDIRKNVARFILKRDLHHDPTQDLIDETASNVFLTAGASTAVDHILPLFAKDESCGV 186
           QGV  IR++VA FI KRD       +       ++FLTAGAS AV+++L +F +    GV
Sbjct: 225 QGVEGIRRSVAEFITKRD-------EGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGV 277

Query: 187 LLPIPQYPLYTAAVTLQKSKLLPYYLNESNNWSTDPKQIEQIVIDAIKQNIKPTTLVVIN 246
           L+PIPQYPLYTA + L  S+ LPYYL+ES+ WST+P++IE +V +AI+  IK T LVVIN
Sbjct: 278 LIPIPQYPLYTATLALNNSQALPYYLDESSGWSTNPEEIETVVKEAIENEIKSTVLVVIN 337

Query: 247 PGNPTGAILTKDSXXXXXXXXXEYGIVIIADEVYQENVYEAFEFHSFKKVLSELRKNYPS 306
           PGNPTGA+L+ +S         +YG V+IADEVYQEN++   +FHS KK+L  L++ +P 
Sbjct: 338 PGNPTGAVLSPESIAQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKKILRHLQREHPG 397

Query: 307 KYDNVQLASLHSISKGVNGECGQRGGYMEITGFSNDVKKVLLKVASISICSVVTGQILVD 366
           K+DNVQLASLHS SKGV+GECGQRGGYME+TGFS+++++V+LK+ASIS+C VVTGQ LVD
Sbjct: 398 KFDNVQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVD 457

Query: 367 LMVNPPQPGDESYELDQLERSVIHSNLILKSNTLYDVFTRLPGISCQKPQGAMYLFPRLH 426
           LMV PP  G+ES+E DQ ER+ IH  LI ++ TLY  F  L GI CQKPQGAMYLFP++ 
Sbjct: 458 LMVRPPLEGEESFESDQAERNSIHEKLITRAMTLYKTFNSLEGIECQKPQGAMYLFPKID 517

Query: 427 LSENAINAATELNLKPDEFYCLKLLENTGICTVPGSGFGQYPGTYHLRTTFLPPGIEWIN 486
           L   A+  A  L L PDEFYC KLLE+TGICTVPGSGFGQ PGTYHLRTTFL PG+EWI 
Sbjct: 518 LPFRAVQEARHLELTPDEFYCKKLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWIK 577

Query: 487 SWEKFHLEFMEKYK 500
            WE FH EF + Y+
Sbjct: 578 KWETFHKEFFDHYR 591

>ZYRO0C01628g Chr3 (115665..117269) [1605 bp, 534 aa] {ON} similar
           to uniprot|P52893 Saccharomyces cerevisiae YLR089C ALT1
           putative alanine transaminase (glutamyc pyruvic
           transaminase)
          Length = 534

 Score =  617 bits (1592), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/492 (59%), Positives = 371/492 (75%), Gaps = 8/492 (1%)

Query: 10  PAPKFSLNDINESILKAEYAIRGTIPNRAEELDIQLLENSKSLPFAKIVYANIGNPQQLD 69
           PA K  L+++NE++LKA+YA+RG IP  A EL+ +L ++  SLPF  IV ANIGNPQ L 
Sbjct: 49  PAEKLGLSEVNENVLKAKYAVRGAIPMLAAELNAKLKKDPHSLPFDNIVSANIGNPQHLK 108

Query: 70  QQPLTFQRQVMSLVQFPDLLKSKD-ILLAQKIYSKDSIERATKLLNSIGGSVGAYSSSQG 128
           Q+PLTF RQV+SL+Q+P LL+  + +L+  K+Y KD+I RA +LLN IG SVGAYS+SQG
Sbjct: 109 QKPLTFYRQVLSLLQYPGLLEENEQVLIDSKLYQKDAIARARRLLNDIGSSVGAYSTSQG 168

Query: 129 VLDIRKNVARFILKRDLHHDPTQDLIDETASNVFLTAGASTAVDHILPLFAKDESCGVLL 188
           +  IR+ VA+FI +RD             A ++FLTAGAS+AV ++L +  K +  GVL+
Sbjct: 169 IQGIRETVAQFITERDGGEKAY-------AEDIFLTAGASSAVSYLLSILCKGQETGVLI 221

Query: 189 PIPQYPLYTAAVTLQKSKLLPYYLNESNNWSTDPKQIEQIVIDAIKQNIKPTTLVVINPG 248
           PIPQYPLYTA++ L  S  LPYYL+E + WST+P +IE +V +AI+QNIKP+ LVVINPG
Sbjct: 222 PIPQYPLYTASLALNNSHPLPYYLDEKSGWSTNPTEIEDVVNNAIEQNIKPSVLVVINPG 281

Query: 249 NPTGAILTKDSXXXXXXXXXEYGIVIIADEVYQENVYEAFEFHSFKKVLSELRKNYPSKY 308
           NPTGA+L+++          +YGIV+IADEVYQENV++  EFHS KK+L +L+K+ P  +
Sbjct: 282 NPTGAVLSEEDISQIFAIAAKYGIVVIADEVYQENVFDGAEFHSMKKILRKLQKSNPGVF 341

Query: 309 DNVQLASLHSISKGVNGECGQRGGYMEITGFSNDVKKVLLKVASISICSVVTGQILVDLM 368
           DNVQLASLHS SKGV+GECGQRGGYMEITGF+ND+++V+LK+ASIS+C VVTGQ LVDLM
Sbjct: 342 DNVQLASLHSTSKGVSGECGQRGGYMEITGFNNDIRQVILKLASISLCPVVTGQALVDLM 401

Query: 369 VNPPQPGDESYELDQLERSVIHSNLILKSNTLYDVFTRLPGISCQKPQGAMYLFPRLHLS 428
           V+PP+PGDESYELDQ ER  IH  L  ++  L+  F  L GI CQKP+GAMYLFPRL L 
Sbjct: 402 VSPPKPGDESYELDQQERKSIHEALAERAGKLHATFNSLEGIECQKPEGAMYLFPRLLLP 461

Query: 429 ENAINAATELNLKPDEFYCLKLLENTGICTVPGSGFGQYPGTYHLRTTFLPPGIEWINSW 488
             AI +A    + PD FYC KLLE TGICTVPGSGFGQ PGTYHLRTTFL PG EWI  W
Sbjct: 462 FKAIQSAEHEGMTPDAFYCKKLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIERW 521

Query: 489 EKFHLEFMEKYK 500
           E FH  F E+Y+
Sbjct: 522 ENFHKAFYEEYR 533

>Suva_10.173 Chr10 complement(323066..324844) [1779 bp, 592 aa] {ON}
           YDR111C (REAL)
          Length = 592

 Score =  616 bits (1589), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/496 (59%), Positives = 377/496 (76%), Gaps = 12/496 (2%)

Query: 8   FLPAPKFSLNDINESILKAEYAIRGTIPNRAEELDIQLLENSKSLPFAKIVYANIGNPQQ 67
           F PA + +L+D+NE++LKA YA+RG IP RAEEL  QL ++ +SLPF KI+ ANIGNPQQ
Sbjct: 105 FYPAEQLTLDDVNENVLKARYAVRGAIPMRAEELKAQLEKDPQSLPFNKIINANIGNPQQ 164

Query: 68  LDQQPLTFQRQVMSLVQFPDLLKSKDI-LLAQKIYSKDSIERATKLLNSIGGSVGAYSSS 126
           L Q+PLT+ RQV+SL+Q+P+LL   +  L+  K++  D+I+RA  L+  IGGSVGAYSSS
Sbjct: 165 LQQKPLTYYRQVLSLLQYPELLNHNEQELVGSKLFKIDAIKRAKSLIKDIGGSVGAYSSS 224

Query: 127 QGVLDIRKNVARFILKRDLHHDPTQDLIDETA--SNVFLTAGASTAVDHILPLFAKDESC 184
           QGV  IRK+VA FI KRD           ETA   ++FLTAGAS AV ++L +F +    
Sbjct: 225 QGVEGIRKSVADFITKRDG---------GETAYPEDIFLTAGASAAVTYLLSIFCRGPET 275

Query: 185 GVLLPIPQYPLYTAAVTLQKSKLLPYYLNESNNWSTDPKQIEQIVIDAIKQNIKPTTLVV 244
           GVL+PIPQYPLYTA + L  S+ LPYYL+E++ WST+P++IE +V +AI+  IKPT LVV
Sbjct: 276 GVLIPIPQYPLYTATLALNNSQPLPYYLDENSGWSTNPEEIETVVKEAIQNEIKPTVLVV 335

Query: 245 INPGNPTGAILTKDSXXXXXXXXXEYGIVIIADEVYQENVYEAFEFHSFKKVLSELRKNY 304
           INPGNPTGA+L+ +S         +YG V+IADEVYQEN++   EF+S KKVL  L++++
Sbjct: 336 INPGNPTGAVLSPESIAQIFEVAAKYGTVVIADEVYQENIFPGTEFNSMKKVLRHLQRDH 395

Query: 305 PSKYDNVQLASLHSISKGVNGECGQRGGYMEITGFSNDVKKVLLKVASISICSVVTGQIL 364
           P K+DNVQLASLHS SKGV+GECGQRGGYME+TGFS+++++V+LK+ASIS+C VVTGQ L
Sbjct: 396 PGKFDNVQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQAL 455

Query: 365 VDLMVNPPQPGDESYELDQLERSVIHSNLILKSNTLYDVFTRLPGISCQKPQGAMYLFPR 424
           VDLMV PP  G+ES+E DQ ER+ IH  L  ++ TLY+ F  L GI CQKPQGAMYLFP+
Sbjct: 456 VDLMVRPPVEGEESFESDQSERNSIHEKLNTRAMTLYETFNSLEGIECQKPQGAMYLFPK 515

Query: 425 LHLSENAINAATELNLKPDEFYCLKLLENTGICTVPGSGFGQYPGTYHLRTTFLPPGIEW 484
           + +   AI  A  L L PDEFYC KLLE+TGICTVPGSGFGQ PGTYHLRTTFL PG+EW
Sbjct: 516 IDVPFKAIQEAHHLELTPDEFYCKKLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGVEW 575

Query: 485 INSWEKFHLEFMEKYK 500
           +  WE FH EF ++Y+
Sbjct: 576 MKKWEIFHKEFFDQYR 591

>TDEL0F03900 Chr6 complement(726159..727838) [1680 bp, 559 aa] {ON}
           Anc_8.263 YDR111C
          Length = 559

 Score =  610 bits (1573), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/497 (57%), Positives = 375/497 (75%), Gaps = 8/497 (1%)

Query: 5   QKTFLPAPKFSLNDINESILKAEYAIRGTIPNRAEELDIQLLENSKSLPFAKIVYANIGN 64
            + F PA   ++ D+NE++LKA+YA+RG+IP RAEEL  QL  +  SLPF KIV ANIGN
Sbjct: 69  HQDFYPAESLTVRDLNENVLKAKYAVRGSIPMRAEELQEQLKRDPSSLPFDKIVNANIGN 128

Query: 65  PQQLDQQPLTFQRQVMSLVQFPDLL-KSKDILLAQKIYSKDSIERATKLLNSIGGSVGAY 123
           PQQL+Q+PL+F RQV+S++Q+P++L + ++ L+++ ++ +D+IERA ++L  +GGSVGAY
Sbjct: 129 PQQLNQKPLSFYRQVLSILQYPEVLEQGEEELISKGVFKRDAIERAKRILRDVGGSVGAY 188

Query: 124 SSSQGVLDIRKNVARFILKRDLHHDPTQDLIDETASNVFLTAGASTAVDHILPLFAKDES 183
           SSSQGV  IRK VA FI +RD   +P          ++FLTAGAS AV ++L +  + + 
Sbjct: 189 SSSQGVYGIRKTVADFITERD-SGEPA------YPEDIFLTAGASAAVSYLLSILCRGQE 241

Query: 184 CGVLLPIPQYPLYTAAVTLQKSKLLPYYLNESNNWSTDPKQIEQIVIDAIKQNIKPTTLV 243
            GVL+PIPQYPLYTA + L  S +LPYYL+E + WST+  +IE +V ++I+  I+P+ LV
Sbjct: 242 TGVLIPIPQYPLYTATLALNNSHVLPYYLDEESGWSTNTAEIEGVVTESIESGIRPSVLV 301

Query: 244 VINPGNPTGAILTKDSXXXXXXXXXEYGIVIIADEVYQENVYEAFEFHSFKKVLSELRKN 303
           VINPGNPTG++L+ ++         +YGIV+IADEVYQEN++   EFHS KKVL +L+K 
Sbjct: 302 VINPGNPTGSVLSVEAIEKIFQVAAKYGIVVIADEVYQENIFAGSEFHSMKKVLRQLQKE 361

Query: 304 YPSKYDNVQLASLHSISKGVNGECGQRGGYMEITGFSNDVKKVLLKVASISICSVVTGQI 363
           +P  YDNVQL SLHS SKGV+GECGQRGGYME+TGF++++++V+LK+ASIS+C VVTGQ 
Sbjct: 362 HPGIYDNVQLVSLHSTSKGVSGECGQRGGYMELTGFTHEIRQVVLKLASISLCPVVTGQA 421

Query: 364 LVDLMVNPPQPGDESYELDQLERSVIHSNLILKSNTLYDVFTRLPGISCQKPQGAMYLFP 423
           LVDLMV PP+PGDESYE D+ ER +IH  L  ++  L+D F  L GI CQKP+GAMYLFP
Sbjct: 422 LVDLMVCPPKPGDESYEQDRKEREMIHEELDHRAGLLHDTFNSLEGIECQKPRGAMYLFP 481

Query: 424 RLHLSENAINAATELNLKPDEFYCLKLLENTGICTVPGSGFGQYPGTYHLRTTFLPPGIE 483
           ++ L   AI AA  L   PDEFYC KLLE TGICTVPGSGFGQ PGTYHLRTTFL PG E
Sbjct: 482 QIKLPYKAIQAAQHLEKTPDEFYCQKLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTE 541

Query: 484 WINSWEKFHLEFMEKYK 500
           WI  WE FH +F ++Y+
Sbjct: 542 WIKKWEDFHKKFYDQYR 558

>NCAS0B03840 Chr2 (683781..685274) [1494 bp, 497 aa] {ON} Anc_8.263
           YDR111C
          Length = 497

 Score =  607 bits (1566), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/500 (56%), Positives = 379/500 (75%), Gaps = 7/500 (1%)

Query: 1   MTMNQKTFLPAPKFSLNDINESILKAEYAIRGTIPNRAEELDIQLLENSKSLPFAKIVYA 60
           +++    F PAPK SL DINE+++ A++AIRG+I  +AE+L +QL +N   LPF +I  A
Sbjct: 4   LSLENNDFQPAPKLSLKDINENVVDAKFAIRGSISIKAEDLQVQLNKNPHCLPFDEITVA 63

Query: 61  NIGNPQQLDQQPLTFQRQVMSLVQFPDLLKSKDILLAQKIYSKDSIERATKLLNSIGGSV 120
           NIGNPQ+L+Q+PLTF RQV+S++Q+P+LL ++D+L  +KI++ DS +RA +LL  IGGSV
Sbjct: 64  NIGNPQELNQKPLTFARQVVSILQYPELLNNRDVLTKEKIFNSDSFDRAERLLRDIGGSV 123

Query: 121 GAYSSSQGVLDIRKNVARFILKRDLHHDPTQDLIDETASNVFLTAGASTAVDHILPLFAK 180
           GAYS+SQGV  IRK  A +I KRD   +P+         ++FLT GA++A  ++L +  +
Sbjct: 124 GAYSASQGVYGIRKTAAEYITKRD-GGEPSY------PEDIFLTTGATSAASYLLSVLCR 176

Query: 181 DESCGVLLPIPQYPLYTAAVTLQKSKLLPYYLNESNNWSTDPKQIEQIVIDAIKQNIKPT 240
               GVL+PIPQYPLYTA + L KS ++PYYL+E + WST+  +IE++V+D+IK+ IKP+
Sbjct: 177 GPQTGVLIPIPQYPLYTATLALNKSTMIPYYLDEESAWSTNTTEIEKLVLDSIKKGIKPS 236

Query: 241 TLVVINPGNPTGAILTKDSXXXXXXXXXEYGIVIIADEVYQENVYEAFEFHSFKKVLSEL 300
            +VVINPGNPTGA+L++ +         +YGIV++ADEVYQEN+++  +FHS KKVL  L
Sbjct: 237 VIVVINPGNPTGAVLSELAIAKIFQIAAKYGIVVLADEVYQENIFDGVQFHSTKKVLRGL 296

Query: 301 RKNYPSKYDNVQLASLHSISKGVNGECGQRGGYMEITGFSNDVKKVLLKVASISICSVVT 360
           +K YP K+DN+QLAS+HS SKGV GECGQRGGYME+ GF+++V+++LLK+A +++CSVVT
Sbjct: 297 QKQYPGKFDNIQLASMHSTSKGVFGECGQRGGYMELVGFTDEVRQLLLKLACLAVCSVVT 356

Query: 361 GQILVDLMVNPPQPGDESYELDQLERSVIHSNLILKSNTLYDVFTRLPGISCQKPQGAMY 420
           GQ +VDLM+ PP+ GD SYELD+ ER  I   +  ++  LY +F +L GI CQKPQGAMY
Sbjct: 357 GQAMVDLMLLPPKKGDASYELDKKERQEIFDAMYERARKLYAMFDKLDGIECQKPQGAMY 416

Query: 421 LFPRLHLSENAINAATELNLKPDEFYCLKLLENTGICTVPGSGFGQYPGTYHLRTTFLPP 480
           L+P L LS+ AI  A  LNL PDEFYC +LL+ TGICTVPGSGFGQ  GTYHLRTTFL P
Sbjct: 417 LYPSLILSKKAIAKAESLNLTPDEFYCHELLDATGICTVPGSGFGQKKGTYHLRTTFLAP 476

Query: 481 GIEWINSWEKFHLEFMEKYK 500
           GIEWIN WEKFH  F EKY+
Sbjct: 477 GIEWINKWEKFHKHFYEKYQ 496

>KNAG0M01210 Chr13 (220612..222177) [1566 bp, 521 aa] {ON} Anc_8.263
           YDR111C
          Length = 521

 Score =  608 bits (1568), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/502 (57%), Positives = 375/502 (74%), Gaps = 12/502 (2%)

Query: 2   TMNQKTFLPAPKFSLNDINESILKAEYAIRGTIPNRAEELDIQLLENSKSLPFAKIVYAN 61
           T++   F PA K   +D+N++I+ AEYA+RG IP +AEEL+IQL +    LPF  I  AN
Sbjct: 28  TVSGLAFEPARKLGADDLNKNIIDAEYAVRGAIPMKAEELEIQLSQQPDLLPFNAITVAN 87

Query: 62  IGNPQQLDQQPLTFQRQVMSLVQFPDLLKSKDILLAQKIYSKDSIERATKLLNSIGGSVG 121
           IGNPQQLDQ+PLTF RQV+S++Q+P LL  ++ L+    Y +D+ +RA  LL  IGGSVG
Sbjct: 88  IGNPQQLDQKPLTFSRQVVSILQYPPLLDYEEQLVTSGAYKRDAFKRAAVLLEQIGGSVG 147

Query: 122 AYSSSQGVLDIRKNVARFILKRDLHHDPTQDLIDETAS--NVFLTAGASTAVDHILPLFA 179
           AYS +QGV  IR++VA FI +RD           ETAS  ++FLT GAS A  ++L +  
Sbjct: 148 AYSLAQGVYGIRESVADFITRRDE---------GETASPDDIFLTDGASKAATYLLSILC 198

Query: 180 KDESCGVLLPIPQYPLYTAAVTLQKSKLLPYYLNESNNWSTDPKQIEQIVIDAIKQNIKP 239
           +D S G+++PIPQYPLYTA++T+  S +LPYYL+E + WST  ++IEQ VID+IK+ + P
Sbjct: 199 RDSSTGIMIPIPQYPLYTASITMYNSVMLPYYLDEESGWSTKAEEIEQQVIDSIKRGVTP 258

Query: 240 TTLVVINPGNPTGAILTKDSXXXXXXXXXEYGIVIIADEVYQENVYEAFEFHSFKKVLSE 299
             +VVINPGNPTGA+L+ D+         +YGIV++ADEVYQ N+Y+  +FHS KKVL  
Sbjct: 259 RVIVVINPGNPTGAVLSFDTIAQILTIAAKYGIVVLADEVYQNNIYKGVKFHSMKKVLRS 318

Query: 300 LRKNYPS-KYDNVQLASLHSISKGVNGECGQRGGYMEITGFSNDVKKVLLKVASISICSV 358
           L++++P+ +YDNVQLAS+HS SKGV+GECGQRGGYME+ GFSN+V++V+LK+ASISICSV
Sbjct: 319 LQRDHPNGEYDNVQLASMHSTSKGVSGECGQRGGYMELVGFSNEVRQVILKLASISICSV 378

Query: 359 VTGQILVDLMVNPPQPGDESYELDQLERSVIHSNLILKSNTLYDVFTRLPGISCQKPQGA 418
           VTGQ LVDLM+NPP+ GD+SYELD  ER  IH+N+  +   LYD F +L GI CQ+PQGA
Sbjct: 379 VTGQALVDLMLNPPREGDDSYELDVRERKEIHNNMKTRGYLLYDTFQKLEGIECQEPQGA 438

Query: 419 MYLFPRLHLSENAINAATELNLKPDEFYCLKLLENTGICTVPGSGFGQYPGTYHLRTTFL 478
           MYLFP+L LS+ AI  A  L L+PDEFYC +LL+ TGICTVPGSGFGQ  GTYH+RTTFL
Sbjct: 439 MYLFPKLLLSKKAIEEAKSLGLQPDEFYCHRLLDTTGICTVPGSGFGQKEGTYHVRTTFL 498

Query: 479 PPGIEWINSWEKFHLEFMEKYK 500
            PG +WI  WE FH  F +KY+
Sbjct: 499 APGTQWIKDWETFHKAFYDKYR 520

>NCAS0B05020 Chr2 complement(931456..933162) [1707 bp, 568 aa] {ON} 
          Length = 568

 Score =  608 bits (1568), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/498 (59%), Positives = 370/498 (74%), Gaps = 8/498 (1%)

Query: 4   NQKTFLPAPKFSLNDINESILKAEYAIRGTIPNRAEELDIQLLENSKSLPFAKIVYANIG 63
           N   FLPA + +L ++N+++LKA+YA+RG IP RAEEL IQL E+  SLPF  IV ANIG
Sbjct: 77  NHNNFLPADQLTLAELNDNVLKAKYAVRGAIPMRAEELKIQLQEDPSSLPFDHIVNANIG 136

Query: 64  NPQQLDQQPLTFQRQVMSLVQFPDLLKSKDI-LLAQKIYSKDSIERATKLLNSIGGSVGA 122
           NPQQL+Q+PL+F RQV+SL+Q+P++LK  +  L+A  ++ KD++ERA  LL+ IGG+VGA
Sbjct: 137 NPQQLNQKPLSFYRQVLSLLQYPEILKQDESKLVASGLFKKDALERAKTLLHEIGGTVGA 196

Query: 123 YSSSQGVLDIRKNVARFILKRDLHHDPTQDLIDETASNVFLTAGASTAVDHILPLFAKDE 182
           YS+SQGV  IRK VA FI KRD + +P          ++FLTAGAS AV ++L +  K  
Sbjct: 197 YSASQGVYGIRKTVANFITKRD-NGEPAY------PEDIFLTAGASAAVMYLLSILCKGP 249

Query: 183 SCGVLLPIPQYPLYTAAVTLQKSKLLPYYLNESNNWSTDPKQIEQIVIDAIKQNIKPTTL 242
             GVL+PIPQYPLYTA++ L  S  LPYYL+E + WST+PK+IE++V+ A  + I+P+ L
Sbjct: 250 ETGVLIPIPQYPLYTASLALNNSHALPYYLDEKSGWSTNPKEIEEVVLAAKDKKIRPSVL 309

Query: 243 VVINPGNPTGAILTKDSXXXXXXXXXEYGIVIIADEVYQENVYEAFEFHSFKKVLSELRK 302
           VVINPGNPTGA+L++ S         +YGIV+IADEVYQENV+   +FHS KKVL  L+K
Sbjct: 310 VVINPGNPTGAVLSEKSIEHIFEIAAKYGIVVIADEVYQENVFNEVKFHSMKKVLRNLQK 369

Query: 303 NYPSKYDNVQLASLHSISKGVNGECGQRGGYMEITGFSNDVKKVLLKVASISICSVVTGQ 362
            +P  YD VQLASLHS SKGV+GECGQRGGYME+TGF+++V+ V+LK+ASIS+C VVTGQ
Sbjct: 370 KHPGVYDMVQLASLHSTSKGVSGECGQRGGYMELTGFTHEVRSVILKLASISLCPVVTGQ 429

Query: 363 ILVDLMVNPPQPGDESYELDQLERSVIHSNLILKSNTLYDVFTRLPGISCQKPQGAMYLF 422
            LVDLMV+PP+ GDES+E DQ ER  I S L  ++  LY  F  L GI CQKPQGAMYLF
Sbjct: 430 ALVDLMVSPPKKGDESFEQDQAERKHIKSELHTRAMQLYKNFNTLEGIECQKPQGAMYLF 489

Query: 423 PRLHLSENAINAATELNLKPDEFYCLKLLENTGICTVPGSGFGQYPGTYHLRTTFLPPGI 482
           PRL L   A+  A  L + PDEFYC  LLE TGICTVPGSGFGQ PGTYHLRTTFL PG 
Sbjct: 490 PRLDLPFKAVQKAQHLEMSPDEFYCKSLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGT 549

Query: 483 EWINSWEKFHLEFMEKYK 500
           EWI  W+ FH +F   Y+
Sbjct: 550 EWIEKWKIFHQDFYNTYR 567

>KLTH0G13662g Chr7 (1169989..1171548) [1560 bp, 519 aa] {ON} similar
           to uniprot|P52893 Saccharomyces cerevisiae YLR089C ALT1
           putative alanine transaminase (glutamyc pyruvic
           transaminase)
          Length = 519

 Score =  602 bits (1551), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/488 (58%), Positives = 367/488 (75%), Gaps = 8/488 (1%)

Query: 13  KFSLNDINESILKAEYAIRGTIPNRAEELDIQLLENSKSLPFAKIVYANIGNPQQLDQQP 72
           K +L D+N+ +L A+YA+RG IP RAEEL  +L+E   SLPF KI+ ANIGNPQQLDQ+P
Sbjct: 39  KKTLRDVNQCVLNAKYAVRGPIPLRAEELRHKLVEEPGSLPFNKIINANIGNPQQLDQKP 98

Query: 73  LTFQRQVMSLVQFPDLLKSKDILLAQKIYSKDSIERATKLLNSIGGSVGAYSSSQGVLDI 132
           LTF RQV+SL+Q P L++S       K++  D++ERA K+L  +GGSVGAYS+SQGV   
Sbjct: 99  LTFYRQVLSLLQNPALIESLPTGELHKLFKPDAVERAKKMLKQVGGSVGAYSASQGVAGF 158

Query: 133 RKNVARFILKRDLHHDPTQDLIDETASNVFLTAGASTAVDHILPLFAKDESCGVLLPIPQ 192
           R++VA FI +RD   +P       +A+++FLTAGAS+AV  IL +F      G L+PIPQ
Sbjct: 159 RQSVAEFIEERD--GEPA------SANDIFLTAGASSAVSAILSMFCTGSENGALIPIPQ 210

Query: 193 YPLYTAAVTLQKSKLLPYYLNESNNWSTDPKQIEQIVIDAIKQNIKPTTLVVINPGNPTG 252
           YPLYTA + L  +  LPYYL+E++ WS D +Q+EQ+V DAI++ ++PT LVVINPGNPTG
Sbjct: 211 YPLYTATLALNDAHALPYYLDEASGWSMDTEQVEQVVKDAIRKGVRPTCLVVINPGNPTG 270

Query: 253 AILTKDSXXXXXXXXXEYGIVIIADEVYQENVYEAFEFHSFKKVLSELRKNYPSKYDNVQ 312
           AIL+ ++         +Y +V+IADEVYQEN ++  +F S KKVL  L+K  P KYDNVQ
Sbjct: 271 AILSPEAIEKILTVAAKYSLVVIADEVYQENGFDDADFVSMKKVLRVLQKTEPGKYDNVQ 330

Query: 313 LASLHSISKGVNGECGQRGGYMEITGFSNDVKKVLLKVASISICSVVTGQILVDLMVNPP 372
           LASLHS SKGV+GECGQRGGYME+ GFS +VK+V LK+ASIS+C VVTGQ LVDLMV PP
Sbjct: 331 LASLHSTSKGVSGECGQRGGYMELVGFSEEVKQVFLKLASISLCPVVTGQALVDLMVRPP 390

Query: 373 QPGDESYELDQLERSVIHSNLILKSNTLYDVFTRLPGISCQKPQGAMYLFPRLHLSENAI 432
           + GD SYELD+ ER+ IH++L  KS  LY+ F  L G+SCQKPQGAMYLFP+L LS  AI
Sbjct: 391 KKGDASYELDRQERNAIHNSLHQKSTLLYETFQSLEGVSCQKPQGAMYLFPKLDLSRKAI 450

Query: 433 NAATELNLKPDEFYCLKLLENTGICTVPGSGFGQYPGTYHLRTTFLPPGIEWINSWEKFH 492
             A  L + PDE+YC +LLE TGICTVPGSGF Q PGTYHLRTTFL PG EW++SW+KFH
Sbjct: 451 RKAESLGMAPDEYYCKELLEATGICTVPGSGFRQVPGTYHLRTTFLAPGTEWVDSWKKFH 510

Query: 493 LEFMEKYK 500
            +F+++++
Sbjct: 511 QKFVDEHR 518

>NDAI0B01990 Chr2 complement(493160..494926) [1767 bp, 588 aa] {ON}
           Anc_8.263 YDR111C
          Length = 588

 Score =  604 bits (1557), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/496 (58%), Positives = 371/496 (74%), Gaps = 8/496 (1%)

Query: 6   KTFLPAPKFSLNDINESILKAEYAIRGTIPNRAEELDIQLLENSKSLPFAKIVYANIGNP 65
           K F PA + +L D+NE++LKA+YA+RG+IP RAEEL +QL  N  +LPF++IV ANIGNP
Sbjct: 99  KDFAPAEQLTLADLNENVLKAKYAVRGSIPMRAEELKVQLENNPSTLPFSQIVNANIGNP 158

Query: 66  QQLDQQPLTFQRQVMSLVQFPDLLKSKDI-LLAQKIYSKDSIERATKLLNSIGGSVGAYS 124
           QQL Q+PL+F RQV+S++Q+PD+LK  +  L+  K+Y +D+I+RA  LL+ IGGSVGAYS
Sbjct: 159 QQLKQKPLSFYRQVLSILQYPDILKENEQNLIDAKVYKRDAIDRAKLLLSEIGGSVGAYS 218

Query: 125 SSQGVLDIRKNVARFILKRDLHHDPTQDLIDETASNVFLTAGASTAVDHILPLFAKDESC 184
           +SQGV  IRK VA FI +RD   +P          ++FLT        ++L +  +    
Sbjct: 219 ASQGVYGIRKTVANFITERD-GGEPAY------PEDIFLTVWCFRCCCYLLSILCQGPKT 271

Query: 185 GVLLPIPQYPLYTAAVTLQKSKLLPYYLNESNNWSTDPKQIEQIVIDAIKQNIKPTTLVV 244
           GVL+PIPQYPLYTA + L  S  LPYYL+E + WST+PK+IE++V DA+++ I P+ LVV
Sbjct: 272 GVLIPIPQYPLYTATLALNNSHALPYYLDEKSGWSTNPKEIEEVVQDAMERAINPSVLVV 331

Query: 245 INPGNPTGAILTKDSXXXXXXXXXEYGIVIIADEVYQENVYEAFEFHSFKKVLSELRKNY 304
           INPGNPTGA+LT++S         +YGIV+IADEVYQEN+ +  +F+S KKVL +L+K++
Sbjct: 332 INPGNPTGAVLTEESIEHIFEIAAKYGIVVIADEVYQENIADGVKFYSMKKVLRKLQKSH 391

Query: 305 PSKYDNVQLASLHSISKGVNGECGQRGGYMEITGFSNDVKKVLLKVASISICSVVTGQIL 364
           P K+DNVQLASLHS SKGV+GECGQRGGYME+ GF+++V+KV+LK+ASIS+C VVTGQ L
Sbjct: 392 PGKFDNVQLASLHSTSKGVSGECGQRGGYMELIGFTHEVRKVILKLASISLCPVVTGQAL 451

Query: 365 VDLMVNPPQPGDESYELDQLERSVIHSNLILKSNTLYDVFTRLPGISCQKPQGAMYLFPR 424
           VDLMV+PP+ GD SYE DQ ER  I S L ++++ LY+ F  L GI CQKPQGAMYLFP+
Sbjct: 452 VDLMVSPPKKGDASYEQDQAERRHIKSELSIRASQLYETFVGLEGIECQKPQGAMYLFPK 511

Query: 425 LHLSENAINAATELNLKPDEFYCLKLLENTGICTVPGSGFGQYPGTYHLRTTFLPPGIEW 484
           L L   A+  A  L + PDEFYC  LL+ TGICTVPGSGFGQ PGTYHLRTTFL PG EW
Sbjct: 512 LDLPFKAVQEAQHLEMTPDEFYCKSLLDATGICTVPGSGFGQEPGTYHLRTTFLAPGTEW 571

Query: 485 INSWEKFHLEFMEKYK 500
           I  WE FH EF + Y+
Sbjct: 572 IKKWEAFHKEFYDNYR 587

>Suva_2.271 Chr2 complement(472714..474237) [1524 bp, 507 aa] {ON}
           YDR111C (REAL)
          Length = 507

 Score =  600 bits (1546), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/494 (56%), Positives = 368/494 (74%), Gaps = 8/494 (1%)

Query: 8   FLPAPKFSLNDINESILKAEYAIRGTIPNRAEELDIQLLENSKSLPFAKIVYANIGNPQQ 67
           F PA K +  D+N S+ KAEYA+RG IP RAEEL  +L  +S SLPF  I+ ANIGNPQQ
Sbjct: 20  FKPAAKLTKKDLNASVTKAEYAVRGAIPTRAEELKEELKRSSNSLPFNSIINANIGNPQQ 79

Query: 68  LDQQPLTFQRQVMSLVQFPDLLK-SKDILLAQKIYSKDSIERATKLLNSIGGSVGAYSSS 126
           LDQ+PLTF RQV+S++++P++L+   D L +  +++KD+++RA +LL+ IGGSVGAYS S
Sbjct: 80  LDQKPLTFTRQVLSILEYPEILRVDHDKLASLNLFAKDALKRAQRLLDDIGGSVGAYSHS 139

Query: 127 QGVLDIRKNVARFILKRDLHHDPTQDLIDETASNVFLTAGASTAVDHILPLFAKDESCGV 186
           QGV  IR+ VA FI +RD   +P          +++LT GAS+A   +L L  KD   G+
Sbjct: 140 QGVPGIRQTVADFITERD-GGEPA------GPEDIYLTTGASSAATSLLSLLCKDSQTGL 192

Query: 187 LLPIPQYPLYTAAVTLQKSKLLPYYLNESNNWSTDPKQIEQIVIDAIKQNIKPTTLVVIN 246
           LLPIPQYPLYTA+ +L  +++LPYYL+E  +WST+  +IE++V+DA+K+ I+P+ LVVIN
Sbjct: 193 LLPIPQYPLYTASASLYNAQVLPYYLDEEADWSTESDEIERVVLDALKKGIRPSVLVVIN 252

Query: 247 PGNPTGAILTKDSXXXXXXXXXEYGIVIIADEVYQENVYEAFEFHSFKKVLSELRKNYPS 306
           PGNPTGA+LT+++         +YGI II+DEVYQEN++   +FHS KK+L +L+  +P 
Sbjct: 253 PGNPTGAVLTENTIAKICLIAAKYGITIISDEVYQENIFGDVKFHSMKKILRKLQNLHPG 312

Query: 307 KYDNVQLASLHSISKGVNGECGQRGGYMEITGFSNDVKKVLLKVASISICSVVTGQILVD 366
           K+DNVQLASLHSISKG  GECGQRGGYMEI GFS D++  L K+ SISICSV TGQ ++D
Sbjct: 313 KFDNVQLASLHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKLMSISICSVATGQAIID 372

Query: 367 LMVNPPQPGDESYELDQLERSVIHSNLILKSNTLYDVFTRLPGISCQKPQGAMYLFPRLH 426
           LMV PPQPGDESY+ D+ ER  I++ ++ ++N LY+ F  L GI CQKPQGAMYLFP+L 
Sbjct: 373 LMVKPPQPGDESYDQDRKERLKIYNEMLTRANLLYETFNELEGIKCQKPQGAMYLFPKLF 432

Query: 427 LSENAINAATELNLKPDEFYCLKLLENTGICTVPGSGFGQYPGTYHLRTTFLPPGIEWIN 486
           L E A+  +  LN++PD  YC  LLE+TGICTVPGSGFGQ  GTYH+RTTFLPPG +WI 
Sbjct: 433 LPEKALRESERLNIEPDVLYCTSLLESTGICTVPGSGFGQKSGTYHVRTTFLPPGTQWIQ 492

Query: 487 SWEKFHLEFMEKYK 500
            W +FH +F  KY+
Sbjct: 493 DWRQFHQDFFNKYR 506

>Kpol_392.5 s392 (6873..8411) [1539 bp, 512 aa] {ON} (6873..8411)
           [1539 nt, 513 aa]
          Length = 512

 Score =  599 bits (1544), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/491 (59%), Positives = 371/491 (75%), Gaps = 14/491 (2%)

Query: 10  PAPKFSLNDINESILKAEYAIRGTIPNRAEELDIQLLENSKSLPFAKIVYANIGNPQQLD 69
           PA K  ++D+N+++LKA+YA+RG+IP RAEEL +  LE  + LPF  ++ ANIGNPQQL 
Sbjct: 35  PAQKLRMDDLNKNVLKAKYAVRGSIPLRAEELKL-YLEAGQKLPFDTVINANIGNPQQLK 93

Query: 70  QQPLTFQRQVMSLVQFPDLLKSKDILLAQKIYSKDSIERATKLLNSIGGSVGAYSSSQGV 129
           Q+PLTF RQV+S++Q+P+LL+S        I+ KD+IERA KLL  IG SVG+YSSSQG+
Sbjct: 94  QKPLTFYRQVLSILQYPELLES-----GSNIFKKDAIERARKLLKEIG-SVGSYSSSQGI 147

Query: 130 LDIRKNVARFILKRDLHHDPTQDLIDETASNVFLTAGASTAVDHILPLFAKDESCGVLLP 189
             IRK VA FI KRD       D    T +++FLTAGAS+AVD++L +  K+E  GVL+P
Sbjct: 148 PAIRKTVANFITKRD-------DGEISTPNDIFLTAGASSAVDYLLSILCKNEKSGVLIP 200

Query: 190 IPQYPLYTAAVTLQKSKLLPYYLNESNNWSTDPKQIEQIVIDAIKQNIKPTTLVVINPGN 249
           IPQYPLYTA + L  +  LPYYL+ES  WSTD  +IE+++ D++ + IKPT LV+INPGN
Sbjct: 201 IPQYPLYTATLALNNAHALPYYLDESKGWSTDINEIEEVINDSLDKGIKPTALVIINPGN 260

Query: 250 PTGAILTKDSXXXXXXXXXEYGIVIIADEVYQENVYEAFEFHSFKKVLSELRKNYPSKYD 309
           PTG+IL+ +S          +GIVIIADEVYQENV+   +FHS KKVL  L+K +P +YD
Sbjct: 261 PTGSILSVESMEKIIEVAATHGIVIIADEVYQENVFNNAKFHSMKKVLRNLQKAFPGEYD 320

Query: 310 NVQLASLHSISKGVNGECGQRGGYMEITGFSNDVKKVLLKVASISICSVVTGQILVDLMV 369
            VQLASLHS SKGV+GECGQRGGYME+TGF+ ++K+V+LK+ SIS+C VVTGQ LVDLMV
Sbjct: 321 TVQLASLHSTSKGVSGECGQRGGYMELTGFNPEIKQVILKLCSISLCPVVTGQALVDLMV 380

Query: 370 NPPQPGDESYELDQLERSVIHSNLILKSNTLYDVFTRLPGISCQKPQGAMYLFPRLHLSE 429
           +PPQ GDESYE DQLERS I ++L  ++  L++ F  + G+SCQKP+GAMYLFP++ L  
Sbjct: 381 SPPQKGDESYEQDQLERSTILNDLSNRAILLWEAFNSMEGVSCQKPEGAMYLFPKIDLPF 440

Query: 430 NAINAATELNLKPDEFYCLKLLENTGICTVPGSGFGQYPGTYHLRTTFLPPGIEWINSWE 489
             +  + EL++ PDEFYC  LLE TGICTVPGSGFGQ PGTYHLRTTFL PG EWI+ W 
Sbjct: 441 KVLQKSQELDITPDEFYCKALLEATGICTVPGSGFGQQPGTYHLRTTFLAPGTEWIDRWN 500

Query: 490 KFHLEFMEKYK 500
           KFH EF +KY+
Sbjct: 501 KFHAEFYDKYR 511

>Skud_4.372 Chr4 complement(649872..651395) [1524 bp, 507 aa] {ON}
           YDR111C (REAL)
          Length = 507

 Score =  597 bits (1538), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/494 (57%), Positives = 366/494 (74%), Gaps = 8/494 (1%)

Query: 8   FLPAPKFSLNDINESILKAEYAIRGTIPNRAEELDIQLLENSKSLPFAKIVYANIGNPQQ 67
           F PA K +  D+N S+ KAEYA+RG+IP RA+EL  +L +N   LPF  I+ ANIGNPQQ
Sbjct: 20  FKPAAKITKKDLNGSVTKAEYAVRGSIPTRADELKEELKKNPGLLPFDDIINANIGNPQQ 79

Query: 68  LDQQPLTFQRQVMSLVQFPDLLK-SKDILLAQKIYSKDSIERATKLLNSIGGSVGAYSSS 126
           LDQ+PLTF RQV+S++++P++L+   + L +  ++SKD+++RA  LL  IGGSVGAYS S
Sbjct: 80  LDQKPLTFTRQVLSILEYPEILQVDHEKLASLNLFSKDALKRAECLLKDIGGSVGAYSHS 139

Query: 127 QGVLDIRKNVARFILKRDLHHDPTQDLIDETASNVFLTAGASTAVDHILPLFAKDESCGV 186
           QGV  IR+ VA FI  RD   +P       T  +++LT GAS+A   +L L  KD   G+
Sbjct: 140 QGVPGIRQTVADFITARD-GGEPA------TPEDIYLTTGASSAATSLLSLLCKDTRTGL 192

Query: 187 LLPIPQYPLYTAAVTLQKSKLLPYYLNESNNWSTDPKQIEQIVIDAIKQNIKPTTLVVIN 246
           L+PIPQYPLYTA+ +L  +++LPYYL+E  NWST+  +IE++V DA+++ I+P+ L+VIN
Sbjct: 193 LIPIPQYPLYTASASLFNAQVLPYYLDEECNWSTESDEIEKVVQDALEKGIRPSVLIVIN 252

Query: 247 PGNPTGAILTKDSXXXXXXXXXEYGIVIIADEVYQENVYEAFEFHSFKKVLSELRKNYPS 306
           PGNPTGA+LT+++         +YGI +I+DEVYQENV+  F+FHS KKVL +L+  YP 
Sbjct: 253 PGNPTGAVLTEETIARICLIAAKYGIAVISDEVYQENVFNDFKFHSMKKVLRKLQHCYPG 312

Query: 307 KYDNVQLASLHSISKGVNGECGQRGGYMEITGFSNDVKKVLLKVASISICSVVTGQILVD 366
           K+DNVQLASLHSISKG  GECGQRGGYMEI GFS D++  L K+ SISICSVVTGQ +VD
Sbjct: 313 KFDNVQLASLHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKLMSISICSVVTGQAIVD 372

Query: 367 LMVNPPQPGDESYELDQLERSVIHSNLILKSNTLYDVFTRLPGISCQKPQGAMYLFPRLH 426
           LMVNPPQPGDESYE D+ ERS I + +  ++N LY+ F  L GI CQ PQGAMYLFPRL 
Sbjct: 373 LMVNPPQPGDESYEQDRQERSKIFNEMRTRANLLYETFNGLEGIECQNPQGAMYLFPRLI 432

Query: 427 LSENAINAATELNLKPDEFYCLKLLENTGICTVPGSGFGQYPGTYHLRTTFLPPGIEWIN 486
           L + A   +  L ++PDEFYC  LLE+TGICTVPGSGFGQ PGTYH+RTTFL PG +WI 
Sbjct: 433 LPDKAFRESERLGVEPDEFYCASLLESTGICTVPGSGFGQKPGTYHVRTTFLAPGTQWIQ 492

Query: 487 SWEKFHLEFMEKYK 500
           +W+ FH  F  +Y+
Sbjct: 493 NWKNFHQSFFNEYR 506

>Smik_4.357 Chr4 complement(639561..641084) [1524 bp, 507 aa] {ON}
           YDR111C (REAL)
          Length = 507

 Score =  593 bits (1528), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/501 (55%), Positives = 358/501 (71%), Gaps = 8/501 (1%)

Query: 1   MTMNQKTFLPAPKFSLNDINESILKAEYAIRGTIPNRAEELDIQLLENSKSLPFAKIVYA 60
            T     F PA K +  D+N  + KAEYA+RG IP RA+EL  +L      LPF  I+ A
Sbjct: 13  FTTKDLNFKPAAKITKKDLNAGVTKAEYAVRGAIPTRADELKEELKRKPGVLPFDDIINA 72

Query: 61  NIGNPQQLDQQPLTFQRQVMSLVQFPDLLK-SKDILLAQKIYSKDSIERATKLLNSIGGS 119
           NIGNPQQLDQ+PLTF RQV+S++++P++L+   D L +  ++ KD++ RA  LL  IGGS
Sbjct: 73  NIGNPQQLDQKPLTFTRQVLSILEYPEILRVGPDKLASLNLFRKDALGRAEHLLEDIGGS 132

Query: 120 VGAYSSSQGVLDIRKNVARFILKRDLHHDPTQDLIDETASNVFLTAGASTAVDHILPLFA 179
           +GAYS SQGV  IR++VA FI KRD       D       N++LT GAS+A   +L L  
Sbjct: 133 IGAYSHSQGVPGIRQSVAEFITKRD-------DGEPAAPENIYLTTGASSAATSLLSLLC 185

Query: 180 KDESCGVLLPIPQYPLYTAAVTLQKSKLLPYYLNESNNWSTDPKQIEQIVIDAIKQNIKP 239
           KD   G+L+PIPQYPLYTA+ +L  +++LPYYL+E +NWST   +IE++V DA+++ IKP
Sbjct: 186 KDVQTGLLIPIPQYPLYTASASLFNAQVLPYYLDEGSNWSTKSDEIEKVVKDALEKGIKP 245

Query: 240 TTLVVINPGNPTGAILTKDSXXXXXXXXXEYGIVIIADEVYQENVYEAFEFHSFKKVLSE 299
           + L+VINPGNPTGA+L++D+         +YGI II+DEVYQENV+   +FHS KKVL +
Sbjct: 246 SVLIVINPGNPTGAVLSEDTIAKICLIAAKYGIAIISDEVYQENVFNGVKFHSMKKVLRK 305

Query: 300 LRKNYPSKYDNVQLASLHSISKGVNGECGQRGGYMEITGFSNDVKKVLLKVASISICSVV 359
           L++ YP K+DNVQLASLHSISKG  GECGQRGGYME+ GFS D++  L K+ SISICSVV
Sbjct: 306 LQRLYPGKFDNVQLASLHSISKGFMGECGQRGGYMEVVGFSKDIRDALFKLMSISICSVV 365

Query: 360 TGQILVDLMVNPPQPGDESYELDQLERSVIHSNLILKSNTLYDVFTRLPGISCQKPQGAM 419
           TGQ +VDLMV PPQPGDESY+ D  ER  I   +  ++  L++ F  L GI CQKPQGAM
Sbjct: 366 TGQAVVDLMVKPPQPGDESYDQDHSERMKIFHEMYTRATLLHETFNELEGIECQKPQGAM 425

Query: 420 YLFPRLHLSENAINAATELNLKPDEFYCLKLLENTGICTVPGSGFGQYPGTYHLRTTFLP 479
           YLFPRL L E A+  +  L ++PDEFYC  LLE+TGICTVPGSGFGQ PGTYH+RTTFL 
Sbjct: 426 YLFPRLVLPEKALRESERLGIEPDEFYCTSLLESTGICTVPGSGFGQQPGTYHVRTTFLA 485

Query: 480 PGIEWINSWEKFHLEFMEKYK 500
           PG +WI  W+ FH +F  KY+
Sbjct: 486 PGTQWIQDWKHFHQDFFNKYR 506

>YDR111C Chr4 complement(678241..679764) [1524 bp, 507 aa] {ON}
           ALT2Putative alanine transaminase (glutamic pyruvic
           transaminase)
          Length = 507

 Score =  592 bits (1526), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/494 (56%), Positives = 366/494 (74%), Gaps = 8/494 (1%)

Query: 8   FLPAPKFSLNDINESILKAEYAIRGTIPNRAEELDIQLLENSKSLPFAKIVYANIGNPQQ 67
           F PA K +  D+N  + KAEYA+RG IP RA+EL  +L +N + LPF  I+ ANIGNPQQ
Sbjct: 20  FKPAGKITKKDLNTGVTKAEYAVRGAIPTRADELKEELKKNPEVLPFDDIINANIGNPQQ 79

Query: 68  LDQQPLTFQRQVMSLVQFPDLLK-SKDILLAQKIYSKDSIERATKLLNSIGGSVGAYSSS 126
           LDQ+PLTF RQV++++++P++L+   + L +  ++S+D++ERA +LLN IGGS+GAYS S
Sbjct: 80  LDQKPLTFTRQVLAILEYPEILRVGHNELASLNLFSRDALERAERLLNDIGGSIGAYSHS 139

Query: 127 QGVLDIRKNVARFILKRDLHHDPTQDLIDETASNVFLTAGASTAVDHILPLFAKDESCGV 186
           QGV  IR+ VA FI +RD   +P       T  +++LT GAS+A   +L L  KD   G+
Sbjct: 140 QGVPGIRQTVADFITRRD-GGEPA------TPEDIYLTTGASSAATSLLSLLCKDSQTGL 192

Query: 187 LLPIPQYPLYTAAVTLQKSKLLPYYLNESNNWSTDPKQIEQIVIDAIKQNIKPTTLVVIN 246
           L+PIPQYPLYTA+ +L  +++LPYYL+E +NWST+  +IE++V DA+K+ I+P+ L+VIN
Sbjct: 193 LIPIPQYPLYTASASLFNAQVLPYYLDEESNWSTNSDEIEKVVQDALKKQIRPSVLIVIN 252

Query: 247 PGNPTGAILTKDSXXXXXXXXXEYGIVIIADEVYQENVYEAFEFHSFKKVLSELRKNYPS 306
           PGNPTGA+L++++         +YGI II+DEVYQEN++   +FHS KKVL +L+  YP 
Sbjct: 253 PGNPTGAVLSEETIARICLIAAKYGITIISDEVYQENIFNDVKFHSMKKVLRKLQHLYPG 312

Query: 307 KYDNVQLASLHSISKGVNGECGQRGGYMEITGFSNDVKKVLLKVASISICSVVTGQILVD 366
           K+DNVQLASLHSISKG   ECGQRGGYMEI GFS +++  L K+ SISICSVVTGQ +VD
Sbjct: 313 KFDNVQLASLHSISKGFMDECGQRGGYMEIIGFSQEIRDALFKLMSISICSVVTGQAVVD 372

Query: 367 LMVNPPQPGDESYELDQLERSVIHSNLILKSNTLYDVFTRLPGISCQKPQGAMYLFPRLH 426
           LMV PPQPGDESYE D  ER  I   +  ++N LY+ F  L GI CQKPQGAMYLFPRL 
Sbjct: 373 LMVKPPQPGDESYEQDHDERLKIFHEMRTRANLLYETFKELEGIECQKPQGAMYLFPRLV 432

Query: 427 LSENAINAATELNLKPDEFYCLKLLENTGICTVPGSGFGQYPGTYHLRTTFLPPGIEWIN 486
           L + A+  +  L ++PDEFYC  LLE+TGICTVPGSGFGQ PGTYH+RTTFL PG +WI 
Sbjct: 433 LPKKALCESERLGIEPDEFYCTSLLESTGICTVPGSGFGQRPGTYHVRTTFLAPGTKWIQ 492

Query: 487 SWEKFHLEFMEKYK 500
            W++FH +F  KY+
Sbjct: 493 DWKEFHQDFFSKYR 506

>Kwal_56.23791 s56 (706946..708502) [1557 bp, 518 aa] {ON} YLR089C -
           Hypothetical ORF [contig 173] FULL
          Length = 518

 Score =  592 bits (1525), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/488 (59%), Positives = 355/488 (72%), Gaps = 8/488 (1%)

Query: 13  KFSLNDINESILKAEYAIRGTIPNRAEELDIQLLENSKSLPFAKIVYANIGNPQQLDQQP 72
           K +L DINE +L A+YA+RG IP RAEEL  +LLE   SLPF KI+ ANIGNPQQLDQ+P
Sbjct: 38  KKTLQDINECVLNAKYAVRGLIPLRAEELKQKLLEEPGSLPFDKIINANIGNPQQLDQKP 97

Query: 73  LTFQRQVMSLVQFPDLLKSKDILLAQKIYSKDSIERATKLLNSIGGSVGAYSSSQGVLDI 132
           LTF RQV++L+Q PDL+         K +  D++ERA K+L  +GGSVGAYS+SQGV   
Sbjct: 98  LTFYRQVLALLQNPDLISDLSSGELHKFFKPDAVERAKKMLKQVGGSVGAYSNSQGVAGF 157

Query: 133 RKNVARFILKRDLHHDPTQDLIDETASNVFLTAGASTAVDHILPLFAKDESCGVLLPIPQ 192
           R++VA FI +RD   +P       +A ++FLT GAS AV +IL LF      G L+PIPQ
Sbjct: 158 RESVAEFIEERD--GEPA------SAQDIFLTTGASGAVSYILSLFCNGPENGALIPIPQ 209

Query: 193 YPLYTAAVTLQKSKLLPYYLNESNNWSTDPKQIEQIVIDAIKQNIKPTTLVVINPGNPTG 252
           YPLYTA++ L  S  LPYYL+E + WS D +QIE++V D+IK+ I+PT LVVINPGNPTG
Sbjct: 210 YPLYTASLALNNSHALPYYLDEESGWSMDTEQIEKVVQDSIKKGIRPTCLVVINPGNPTG 269

Query: 253 AILTKDSXXXXXXXXXEYGIVIIADEVYQENVYEAFEFHSFKKVLSELRKNYPSKYDNVQ 312
           A+L  D+         +Y +VIIADEVYQEN +   EF S KKVL  L+K  P KYDNVQ
Sbjct: 270 ALLNTDTIENVIKVAAKYSMVIIADEVYQENGFNDAEFVSMKKVLRVLQKTEPGKYDNVQ 329

Query: 313 LASLHSISKGVNGECGQRGGYMEITGFSNDVKKVLLKVASISICSVVTGQILVDLMVNPP 372
           LASLHS SKGV+GECGQRGGYME+ GFS +VK+V LK+ASIS+C VVTGQ L+DLMV PP
Sbjct: 330 LASLHSTSKGVSGECGQRGGYMELVGFSEEVKQVFLKLASISLCPVVTGQALIDLMVRPP 389

Query: 373 QPGDESYELDQLERSVIHSNLILKSNTLYDVFTRLPGISCQKPQGAMYLFPRLHLSENAI 432
           + GD SYE D+ ER  IH  L  +S  LY  F  + G+SCQ+PQGAMYLFP+L LS  AI
Sbjct: 390 KKGDASYEQDRQERCDIHDALHKRSGLLYQAFQSMEGVSCQEPQGAMYLFPKLELSNKAI 449

Query: 433 NAATELNLKPDEFYCLKLLENTGICTVPGSGFGQYPGTYHLRTTFLPPGIEWINSWEKFH 492
           + A    L PDE+YC +LLE TGICTVPGSGFGQ PGT+HLRTTFL PG EWI+SW+KFH
Sbjct: 450 HKAESAGLAPDEYYCKELLEATGICTVPGSGFGQVPGTFHLRTTFLAPGTEWIDSWKKFH 509

Query: 493 LEFMEKYK 500
            +F E ++
Sbjct: 510 EKFTEDHR 517

>KAFR0B02730 Chr2 complement(558858..560477) [1620 bp, 539 aa] {ON}
           Anc_8.263 YDR111C
          Length = 539

 Score =  591 bits (1524), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/493 (59%), Positives = 369/493 (74%), Gaps = 8/493 (1%)

Query: 8   FLPAPKFSLNDINESILKAEYAIRGTIPNRAEELDIQLLENSKSLPFAKIVYANIGNPQQ 67
           F PA + ++ D+NE++LKA+YA+RG IP RAEEL  QL E   SLPF KI+ ANIGNPQQ
Sbjct: 52  FKPAGQLTIGDLNENVLKAKYAVRGKIPTRAEELKRQLAEKPNSLPFDKIINANIGNPQQ 111

Query: 68  LDQQPLTFQRQVMSLVQFPDLLKSKDIL-LAQKIYSKDSIERATKLLNSIGGSVGAYSSS 126
           L QQPL+F RQV+SL+Q+P LL + +    +  +Y KD+I RA K+L  IGGSVGAYS S
Sbjct: 112 LQQQPLSFYRQVLSLLQYPTLLHAIETKPGSSAVYKKDAILRAKKILKDIGGSVGAYSES 171

Query: 127 QGVLDIRKNVARFILKRDLHHDPTQDLIDETASNVFLTAGASTAVDHILPLFAKDESCGV 186
           QGV  IR+ VA FI +RD   +P          ++FLTAGAS AV+++L +  K E  GV
Sbjct: 172 QGVYGIRRTVANFITERD-GGEPAY------PEDIFLTAGASAAVNYLLSILCKGEKTGV 224

Query: 187 LLPIPQYPLYTAAVTLQKSKLLPYYLNESNNWSTDPKQIEQIVIDAIKQNIKPTTLVVIN 246
           L+PIPQYPLYTA + L  S  LPY+L+E N WS +P +IE ++  A++ NIKP  LVVIN
Sbjct: 225 LIPIPQYPLYTATLALNNSHALPYFLDEMNGWSINPIEIENVIKKAVQDNIKPDVLVVIN 284

Query: 247 PGNPTGAILTKDSXXXXXXXXXEYGIVIIADEVYQENVYEAFEFHSFKKVLSELRKNYPS 306
           PGNPTGA+L+K++         +YGIV+IADEVYQEN+++  +FHS K VL  L++  P 
Sbjct: 285 PGNPTGAVLSKEAIVSILEIAAKYGIVVIADEVYQENIFDGMKFHSVKGVLRRLQREIPG 344

Query: 307 KYDNVQLASLHSISKGVNGECGQRGGYMEITGFSNDVKKVLLKVASISICSVVTGQILVD 366
           K+DNVQLASLHS SKGV+GECGQRGGYMEI GF+++V++V+LK+ASIS+C VVTGQ LVD
Sbjct: 345 KFDNVQLASLHSTSKGVSGECGQRGGYMEIIGFTHEVRQVILKLASISLCPVVTGQALVD 404

Query: 367 LMVNPPQPGDESYELDQLERSVIHSNLILKSNTLYDVFTRLPGISCQKPQGAMYLFPRLH 426
           LMV+PP+ G+ES+ LDQ +R  IHS L  ++  L+  F  L GI CQKP GAMYLFP+L+
Sbjct: 405 LMVSPPKRGEESFALDQAQRKTIHSQLSQRAELLWKTFNSLDGIECQKPNGAMYLFPKLN 464

Query: 427 LSENAINAATELNLKPDEFYCLKLLENTGICTVPGSGFGQYPGTYHLRTTFLPPGIEWIN 486
           L   AI  A  L L PDEFYC +LLE+TGICTVPGSGFGQ  GTYHLRTTFL PGIEWI+
Sbjct: 465 LPYRAIQEAQRLELSPDEFYCKELLEHTGICTVPGSGFGQVAGTYHLRTTFLAPGIEWID 524

Query: 487 SWEKFHLEFMEKY 499
           SW++FH+EFMEKY
Sbjct: 525 SWKQFHIEFMEKY 537

>NDAI0J01360 Chr10 (313791..315296) [1506 bp, 501 aa] {ON} Anc_8.263
          Length = 501

 Score =  588 bits (1516), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/497 (55%), Positives = 371/497 (74%), Gaps = 14/497 (2%)

Query: 8   FLPAPKFSLNDINESILKAEYAIRGTIPNRAEELDIQLLENSKSLPFAKIVYANIGNPQQ 67
           F PAPK S+ D+N +++KAE+A+RGTIP +A+EL  QL +N  SLPF +I  ANIGNPQ+
Sbjct: 13  FEPAPKLSIKDLNPNVIKAEFAVRGTIPMKAQELQTQLNKNPHSLPFNEITVANIGNPQE 72

Query: 68  LDQQPLTFQRQVMSLVQFPDLLKSKDILLAQK--IYSKDSIERATKLLNSIGGSVGAYSS 125
           L Q+PLTF RQV+S++Q+P+LL  ++ L +    IY+ DS +RA KLLN IGGSVGAYS+
Sbjct: 73  LHQKPLTFARQVVSILQYPELLNRRNELTSTTPPIYNNDSFDRAEKLLNEIGGSVGAYSA 132

Query: 126 SQGVLDIRKNVARFILKRDLHHDPTQDLIDETAS--NVFLTAGASTAVDHILPLFAKDES 183
           SQGV  IRK +A +I +RDL          E+AS  ++F+T GA+ A  ++L + +    
Sbjct: 133 SQGVYGIRKTIANYITQRDL---------GESASPNDIFMTTGATAASSYLLSILSNGPQ 183

Query: 184 CGVLLPIPQYPLYTAAVTLQKSKLLPYYLNESNNWSTDPKQIEQIVI-DAIKQNIKPTTL 242
            GVLLPIPQYPLYTA + L  + +LPYYL E + WS D  +IE+ +  +A+ + I+P  +
Sbjct: 184 TGVLLPIPQYPLYTALLALHNATMLPYYLEEESGWSIDTNEIEKTIKKNAMTKGIQPKVM 243

Query: 243 VVINPGNPTGAILTKDSXXXXXXXXXEYGIVIIADEVYQENVYEAFEFHSFKKVLSELRK 302
           V+INPGNPTG+IL++DS         +YGIVIIADEVYQEN++   +FHS KKVL  L+K
Sbjct: 244 VIINPGNPTGSILSEDSLIKIFNIAAKYGIVIIADEVYQENLFNGNKFHSCKKVLRSLQK 303

Query: 303 NYPSKYDNVQLASLHSISKGVNGECGQRGGYMEITGFSNDVKKVLLKVASISICSVVTGQ 362
            +P++Y+NVQLASLHS SKG+ GECGQRGGYMEI GF+NDV+ ++LK+A I +C VVTGQ
Sbjct: 304 QFPTQYNNVQLASLHSTSKGLFGECGQRGGYMEIIGFNNDVRNLILKLACIDVCPVVTGQ 363

Query: 363 ILVDLMVNPPQPGDESYELDQLERSVIHSNLILKSNTLYDVFTRLPGISCQKPQGAMYLF 422
            ++DLM+ PP+ GD+SY+LD +ER  IH++++ ++  LYD+F+ + GI CQKPQGAMYLF
Sbjct: 364 AMMDLMILPPKQGDQSYQLDCIERQQIHNDMLNRAKKLYDMFSHMEGIQCQKPQGAMYLF 423

Query: 423 PRLHLSENAINAATELNLKPDEFYCLKLLENTGICTVPGSGFGQYPGTYHLRTTFLPPGI 482
           PRL LS   I+ A +  ++PDEFYC +LL  TGICTVPGSGFGQ P TYHLRTTFL PG 
Sbjct: 424 PRLLLSTKVIDEAKKFEMEPDEFYCHELLNETGICTVPGSGFGQKPNTYHLRTTFLAPGD 483

Query: 483 EWINSWEKFHLEFMEKY 499
           +WIN WEKFH  F+++Y
Sbjct: 484 QWINKWEKFHKAFLKRY 500

>Kpol_543.39 s543 complement(86358..87836) [1479 bp, 492 aa] {ON}
           complement(86358..87836) [1479 nt, 493 aa]
          Length = 492

 Score =  581 bits (1498), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/496 (55%), Positives = 367/496 (73%), Gaps = 9/496 (1%)

Query: 7   TFLPAPKFSLNDINESILKAEYAIRGTIPNRAEELDIQLLENSKSLPFAKIVYANIGNPQ 66
           +F+PA K S+ND+N+  + A+YA+RG+IP RAE+L  Q++ +  SLPF KI+ ANIGNPQ
Sbjct: 2   SFVPAEKLSVNDLNQHAVHADYAVRGSIPMRAEQLHAQIINDPGSLPFDKIITANIGNPQ 61

Query: 67  QLDQQPLTFQRQVMSLVQFPDLLKSKDIL--LAQ-KIYSKDSIERATKLLNSIGGSVGAY 123
           Q+ Q+PLTF RQV+S++++P++L   ++L  L Q  +Y +D IERA K+L+SIGGSVGAY
Sbjct: 62  QVGQKPLTFIRQVLSILEYPNILNDPELLEKLVQLGVYQRDVIERARKMLDSIGGSVGAY 121

Query: 124 SSSQGVLDIRKNVARFILKRDLHHDPTQDLIDETASNVFLTAGASTAVDHILPLFAKDES 183
           S+SQGVL  R+ VA FI KRD      + L   + +++FLT GAS+AV ++L +      
Sbjct: 122 SASQGVLGFRQTVADFINKRD----GCKQL--ASPNDIFLTGGASSAVHYLLSILCSGPE 175

Query: 184 CGVLLPIPQYPLYTAAVTLQKSKLLPYYLNESNNWSTDPKQIEQIVIDAIKQNIKPTTLV 243
            GVL+PIPQYPLYTA +TL  S  +PYYL E  +WST+ K+IE  + +++   +KP  +V
Sbjct: 176 FGVLIPIPQYPLYTATLTLSNSTAIPYYLKEHTSWSTNTKEIEINIKESMANGVKPVAIV 235

Query: 244 VINPGNPTGAILTKDSXXXXXXXXXEYGIVIIADEVYQENVYEAFEFHSFKKVLSELRKN 303
           +INPGNPTGAIL++           +YGI IIADEVYQEN++  FEFHS +KVL  L+  
Sbjct: 236 IINPGNPTGAILSESDLADIIRISAKYGIAIIADEVYQENIFPGFEFHSMRKVLLNLQSE 295

Query: 304 YPSKYDNVQLASLHSISKGVNGECGQRGGYMEITGFSNDVKKVLLKVASISICSVVTGQI 363
           +P  YDNVQLASLHS SKG  GECGQRGGYME+ GF ++V  ++LK+ASISICSVVTGQ 
Sbjct: 296 FPGTYDNVQLASLHSTSKGFIGECGQRGGYMELIGFKDEVIAIVLKLASISICSVVTGQA 355

Query: 364 LVDLMVNPPQPGDESYELDQLERSVIHSNLILKSNTLYDVFTRLPGISCQKPQGAMYLFP 423
           L+DL+  PPQPGD SY+LDQ ER+ I  +L+ +++ LY +FT L G+ CQ+PQGAMYLFP
Sbjct: 356 LMDLVTCPPQPGDASYKLDQEERNKIKQDLMFRADRLYGLFTSLEGVECQRPQGAMYLFP 415

Query: 424 RLHLSENAINAATELNLKPDEFYCLKLLENTGICTVPGSGFGQYPGTYHLRTTFLPPGIE 483
           +L L + AI  A +L + PDE+YC +LL+ TGICTVPGSGFGQ PGTYHLRTTFL PG E
Sbjct: 416 KLILPDKAIEKALQLEIPPDEYYCRELLDATGICTVPGSGFGQDPGTYHLRTTFLVPGTE 475

Query: 484 WINSWEKFHLEFMEKY 499
           WI  W +FH +F E++
Sbjct: 476 WIERWREFHQQFYERF 491

>TPHA0J00750 Chr10 complement(176561..178129) [1569 bp, 522 aa] {ON}
           Anc_8.263 YDR111C
          Length = 522

 Score =  571 bits (1472), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/500 (56%), Positives = 366/500 (73%), Gaps = 7/500 (1%)

Query: 1   MTMNQKTFLPAPKFSLNDINESILKAEYAIRGTIPNRAEELDIQLLENSKSLPFAKIVYA 60
           +++  K F PA K ++ND+NE++LKA+YA+RG IP RAE L  QL++N  SLPF K++ A
Sbjct: 29  ISLKHKNFKPADKLTINDLNENVLKAKYAVRGKIPARAEVLKQQLIDNPSSLPFKKVINA 88

Query: 61  NIGNPQQLDQQPLTFQRQVMSLVQFPDLLKSKDILLAQKIYSKDSIERATKLLNSIGGSV 120
           NIGNPQQL+Q+PLTF RQV+SL+Q+P +L        + +Y +D+IERA ++LN IG SV
Sbjct: 89  NIGNPQQLNQKPLTFYRQVLSLLQYPMVLDETFSGNTKTLYKQDAIERAKRILNDIGSSV 148

Query: 121 GAYSSSQGVLDIRKNVARFILKRDLHHDPTQDLIDETASNVFLTAGASTAVDHILPLFAK 180
           G+YSSSQGV  +RK VA +I +RD             A ++FLTAGAS+AV ++L +  K
Sbjct: 149 GSYSSSQGVFGLRKTVAEYISRRDGGEKAY-------AEDIFLTAGASSAVSYLLNILCK 201

Query: 181 DESCGVLLPIPQYPLYTAAVTLQKSKLLPYYLNESNNWSTDPKQIEQIVIDAIKQNIKPT 240
            +  GVL+PIPQYPLYTA + L  +  LPYYL E++ WST+ ++IE +V +AI++ I P 
Sbjct: 202 GKESGVLIPIPQYPLYTATLALNNTNALPYYLEENSGWSTNMEEIENVVHNAIREKIIPR 261

Query: 241 TLVVINPGNPTGAILTKDSXXXXXXXXXEYGIVIIADEVYQENVYEAFEFHSFKKVLSEL 300
            LVVINPGNPTGAIL+ +S          +GIV+IADEVYQEN++   EFHS KKVL +L
Sbjct: 262 VLVVINPGNPTGAILSVESIEKIFDVAAHHGIVVIADEVYQENIFPGNEFHSMKKVLRDL 321

Query: 301 RKNYPSKYDNVQLASLHSISKGVNGECGQRGGYMEITGFSNDVKKVLLKVASISICSVVT 360
           ++  P KY+NVQLASLHS SKGV+GECGQRGGYME+TGFS ++K  +LK+ SIS+C VVT
Sbjct: 322 QRRVPGKYENVQLASLHSTSKGVSGECGQRGGYMELTGFSTEIKHEILKLCSISLCPVVT 381

Query: 361 GQILVDLMVNPPQPGDESYELDQLERSVIHSNLILKSNTLYDVFTRLPGISCQKPQGAMY 420
           GQ LVDLM  PP+ G+ SYE DQ+ERS IHS L  ++  L+  F  + G+SCQKPQG+MY
Sbjct: 382 GQALVDLMTCPPKKGEASYEQDQMERSTIHSELYERATYLWKAFNEMEGVSCQKPQGSMY 441

Query: 421 LFPRLHLSENAINAATELNLKPDEFYCLKLLENTGICTVPGSGFGQYPGTYHLRTTFLPP 480
           LFP++ +   A+  A EL++ PDE YC +LLE TGICTVPGSGFGQ PGT+HLRTTFL P
Sbjct: 442 LFPKIDIPHKALEKAQELDITPDELYCAELLEATGICTVPGSGFGQKPGTFHLRTTFLAP 501

Query: 481 GIEWINSWEKFHLEFMEKYK 500
           G  WI+ W +FH  F  KY+
Sbjct: 502 GTSWIDQWREFHQIFCNKYR 521

>TBLA0E04440 Chr5 complement(1138820..1140508) [1689 bp, 562 aa]
           {ON} Anc_8.263 YDR111C
          Length = 562

 Score =  571 bits (1471), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 274/499 (54%), Positives = 362/499 (72%), Gaps = 9/499 (1%)

Query: 2   TMNQKTFLPAPKFSLNDINESILKAEYAIRGTIPNRAEELDIQLLENSKSLPFAKIVYAN 61
           T  +K++  A +    D+N +++KA+YA+RG IP+ A++L IQLL++  +LPF  ++ +N
Sbjct: 73  TSREKSYF-AERLEPEDLNPNVVKAKYAVRGAIPSYADKLKIQLLKHPGTLPFESVINSN 131

Query: 62  IGNPQQLDQQPLTFQRQVMSLVQFPDLLKSKDILLAQKIYSKDSIERATKLLNSIGGSVG 121
           IGNPQQL Q+PL+F RQV+S++++P LL  +  L+    Y+ DSIERA  LL  IG S+G
Sbjct: 132 IGNPQQLGQKPLSFGRQVLSILEYPALLDHERTLVDSMGYAPDSIERAKTLLTDIG-SIG 190

Query: 122 AYSSSQGVLDIRKNVARFILKRDLHHDPTQDLIDETASNVFLTAGASTAVDHILPLFAKD 181
           AYS+SQGV  IR+ VA FI  RD       D       ++FLTAGAS+AV  IL +  K 
Sbjct: 191 AYSNSQGVHGIRQTVADFITNRDDGEVAYPD-------DIFLTAGASSAVSTILSILCKG 243

Query: 182 ESCGVLLPIPQYPLYTAAVTLQKSKLLPYYLNESNNWSTDPKQIEQIVIDAIKQNIKPTT 241
           +  GVL+PIPQYPLYTA +TL  +  LPYYL+ESN WSTD  +I ++  D+++  IKPT 
Sbjct: 244 QQTGVLIPIPQYPLYTATLTLNDATALPYYLDESNGWSTDINEISKVAQDSLEAGIKPTC 303

Query: 242 LVVINPGNPTGAILTKDSXXXXXXXXXEYGIVIIADEVYQENVYEAFEFHSFKKVLSELR 301
           LVVINPGNPTG++LT ++         +YG+V+IADEVYQ+N++   EFHS KK+L  L+
Sbjct: 304 LVVINPGNPTGSVLTVEAIKNVFDVAAKYGLVVIADEVYQDNIFPGSEFHSMKKILRILQ 363

Query: 302 KNYPSKYDNVQLASLHSISKGVNGECGQRGGYMEITGFSNDVKKVLLKVASISICSVVTG 361
           K  P+KYDN+QLASLHS SKG+ GECG RGGY E  GF+ +VK+V+ K++SIS+CS V G
Sbjct: 364 KEVPNKYDNIQLASLHSCSKGLLGECGHRGGYCEFIGFTPEVKQVITKLSSISLCSSVIG 423

Query: 362 QILVDLMVNPPQPGDESYELDQLERSVIHSNLILKSNTLYDVFTRLPGISCQKPQGAMYL 421
           Q LVDLM  PP+ G+ SYELDQ ER  I +N   +SN LY++F  L G++CQKPQGAMY+
Sbjct: 424 QALVDLMCCPPKKGEPSYELDQHERQTIRTNHKKRSNKLYEMFNSLEGVTCQKPQGAMYM 483

Query: 422 FPRLHLSENAINAATELNLKPDEFYCLKLLENTGICTVPGSGFGQYPGTYHLRTTFLPPG 481
           FP + L  NAI  A  L++ PDEFYC +LL+ TGICTVPGSGFGQ PGTYH+RTTFL PG
Sbjct: 484 FPNIQLPFNAIKMAQNLDITPDEFYCRELLKATGICTVPGSGFGQQPGTYHVRTTFLAPG 543

Query: 482 IEWINSWEKFHLEFMEKYK 500
           +EW+  WEKFH+EF EKY+
Sbjct: 544 VEWMKRWEKFHIEFFEKYR 562

>TPHA0A01800 Chr1 (364262..365758) [1497 bp, 498 aa] {ON} Anc_8.263
           YDR111C
          Length = 498

 Score =  568 bits (1464), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 274/498 (55%), Positives = 361/498 (72%), Gaps = 14/498 (2%)

Query: 8   FLPAPKFSLNDINESILKAEYAIRGTIPNRAEELDIQLLENSKSLPFAKIVYANIGNPQQ 67
           F P  K +L D+N  I+K +YA+RG IP RAEEL +QL ++ KSLPF KI+ ANIGNPQQ
Sbjct: 9   FTPVAKVTLKDLNSKIIKTQYAVRGPIPARAEELKLQLEKDPKSLPFNKIINANIGNPQQ 68

Query: 68  LDQQPLTFQRQVMSLVQFPDLLKSKD---ILLAQKIYSKDSIERATKLLNSIGGSVGAYS 124
           L Q+PL+F R+V+S++Q+PD+L+ +     L+  ++Y KD + RA KLL  IGGSVGAYS
Sbjct: 69  LGQKPLSFIRKVLSILQYPDILEDESKLQTLIELRVYQKDVVRRARKLLGEIGGSVGAYS 128

Query: 125 SSQGVLDIRKNVARFILKRDLHHDPTQDLIDETA--SNVFLTAGASTAVDHILPLFAKDE 182
            SQGV  I++ VA +I KRD           E A   ++FLT GAS+AV  ILP+F    
Sbjct: 129 LSQGVPGIQQTVADYITKRDS---------GEVAYPEDIFLTTGASSAVSFILPMFCNGP 179

Query: 183 SCGVLLPIPQYPLYTAAVTLQKSKLLPYYLNESNNWSTDPKQIEQIVIDAIKQNIKPTTL 242
           + GVL+PIPQYPLYTA +TL  +  + YYLNE +NWS +  ++E  + ++IK  IKPTT+
Sbjct: 180 TTGVLIPIPQYPLYTATITLVGATAISYYLNEEDNWSVNTVEMENTIQESIKSGIKPTTI 239

Query: 243 VVINPGNPTGAILTKDSXXXXXXXXXEYGIVIIADEVYQENVYEAFEFHSFKKVLSELRK 302
           V+INPGNPTG+ILT+           +YG++IIADEVYQENV+   EFHS KKVL +L++
Sbjct: 240 VIINPGNPTGSILTEKDIANIIRISAKYGLLIIADEVYQENVFSGNEFHSVKKVLRKLQR 299

Query: 303 NYPSKYDNVQLASLHSISKGVNGECGQRGGYMEITGFSNDVKKVLLKVASISICSVVTGQ 362
            Y   Y+ VQLASLHS SKG+ GECGQRGGYME+ G ++DV+  ++K+ SISICSVVTGQ
Sbjct: 300 KYLGFYETVQLASLHSTSKGLIGECGQRGGYMELIGLTDDVRLEVVKLMSISICSVVTGQ 359

Query: 363 ILVDLMVNPPQPGDESYELDQLERSVIHSNLILKSNTLYDVFTRLPGISCQKPQGAMYLF 422
            L+D++V+PP+PGDESYE+DQLER+ I ++LI +S  L+ +F  L G+ C +PQGAMYLF
Sbjct: 360 ALIDMVVSPPRPGDESYEMDQLERNNIKNDLISRSQKLHQLFISLEGVECLRPQGAMYLF 419

Query: 423 PRLHLSENAINAATELNLKPDEFYCLKLLENTGICTVPGSGFGQYPGTYHLRTTFLPPGI 482
           P+    +  I+ A +L+ + D  YC +LLE+TGICTVPGSGFGQ P TYHLRTTFL PG 
Sbjct: 420 PKFIFPQKFIDIAQKLHTEADTLYCKELLEHTGICTVPGSGFGQKPNTYHLRTTFLVPGD 479

Query: 483 EWINSWEKFHLEFMEKYK 500
            WI+ W KFH EF E+Y+
Sbjct: 480 SWIDLWRKFHTEFCERYR 497

>Ecym_4307 Chr4 (652209..653813) [1605 bp, 534 aa] {ON} similar to
           Ashbya gossypii AGR085W
          Length = 534

 Score =  555 bits (1429), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 266/493 (53%), Positives = 352/493 (71%), Gaps = 9/493 (1%)

Query: 8   FLPAPKFSLNDINESILKAEYAIRGTIPNRAEELDIQLLENSKSLPFAKIVYANIGNPQQ 67
           F P     L D+N ++L+A+YA+RG IP RA EL+ QL  +  SLPF KI+YANIGNPQQ
Sbjct: 50  FEPGDPLKLEDLNSNVLEAKYAVRGKIPARAMELERQLSRDPDSLPFKKIIYANIGNPQQ 109

Query: 68  LDQQPLTFQRQVMSLVQFPDLLKSKDILLAQKIYSKDSIERATKLLNSIGGSVGAYSSSQ 127
           L Q+PL+F R+V+SL++ P+LL+    +L   IY  D++ RA +++  +  S+GAYS SQ
Sbjct: 110 LGQKPLSFSREVLSLLESPNLLQMPMEVL-NLIYKPDAVRRAKRMMRDLQTSIGAYSHSQ 168

Query: 128 GVLDIRKNVARFILKRDLHHDPTQDLIDETASNVFLTAGASTAVDHILPLFAKDESCGVL 187
           GVL  RK VA ++  RD   +P       +A ++FLT GAS     ++ L  K +  GVL
Sbjct: 169 GVLGFRKTVAEYLSSRD--GEPA------SAEDIFLTTGASNGASLMIELLCKGQESGVL 220

Query: 188 LPIPQYPLYTAAVTLQKSKLLPYYLNESNNWSTDPKQIEQIVIDAIKQNIKPTTLVVINP 247
           +PIPQYPLYTA +TL  +  LPYYL+E + WS +   +E+I+I++I++ +KP  LVVINP
Sbjct: 221 IPIPQYPLYTATITLNNTVALPYYLDEESGWSLNIDDLERIIIESIEKGVKPACLVVINP 280

Query: 248 GNPTGAILTKDSXXXXXXXXXEYGIVIIADEVYQENVYEAFEFHSFKKVLSELRKNYPSK 307
           GNPTGAIL  +S         +Y IV+IADEVYQENV+E  +F+S KKVL  L++ Y   
Sbjct: 281 GNPTGAILPVESMERIFVIAAKYSIVVIADEVYQENVFEGLKFYSMKKVLRSLQRRYKEL 340

Query: 308 YDNVQLASLHSISKGVNGECGQRGGYMEITGFSNDVKKVLLKVASISICSVVTGQILVDL 367
           + NVQL SLHS SKG++GECGQRGGYME+ GFS+D+++V+LK+ASI +CS V GQ LVDL
Sbjct: 341 FSNVQLVSLHSTSKGLSGECGQRGGYMELVGFSDDIREVILKMASIQLCSPVGGQALVDL 400

Query: 368 MVNPPQPGDESYELDQLERSVIHSNLILKSNTLYDVFTRLPGISCQKPQGAMYLFPRLHL 427
           M++ P+PGDESYE D  ERS I + L  +S +L++ F  L G+ C+KPQG+MYLFPRL L
Sbjct: 401 MLSRPKPGDESYERDLSERSSIRNALQERSKSLWETFNNLEGVECRKPQGSMYLFPRLVL 460

Query: 428 SENAINAATELNLKPDEFYCLKLLENTGICTVPGSGFGQYPGTYHLRTTFLPPGIEWINS 487
            + AI AA  L+++PDEFYC +LL +TGICTVPGSGFGQ P T HLRTTFL PG EWI S
Sbjct: 461 PQKAIKAAESLDMQPDEFYCTELLNSTGICTVPGSGFGQAPDTCHLRTTFLCPGTEWIES 520

Query: 488 WEKFHLEFMEKYK 500
           WE FH  F +KY+
Sbjct: 521 WELFHKSFYDKYR 533

>AGR085W Chr7 (887023..888588) [1566 bp, 521 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR089C (ALT1) and
           YDR111C (ALT2)
          Length = 521

 Score =  553 bits (1425), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 273/493 (55%), Positives = 353/493 (71%), Gaps = 9/493 (1%)

Query: 8   FLPAPKFSLNDINESILKAEYAIRGTIPNRAEELDIQLLENSKSLPFAKIVYANIGNPQQ 67
           F+PA   +L D+NE+++KA+YA+RG IP RAEEL+ +L E+  SLPF+KI+ ANIGNPQQ
Sbjct: 37  FVPAEPMTLADVNENVVKAKYAVRGKIPTRAEELERRLEEHPGSLPFSKIIQANIGNPQQ 96

Query: 68  LDQQPLTFQRQVMSLVQFPDLLKSKDILLAQKIYSKDSIERATKLLNSIGGSVGAYSSSQ 127
           L Q+PLTF RQV+SL+Q P LL+     L Q+ +  D + RA ++L   GGSVGAYS+SQ
Sbjct: 97  LGQKPLTFYRQVISLMQNPQLLEMPAEWL-QQAFKADVVVRARRMLQDAGGSVGAYSASQ 155

Query: 128 GVLDIRKNVARFILKRDLHHDPTQDLIDETASNVFLTAGASTAVDHILPLFAKDESCGVL 187
           GV   R+ VA+FI +RD         I     NV+LTAGAS+AV  +L  F K    GVL
Sbjct: 156 GVKGYRRTVAQFIERRDG--------IPANPDNVYLTAGASSAVSCLLSTFCKGPETGVL 207

Query: 188 LPIPQYPLYTAAVTLQKSKLLPYYLNESNNWSTDPKQIEQIVIDAIKQNIKPTTLVVINP 247
           +PIPQYPLYTA +T   +  LPYYLNE++ WST+P ++E++++D+ K+NI P  LVVINP
Sbjct: 208 IPIPQYPLYTATITQNNAVALPYYLNEADGWSTNPDEMERVILDSKKRNIAPKCLVVINP 267

Query: 248 GNPTGAILTKDSXXXXXXXXXEYGIVIIADEVYQENVYEAFEFHSFKKVLSELRKNYPSK 307
           GNPTG++L+            +YGIV+IADEVYQ+NV+   +FHS +KVL  L+   P+ 
Sbjct: 268 GNPTGSVLSVKDMEAILTLAAKYGIVVIADEVYQDNVFGDAKFHSMRKVLKNLQLREPTL 327

Query: 308 YDNVQLASLHSISKGVNGECGQRGGYMEITGFSNDVKKVLLKVASISICSVVTGQILVDL 367
           Y NVQLASLHSISKG++GECGQRGGYME+ GF  +++KV +K+ASIS+C VVTGQ LVDL
Sbjct: 328 YKNVQLASLHSISKGLSGECGQRGGYMELIGFREELRKVFVKLASISLCPVVTGQALVDL 387

Query: 368 MVNPPQPGDESYELDQLERSVIHSNLILKSNTLYDVFTRLPGISCQKPQGAMYLFPRLHL 427
           MV PP  GD SYE    E   I+  L  +S  L+  F  L GI C  PQGA+YLFP+LHL
Sbjct: 388 MVGPPSQGDPSYEQYTQETRSIYHELEERSQLLWKTFCSLEGIECNMPQGALYLFPKLHL 447

Query: 428 SENAINAATELNLKPDEFYCLKLLENTGICTVPGSGFGQYPGTYHLRTTFLPPGIEWINS 487
            + AI AA +L +  DE YC +LL+ TGICTVPG+GFGQ PGTYH+RTTFLPPG +WI S
Sbjct: 448 PQKAIEAAQKLGIPADELYCSELLDETGICTVPGTGFGQIPGTYHVRTTFLPPGTKWIES 507

Query: 488 WEKFHLEFMEKYK 500
           W+ FH +F +KY+
Sbjct: 508 WKDFHKKFYDKYR 520

>Ecym_6292 Chr6 (547563..548855) [1293 bp, 430 aa] {ON} similar to
           Ashbya gossypii AEL170C
          Length = 430

 Score = 44.3 bits (103), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 65/262 (24%), Positives = 102/262 (38%), Gaps = 45/262 (17%)

Query: 214 ESNNWSTDPKQIEQIVIDAIKQNIKPTTLVVINPGNPTGAILTKDSXXXXXXXXXEYGIV 273
           E+N+W  D + +     D  K       +++ NP NP G +  +D            G  
Sbjct: 163 EANDWILDRETLRAAFTDKTK------LMIINNPNNPLGKVFNRDELLEMATLCVNNGAY 216

Query: 274 IIADEVYQENVYEAFEFHSFKKVLSELRKNYPSKYDNVQLA-SLHSISKGVNGE----CG 328
           IIADEVY        EF  F         N  S+  N+  A +  +I+ G  G+     G
Sbjct: 217 IIADEVY--------EFLQFT-------PNPLSRISNLSEAIAQKTITIGSAGKIFRVTG 261

Query: 329 QRGGYMEITGFSNDVKKVLLKVASISICSVVTGQILVDLMVNPPQPGDESYEL---DQLE 385
            R G+M I+     V+KV      +  CS    Q+   L +   +  +  Y L   ++ +
Sbjct: 262 WRVGWM-ISKNRELVEKVTAVHVRMGFCSPSISQVASGLGIQ--RALECGYFLSMPNEFD 318

Query: 386 RSVIHSNLILKSNTLYDVFTRLPGISCQKPQGAMYL---FPRLHLSENAINAATELNLKP 442
           R         K + +Y     L G+S  KPQGA ++   F ++ + E+        N   
Sbjct: 319 R---------KFSIIYKALDYL-GVSYTKPQGAHFIITDFSKVKIPEDYQFPEYLKNRAR 368

Query: 443 DEFYCLKLLENTGICTVPGSGF 464
           D F    L +   I  +P S F
Sbjct: 369 DFFISYWLTQEFCILLLPCSEF 390

>AEL170C Chr5 complement(318032..319408) [1377 bp, 458 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL060W
           (BNA3)
          Length = 458

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 54/214 (25%), Positives = 83/214 (38%), Gaps = 35/214 (16%)

Query: 155 DETASNVFLTAGASTAVDHILP-LFAKDESCGVLLP-----IPQYPLYTAAVT---LQKS 205
           D  A NV +T GA+  +   L  L    +   V  P     IP   L    V    ++  
Sbjct: 126 DLAAENVQVTTGANEGIFACLAGLVNPGDEVIVFEPFFDQYIPNIELLGGVVRYVPIRPP 185

Query: 206 KLLPYYLNESNNWSTDPKQIEQIVIDAIKQNIKPTTLVVINPGNPTGAILTKDSXXXXXX 265
             L   + E   W  D   + Q +      N K   +++ +P NP G + T++       
Sbjct: 186 AELSKRVTEGTEWVIDYDMLRQTI------NEKTKAVIINSPHNPIGKVFTREELLKLGN 239

Query: 266 XXXEYGIVIIADEVYQENVYEAFEFHSFKKVLSELRKNYPSKYDNVQLASLHSISKGVNG 325
              E GI II+DEVY E++Y   EF     +  E+              S H+++ G  G
Sbjct: 240 ICVEKGIYIISDEVY-EHLYFTDEFTRIATLSEEI--------------SQHTLTVGSAG 284

Query: 326 ECGQRGGYMEITGFSNDVKKVLLKVAS---ISIC 356
           +     G+    G+     K LL +AS   + IC
Sbjct: 285 KSFAATGWR--IGWVISRNKELLALASKAHVRIC 316

>NCAS0A09200 Chr1 complement(1819134..1820471) [1338 bp, 445 aa]
           {ON} Anc_1.321 YJL060W
          Length = 445

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 73/321 (22%), Positives = 126/321 (39%), Gaps = 47/321 (14%)

Query: 160 NVFLTAGASTAVDHILP--LFAKDESCGVLLPIPQYPLYTAAVTLQKSKLLPYYLN---- 213
           NV +T GA+  +   L   L A DE   V++  P +  Y + + L   K++   +N    
Sbjct: 118 NVTITTGANEGILSCLMGLLNAGDE---VIVFEPFFDQYISNIELMGGKIVYVPINPPKE 174

Query: 214 ------ESNNWSTDPKQIEQIVIDAIKQNIKPTTLVVIN-PGNPTGAILTKDSXXXXXXX 266
                 E   W+ D +Q +  +    K        V+IN P NP G + T++        
Sbjct: 175 LDQRVTEGTEWTVDMEQFKNAITSKTKA-------VIINTPHNPIGKVFTREELLQIGNI 227

Query: 267 XXEYGIVIIADEVYQENVYEAFEFHSFKKVLSELRKNYPSKYDNVQLASLHSISKGVNGE 326
             E  ++II+DEVY E++Y   EF     +  E+           QL      +      
Sbjct: 228 CVEKNVIIISDEVY-EHLYFTDEFTRIATLSPEIG----------QLTLTVGSAGKTFAA 276

Query: 327 CGQRGGYMEITGFSNDVKKVLLKVASISICSVVTGQILVDLMVNPPQPGDESYELDQLER 386
            G R G+  +   ++++ + + K A   IC   +   L +   N      ES   +++ +
Sbjct: 277 TGWRIGW--VISLNSELLQYVSK-AHTRIC-FASPSPLQEACANSINDALESNYFEKMRQ 332

Query: 387 SVIHSNLILKSNTLYDVFTRLPGISCQKPQGAMYL---FPRLHLSENAINAATELNLKPD 443
             I    I  S     VF  L G+   KP+G  ++   F ++ + E+       LN   D
Sbjct: 333 EYIQKFKIFTS-----VFEEL-GLPYTKPEGTYFVLADFSKVKIPEDYPYPKEILNKGKD 386

Query: 444 EFYCLKLLENTGICTVPGSGF 464
                 L+   G+  +P + F
Sbjct: 387 FRISHWLINELGVVAIPPTEF 407

>ADL249W Chr4 (261227..262390) [1164 bp, 387 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL116W (HIS5)
          Length = 387

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 49/179 (27%), Positives = 80/179 (44%), Gaps = 23/179 (12%)

Query: 157 TASNVFLTAGASTAVDHILPLFAKDESCGVLLPIPQYPLYTAAVTLQKSKLLPYYLNESN 216
           TA N+ L  G+  ++D I+          V+L  P Y +Y     +     +   L  S+
Sbjct: 86  TAKNICLGVGSDESIDAIIRATCSPREQKVMLLPPTYGMYKVCADINDVGYVEVPLISSD 145

Query: 217 N-WSTDPKQI-EQIVIDAIKQNIKPTTLVVINPGNPTGAILTKDSXXXXXXXXXEYGIVI 274
           N +  D  +I EQ+ +D   ++IK   + + +PGNPTGA + +             GIV+
Sbjct: 146 NSFQIDEDRILEQLNLD---KSIK--VVFITSPGNPTGACI-EVGRVEKLLRNWTAGIVV 199

Query: 275 IADEVYQENVYEAFEFHSFKKVLSELRKNYPSKYDNVQLASLHSISKGVNGECGQRGGY 333
           + DE Y        +F + K  LS L   +P+      L  L ++SK  +G  G R G+
Sbjct: 200 V-DEAY-------IDFSADKPSLSPLVNKHPN------LVVLQTLSKA-SGLAGIRLGF 243

>Suva_6.136 Chr6 complement(227366..228700) [1335 bp, 444 aa] {ON}
           YJL060W (REAL)
          Length = 444

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 39/137 (28%), Positives = 62/137 (45%), Gaps = 23/137 (16%)

Query: 158 ASNVFLTAGASTAVDHILP--LFAKDESCGVLLPIPQYPLYTAAVTLQKSKLL------P 209
           A NV +T GA+  +   L   L + DE   V++  P +  Y   + L   K++      P
Sbjct: 115 AENVVVTTGANEGILSCLMGLLNSGDE---VIVFEPFFDQYIPNIELCGGKVVYVPINPP 171

Query: 210 YYLNESNN----WSTDPKQIEQIVIDAIKQNIKPTTLVVIN-PGNPTGAILTKDSXXXXX 264
             L++ N     W+ D +Q E+ +    K        V+IN P NP G + T D      
Sbjct: 172 KELDQRNTRGEEWTIDFEQFEKAITSKTKA-------VIINTPNNPIGKVFTHDELTTLG 224

Query: 265 XXXXEYGIVIIADEVYQ 281
               ++ +VII+DEVY+
Sbjct: 225 NICVKHNVVIISDEVYE 241

>YJL060W Chr10 (323386..324720) [1335 bp, 444 aa] {ON}
           BNA3Kynurenine aminotransferase, catalyzes formation of
           kynurenic acid from kynurenine; potential Cdc28p
           substrate
          Length = 444

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 39/137 (28%), Positives = 63/137 (45%), Gaps = 23/137 (16%)

Query: 158 ASNVFLTAGASTAVDHILP--LFAKDESCGVLLPIPQYPLYTAAVTLQKSKLL------P 209
           A NV +T GA+  +   L   L A DE   V++  P +  Y   + L   K++      P
Sbjct: 115 AENVTVTTGANEGILSCLMGLLNAGDE---VIVFEPFFDQYIPNIELCGGKVVYVPINPP 171

Query: 210 YYLNESNN----WSTDPKQIEQIVIDAIKQNIKPTTLVVIN-PGNPTGAILTKDSXXXXX 264
             L++ N     W+ D +Q E+ +    K        V+IN P NP G + T++      
Sbjct: 172 KELDQRNTRGEEWTIDFEQFEKAITSKTKA-------VIINTPHNPIGKVFTREELTTLG 224

Query: 265 XXXXEYGIVIIADEVYQ 281
               ++ +VII+DEVY+
Sbjct: 225 NICVKHNVVIISDEVYE 241

>TPHA0O01450 Chr15 complement(291591..292922) [1332 bp, 443 aa] {ON}
           Anc_1.321 YJL060W
          Length = 443

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 33/140 (23%), Positives = 63/140 (45%), Gaps = 16/140 (11%)

Query: 160 NVFLTAGASTAV-DHILPLFAKDESCGVLLP-----IPQYPLYTAAVT---LQKSKLLPY 210
           NV +T GA+  +   ++ +  +++   V  P     IP   L    V    +   K L  
Sbjct: 116 NVLVTTGANEGILACLMGILNQNDEVIVFEPFFDQYIPNIELCGGKVVYVPINPPKDLDK 175

Query: 211 YLNESNNWSTDPKQIEQIVIDAIKQNIKPTTLVVINPGNPTGAILTKDSXXXXXXXXXEY 270
            + +   W+ D +Q E ++ +  K       +++  P NP G + T++          ++
Sbjct: 176 RVTKGTEWTLDFEQFENVITNKTK------AIIINTPHNPIGKVFTREELKRIGDICVKH 229

Query: 271 GIVIIADEVYQENVYEAFEF 290
            ++II+DEVY +N+Y   EF
Sbjct: 230 NVIIISDEVY-DNLYFVDEF 248

>KLTH0H10648g Chr8 complement(919601..920932) [1332 bp, 443 aa] {ON}
           highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase involved in
           biosynthesis of nicotinic acid from tryptophan via
           kynurenine pathway potential Cdc28p substrate
          Length = 443

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 87/393 (22%), Positives = 158/393 (40%), Gaps = 56/393 (14%)

Query: 90  KSKDIL-LAQKIYSKDS----IERATKLLNSIGGSVGAYSSSQGVLDIRKNVARFILKRD 144
           K +D++ L Q  +S       +E A K L+     V  YS ++G + +  ++ +      
Sbjct: 51  KGRDLINLGQGFFSYSPPAFVVEEAQKALDD--AMVNQYSPTKGRMSLINSLIK------ 102

Query: 145 LHHDPTQDLIDETASNVFLTAGASTAVDHILP--LFAKDESCGVLLPIPQYPLYTAAVTL 202
             + P  +     A+N+ +T GA+  +   L   L   DE   V++  P +  Y + + +
Sbjct: 103 -QYSPLYN-TQLQANNIQVTTGANEGILACLVGLLNPGDE---VIVFEPFFDQYISNIQI 157

Query: 203 QKSKLLPYYLNESNNWSTDPKQIEQIVID--AIKQNIKPTT--LVVINPGNPTGAILTKD 258
              K+    L+     S  P +  +  +D   ++  I P T  L++  P NP G + T++
Sbjct: 158 PGGKVTYVPLHPPKEMSVRPTEGTEWTVDYDELRAAITPKTKALILNTPHNPVGKVFTRE 217

Query: 259 SXXXXXXXXXEYGIVIIADEVYQENVYEAFEFHSFKKVLSELRKNYPSKYDNVQLASLHS 318
                     E  +VII+DEVY E++Y   EF     +  E+ +               +
Sbjct: 218 ELLQIGQICVENNVVIISDEVY-EHLYFTPEFTRVATLSPEIGQ--------------IT 262

Query: 319 ISKGVNGECGQRGGYMEITGFSNDVKKVLLKVASIS---ICSVVTGQILVDLMVNPPQPG 375
           ++ G  G+     G+    G+   +   LL+ AS++   IC      +        P   
Sbjct: 263 LTIGSAGKSFAATGWR--IGWIVSLNPELLEYASMAHTRICFASPSPLQEACANALPIAL 320

Query: 376 DESYELDQLERSVIHSNLILKSNTLYDVFTRLPGISCQKPQGAMYL---FPRLHLSENAI 432
           D  Y   ++    IH     K N    VF  L G+   KP+G  ++   F ++ + E+  
Sbjct: 321 DNGY-FKKMREEYIH-----KFNIFTRVFDEL-GLPYTKPEGTYFVLVDFSKVKIPED-Y 372

Query: 433 NAATELNLKPDEF-YCLKLLENTGICTVPGSGF 464
               EL  K  +F     L+   G+  +P + F
Sbjct: 373 PFPEELRSKAKDFRISYWLINELGVVAIPPTEF 405

>Smik_10.180 Chr10 (315030..316364) [1335 bp, 444 aa] {ON} YJL060W
           (REAL)
          Length = 444

 Score = 41.2 bits (95), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 39/140 (27%), Positives = 64/140 (45%), Gaps = 23/140 (16%)

Query: 155 DETASNVFLTAGASTAVDHILP--LFAKDESCGVLLPIPQYPLYTAAVTLQKSKLL---- 208
           D T  NV +T GA+  +   L   L A DE   V++  P +  Y + + L   K++    
Sbjct: 112 DLTTENVTVTTGANEGILSCLMGLLNAGDE---VIVFEPFFDQYISNIELCGGKVVYVPI 168

Query: 209 --PYYLNESNN----WSTDPKQIEQIVIDAIKQNIKPTTLVVIN-PGNPTGAILTKDSXX 261
             P  L+  N     W+ D +Q E+ +    K        V+IN P NP G + T++   
Sbjct: 169 NPPKELDLRNTRGEEWTIDFEQFEKAITPKTKA-------VIINTPHNPIGKVFTREELT 221

Query: 262 XXXXXXXEYGIVIIADEVYQ 281
                  ++ ++II+DEVY+
Sbjct: 222 TLGNICVKHNVIIISDEVYE 241

>Skud_10.156 Chr10 complement(294149..295531) [1383 bp, 460 aa] {ON}
           YJL060W (REAL)
          Length = 460

 Score = 40.4 bits (93), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 41/148 (27%), Positives = 66/148 (44%), Gaps = 24/148 (16%)

Query: 147 HDPTQDLIDETASNVFLTAGASTAVDHILP--LFAKDESCGVLLPIPQYPLYTAAVTLQK 204
           + P  D  D  A NV +T GA+  +   L   L + DE   V++  P +  Y   + L  
Sbjct: 121 YSPIYD-TDLRAENVTVTTGANEGILSCLMGLLNSGDE---VIVFEPFFDQYIPNIELCG 176

Query: 205 SKLL------PYYLNESNN----WSTDPKQIEQIVIDAIKQNIKPTTLVVIN-PGNPTGA 253
            K++      P  L++ N     W+ D +Q E  +    K        V+IN P NP G 
Sbjct: 177 GKVVYVPINPPKELDQRNTKGEEWTIDFEQFENAITSKTKA-------VIINTPHNPIGK 229

Query: 254 ILTKDSXXXXXXXXXEYGIVIIADEVYQ 281
           + T++          ++ +VII+DEVY+
Sbjct: 230 VFTREELTTLGNICVKHNVVIISDEVYE 257

>KLTH0G09614g Chr7 (804939..806108) [1170 bp, 389 aa] {ON} similar
           to uniprot|P07172 Saccharomyces cerevisiae YIL116W HIS5
           Histidinol-phosphate aminotransferase catalyzes the
           seventh step in histidine biosynthesis responsive to
           general control of amino acid biosynthesis mutations
           cause histidine auxotrophy and sensitivity to Cu Co and
           Ni salts
          Length = 389

 Score = 40.4 bits (93), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 50/193 (25%), Positives = 84/193 (43%), Gaps = 26/193 (13%)

Query: 157 TASNVFLTAGASTAVDHILPLFAKDESCGVLLPIPQYPLYTAAVTLQKSKLL--PYYLNE 214
           +A N+ L  G+  ++D ++          +L+  P Y +Y+    +   +++  P  + +
Sbjct: 86  SADNLCLGVGSDESIDALIRACCVPGKDKILIMTPTYGMYSICADINDVEIIKVPLIVED 145

Query: 215 SNNWSTDPKQIEQIVIDAIKQNIKPTTLVVINPGNPTGAILTKDSXXXXXXXXXEYGIVI 274
           ++      K IE +  D+   NIK     V +PGNPTGA++   S         + GIV 
Sbjct: 146 NSFQMNTDKVIETLQGDS---NIK--IAFVTSPGNPTGALIDIAS-IEKILSQWQSGIVA 199

Query: 275 IADEVYQENVYEAFEFHSFKKVLSELRKNYPSKYDNVQLASLHSISKGVNGECGQRGGYM 334
           I DE Y        +F S     + L   YP+      LA L ++SK      G  G  +
Sbjct: 200 I-DEAY-------IDFCSTGGSAAPLVNKYPN------LAVLQTLSKSF----GLAGVRL 241

Query: 335 EITGFSNDVKKVL 347
            +T  S D+ +VL
Sbjct: 242 GVTFTSKDLSRVL 254

>KLLA0F10021g Chr6 (926569..928062) [1494 bp, 497 aa] {ON} similar
           to uniprot|P53090 Saccharomyces cerevisiae YGL202W ARO8
           Aromatic aminotransferase expression is regulated by
           general control of amino acid biosynthesis
          Length = 497

 Score = 40.4 bits (93), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 78/356 (21%), Positives = 137/356 (38%), Gaps = 33/356 (9%)

Query: 123 YSSSQGVLDIRKNVARFILKRDLHHDPTQDLIDETASNVFLTAGASTAVDHILPLFAKDE 182
           Y  SQG  +I K           HH    D+  E   +V  T G + A + +L +F  + 
Sbjct: 105 YGYSQGQPEITKFFKE-------HHSLIHDMKYENW-DVLATIGNTGAWESVLRIFC-NR 155

Query: 183 SCGVLLPIPQYPLYTAAVTLQKSKLLPYYLNESNNWSTDPKQIEQIVIDAIKQNIKPTTL 242
              +L     +    +A   Q   + P  L+E       P ++E I+ +  +   KP  L
Sbjct: 156 GDTILAEQFAFSSSISAAEAQGVNVFPIPLDEHG---IIPSKLETILDNWTEGAAKPKLL 212

Query: 243 VVINPG-NPTGAILTKDSXXXXXXXXXEYGIVIIADEVYQENVYEAFE----------FH 291
             +  G NPTG+ L+ D          ++  +II DE Y     E +E          + 
Sbjct: 213 YTVPTGQNPTGSSLSFDRKEEIYRIAQKHDFIIIEDEPYYFLQMEKYEKDPANRVVKSYA 272

Query: 292 SFKKVLSELRKNYPSKYDNVQLASLHSISKGVNGECGQRGGYMEITGFSNDVKKVL-LKV 350
             K+ +  L K++ S     ++  L S+SK +    G R G+  I G  + + ++L L+ 
Sbjct: 273 DHKEFIQNLEKSFVSIDTEGRVLRLDSLSKVL--APGTRFGW--IVGAKDILARILSLQE 328

Query: 351 ASISICSVVTGQILVDLMVNPPQPGDESYELDQLERSVIHSNLILKSNTLYDVFTRLPGI 410
            +I   +  T  I+   M    Q G   + +          +  +  + LY    ++  I
Sbjct: 329 MTIQAPAGFTQSIIAGTMNRWGQEGYLDWLIGLRHEYTKKRDCCI--DALYKYLPQVDYI 386

Query: 411 SCQKPQGAMYLFPRLHLSENAINAATELNLKPD--EFYCLKLLENTGICTVPGSGF 464
               P   M+    +  S++    AT+    P+  E         +G+  VPG+ F
Sbjct: 387 KINPPIAGMFFTVNIDASKHP-EFATKYGSDPEKVEKAIFDRSIASGVLVVPGNWF 441

>NDAI0G05760 Chr7 (1427844..1429190) [1347 bp, 448 aa] {ON}
           Anc_1.321
          Length = 448

 Score = 39.7 bits (91), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 34/134 (25%), Positives = 57/134 (42%), Gaps = 21/134 (15%)

Query: 160 NVFLTAGASTAVDHILP--LFAKDESCGVLLPIPQYPLYTAAVTLQKSKL---------- 207
           N+ +T GA+  +   L   L A DE   V++  P +  Y + + L   K+          
Sbjct: 121 NITITTGANEGILSCLMGLLNAGDE---VIVFEPFFDQYISNIELMGGKVVYVPINPPKD 177

Query: 208 LPYYLNESNNWSTDPKQIEQIVIDAIKQNIKPTTLVVINPGNPTGAILTKDSXXXXXXXX 267
           L   + E   W+ D +Q    +    K       ++V +P NP G + TK+         
Sbjct: 178 LDQRITEGTEWTIDFEQFRNAITPKTK------AVIVNSPHNPIGKVFTKEELTKLGEIC 231

Query: 268 XEYGIVIIADEVYQ 281
            E  ++II+DEVY+
Sbjct: 232 VENNVIIISDEVYE 245

>Kwal_23.4888 s23 (907745..908914) [1170 bp, 389 aa] {ON} YIL116W
           (HIS5) - histidinol-phosphate aminotransferase [contig
           5] FULL
          Length = 389

 Score = 39.3 bits (90), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 46/198 (23%), Positives = 86/198 (43%), Gaps = 24/198 (12%)

Query: 151 QDLIDETASNVFLTAGASTAVDHILPLFAKDESCGVLLPIPQYPLYTAAVTLQKSKLLPY 210
           Q+L   T  N+ L  G+   +D ++          +L+  P Y +Y+    +   + +  
Sbjct: 80  QNLPPLTHENLCLGVGSDECIDALIRACCVPGKDKILIMPPTYGMYSICTDINDVEYVKV 139

Query: 211 YLN-ESNNWSTDPKQIEQIVIDAIKQNIKPTTLVVINPGNPTGAILTKDSXXXXXXXXXE 269
            L  E N++  D ++    VI+ ++ +     + + +PGNPTGA++ K           +
Sbjct: 140 PLVVEDNSFQMDTEK----VIETLQNDPSIKLVFITSPGNPTGALI-KPENIEKLLSQWQ 194

Query: 270 YGIVIIADEVYQENVYEAFEFHSFKKVLSELRKNYPSKYDNVQLASLHSISKGVNGECGQ 329
            G V++ DE Y        +F +    ++ L   YP+      LA L ++SK      G 
Sbjct: 195 SGFVVV-DEAY-------IDFCTTGGSVAPLVNKYPN------LAVLQTLSKSF----GL 236

Query: 330 RGGYMEITGFSNDVKKVL 347
            G  + IT  S+D  ++L
Sbjct: 237 AGIRLGITFTSSDFSRIL 254

>Kpol_1039.22 s1039 (68736..69896) [1161 bp, 386 aa] {ON}
           (68736..69896) [1161 nt, 387 aa]
          Length = 386

 Score = 38.5 bits (88), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 40/177 (22%), Positives = 77/177 (43%), Gaps = 18/177 (10%)

Query: 157 TASNVFLTAGASTAVDHILPLFAKDESCGVLLPIPQYPLYTAAVTLQKSKLLPY-YLNES 215
           T  N+ L  G+   +D ++    + E   +L   P Y +Y+    +   +++    + E 
Sbjct: 83  TEDNLCLGVGSDECIDSLIRACCRPEVDKILTLPPTYSMYSVCANINDVEIVECPLITED 142

Query: 216 NNWSTDPKQIEQIVIDAIKQNIKPTTLVVINPGNPTGAILTKDSXXXXXXXXXEYGIVII 275
           N++  +  +    V+  +K + K   L + +PGNPTG ++ K             G+V++
Sbjct: 143 NSFQMNVPE----VLSTLKNDPKIKLLFITSPGNPTGKLVNKKDIEFILENWTN-GLVVV 197

Query: 276 ADEVYQENVYEAFEFHSFKKVLSELRKNYPSKYDNVQLASLHSISKGVNGECGQRGG 332
            DE Y +        +S  K++++    YP+      L  L ++SK   G  G R G
Sbjct: 198 -DEAYIDFADAEGTTYSMAKLVTK----YPN------LTVLQTLSKSF-GLAGIRLG 242

>KLTH0G02002g Chr7 (155219..156709) [1491 bp, 496 aa] {ON} highly
           similar to uniprot|P53090 Saccharomyces cerevisiae
           YGL202W ARO8 Aromatic aminotransferase expression is
           regulated by general control of amino acid biosynthesis
          Length = 496

 Score = 38.9 bits (89), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 35/124 (28%), Positives = 58/124 (46%), Gaps = 13/124 (10%)

Query: 222 PKQIEQIVIDAIKQNIKPTTLVVINPG-NPTGAILTKDSXXXXXXXXXEYGIVIIADEVY 280
           P+++E I+ +   +  KP  L  I  G NPTG+ L+ D          ++  +II DE Y
Sbjct: 193 PERLEAILDNWNPETPKPKLLYTIPTGQNPTGSSLSDDRKKEIYRIAQKHDFIIIEDEPY 252

Query: 281 ---QENVYE-------AFEFHSFKKVLSELRKNYPSKYDNVQLASLHSISKGVNGECGQR 330
              Q + YE       A EF S  + ++ L K++ S     ++  + S SK +    G R
Sbjct: 253 YFLQMDAYEKDPSKRKAIEFASHDEFVNSLAKSFISLDTEGRVIRMDSFSKVLG--PGTR 310

Query: 331 GGYM 334
            G++
Sbjct: 311 LGWL 314

>Ecym_6319 Chr6 complement(607599..608663) [1065 bp, 354 aa] {ON}
           similar to Ashbya gossypii AEL170C
          Length = 354

 Score = 38.5 bits (88), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 59/236 (25%), Positives = 91/236 (38%), Gaps = 55/236 (23%)

Query: 200 VTLQKSKLLPYYLNESNNWSTDPKQIEQIVIDAIKQNIKPTTLVVINPGNPTGAILTKDS 259
           V L   K L     + + W+ D  Q    + +  K       +++ +P NPTG + T++ 
Sbjct: 150 VPLTPPKDLKTRRTKGSEWTLDFDQFRSAISEKTK------AVIINSPHNPTGKVFTREE 203

Query: 260 XXXXXXXXXEYGIVIIADEVYQENVYEAFEFHSFKKVLSELRKNYPSKYDNVQLASLHSI 319
                    E  + II+DEVY EN+Y   E                     V+LASL   
Sbjct: 204 LLTLGNICVEKNVYIISDEVY-ENLYFTPEC--------------------VKLASLSPE 242

Query: 320 SKGVNGECGQRGGYMEITGF------SNDVKKVLLKVAS---ISICSVVTGQILVDLMVN 370
              +    G  G    +TG+      S +V+  LLK+AS   I IC             +
Sbjct: 243 ISNITLTIGSAGKIFAVTGWRIGWIISENVE--LLKLASSAHIKICFSSP---------S 291

Query: 371 PPQPG-----DESYELDQLERSVIHSNLILKSNTLYDVFTRLPGISCQKPQGAMYL 421
           PPQ       D +   D  +R  +  + I K   L  VF  L G+    P+G+ ++
Sbjct: 292 PPQLACAHAIDIALNSDYFDR--MRKDYIEKVEILTSVFEEL-GMPYTVPEGSYFI 344

>KNAG0E01850 Chr5 (381827..382981) [1155 bp, 384 aa] {ON} Anc_2.252
           YIL116W
          Length = 384

 Score = 38.5 bits (88), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 43/192 (22%), Positives = 86/192 (44%), Gaps = 26/192 (13%)

Query: 157 TASNVFLTAGASTAVDHILPLFAKDESCGVLLPIPQYPLYTAAVTLQKSKLLPY-YLNES 215
           T+ N+ L  G+  ++D I+          +L+  P Y +Y+    +   +++    + E 
Sbjct: 86  TSGNICLGVGSDESIDAIIRATCVPAREKILVLPPTYSMYSVCAKINDVEVVTCPLITED 145

Query: 216 NNWSTDPKQIEQIVIDAIKQNIKPTTLVVINPGNPTGAILTKDSXXXXXXXXXEYGIVII 275
           N++  D  +    V+D +  + +   L + +PGNPTGA + + +         + G+V++
Sbjct: 146 NSFQMDSDK----VLDILNNDQEIKLLFITSPGNPTGAQI-ETARIEKVLQNWDRGLVVV 200

Query: 276 ADEVYQENVYEAFEFHSFKKVLSELRKNYPSKYDNVQLASLHSISKGVNGECGQRGGYME 335
            DE Y +     F   S   ++        +KY N  L +L ++SK      G  G  + 
Sbjct: 201 -DEAYVD-----FCGGSTAPLV--------TKYQN--LVTLQTLSKSF----GLAGIRLG 240

Query: 336 ITGFSNDVKKVL 347
           +T  S D+ ++L
Sbjct: 241 MTFASEDLARIL 252

>Kpol_1035.23 s1035 complement(56123..57457) [1335 bp, 444 aa] {ON}
           complement(56123..57457) [1335 nt, 445 aa]
          Length = 444

 Score = 38.5 bits (88), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 39/145 (26%), Positives = 58/145 (40%), Gaps = 20/145 (13%)

Query: 157 TASNVFLTAGASTAV-DHILPLFAKDESCGVLLP-----IPQYPLYTAAVT---LQKSKL 207
           T  NV +T GA+  +   ++ +    +   V  P     IP   L    V    +   K 
Sbjct: 114 TPENVLVTTGANEGILSCLMGIINPGDEVIVFEPFFDQYIPNIELCGGKVVYVPINPPKE 173

Query: 208 LPYYLNESNNWSTDPKQIEQIVIDAIKQNIKPTTLVVI--NPGNPTGAILTKDSXXXXXX 265
           L   + +   W+ D         D   + I P T  VI   P NP G + T++       
Sbjct: 174 LDNRVTKGTEWTVD--------FDEFTRAITPKTKAVIINTPHNPIGKVFTREELTKLGN 225

Query: 266 XXXEYGIVIIADEVYQENVYEAFEF 290
              E  ++IIADEVY E++Y   EF
Sbjct: 226 ICVENNVIIIADEVY-EHLYFVDEF 249

>SAKL0D06886g Chr4 complement(571478..572821) [1344 bp, 447 aa] {ON}
           highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase involved in
           biosynthesis of nicotinic acid from tryptophan via
           kynurenine pathway potential Cdc28p substrate
          Length = 447

 Score = 38.1 bits (87), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 28/93 (30%), Positives = 41/93 (44%), Gaps = 11/93 (11%)

Query: 200 VTLQKSKLLPYYLNESNNWSTDPKQIEQIVIDAIKQNIKPTT--LVVINPGNPTGAILTK 257
           V L   K L   +     W+ D         D ++  I P T  L++  P NP G + T+
Sbjct: 169 VPLHPPKELENRVTHGTEWTVD--------YDELRAAITPKTKALILNTPHNPIGKVFTR 220

Query: 258 DSXXXXXXXXXEYGIVIIADEVYQENVYEAFEF 290
           +          E  +VII+DEVY E++Y   EF
Sbjct: 221 EELLEIGNICVENNVVIISDEVY-EHLYFTSEF 252

>SAKL0E08492g Chr5 complement(692049..693203) [1155 bp, 384 aa] {ON}
           similar to uniprot|P07172 Saccharomyces cerevisiae
           YIL116W HIS5 Histidinol-phosphate aminotransferase
           catalyzes the seventh step in histidine biosynthesis
           responsive to general control of amino acid biosynthesis
           mutations cause histidine auxotrophy and sensitivity to
           Cu Co and Ni salts
          Length = 384

 Score = 38.1 bits (87), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 28/131 (21%), Positives = 59/131 (45%), Gaps = 7/131 (5%)

Query: 151 QDLIDETASNVFLTAGASTAVDHILPLFAKDESCGVLLPIPQYPLYTAAVTLQKSKLLPY 210
           Q+L   TA N+ L  G+  ++D ++ +        +++  P Y +Y+    +     +  
Sbjct: 80  QNLPPLTAENICLGVGSDESIDALIRVCCVPSKDKIMIMPPTYGMYSICADINDVGCVKV 139

Query: 211 YL-NESNNWSTDPKQIEQIVIDAIKQNIKPTTLVVINPGNPTGAILTKDSXXXXXXXXXE 269
            L  E N++  D  +    V++ + Q+     + + +PGNPT A++  D+          
Sbjct: 140 PLVAEDNSFQMDTSK----VLETLAQDPTIKLIFITSPGNPTAALI--DTAEIEKVLNNW 193

Query: 270 YGIVIIADEVY 280
            G +++ DE Y
Sbjct: 194 TGGLVVVDEAY 204

>TDEL0C04090 Chr3 complement(722310..723461) [1152 bp, 383 aa] {ON}
           Anc_2.252 YIL116W
          Length = 383

 Score = 37.4 bits (85), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 31/131 (23%), Positives = 63/131 (48%), Gaps = 7/131 (5%)

Query: 151 QDLIDETASNVFLTAGASTAVDHILPLFAKDESCGVLLPIPQYPLYTAAVTLQKSKLLPY 210
           +D+   TA N+ L  G+  ++D I+          ++   P Y +Y+   ++   +++  
Sbjct: 77  KDITPLTAENLCLGVGSDESIDAIIRATCVPGKEKIMAMPPTYGMYSVCASVNDVEIVKC 136

Query: 211 YLNESNN-WSTDPKQIEQIVIDAIKQNIKPTTLVVINPGNPTGAILTKDSXXXXXXXXXE 269
            L  S+N +  D     + V+D +K++     + + +PGNPTGA + + S         +
Sbjct: 137 PLVTSDNSFQVD----TEAVLDTLKKDPLIKLVFITSPGNPTGAKI-ETSRIEKILQNWD 191

Query: 270 YGIVIIADEVY 280
            GI+++ DE Y
Sbjct: 192 QGILVV-DEAY 201

>ZYRO0G20636g Chr7 complement(1700506..1701867) [1362 bp, 453 aa]
           {ON} highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase involved in
           biosynthesis of nicotinic acid from tryptophan via
           kynurenine pathway potential Cdc28p substrate
          Length = 453

 Score = 37.4 bits (85), Expect = 0.089,   Method: Compositional matrix adjust.
 Identities = 35/140 (25%), Positives = 59/140 (42%), Gaps = 18/140 (12%)

Query: 151 QDLIDETASNVFLTAGASTAV-DHILPLFAKDESCGVLLP-----IPQYPLYTAAVT--- 201
           Q+L DE   NV +T GA+  +   ++ +    +   V  P     IP   L    V    
Sbjct: 118 QELKDE---NVTITTGANEGILSSLMGILNPGDEVIVFEPFFDQYIPNIELLGGKVVYVP 174

Query: 202 LQKSKLLPYYLNESNNWSTDPKQIEQIVIDAIKQNIKPTTLVVINPGNPTGAILTKDSXX 261
           +   K +   + E  +W+ D +++ +      K       L++  P NP G + TK+   
Sbjct: 175 INPPKDMDQRIVEGKDWTIDYEELAKAFTSKTK------ALILNTPHNPIGKVFTKEELT 228

Query: 262 XXXXXXXEYGIVIIADEVYQ 281
                  E  +VII+DEVY+
Sbjct: 229 KIGNLCVENNVVIISDEVYE 248

>Ecym_3290 Chr3 (546773..547933) [1161 bp, 386 aa] {ON} similar to
           Ashbya gossypii ADL249W
          Length = 386

 Score = 37.0 bits (84), Expect = 0.089,   Method: Compositional matrix adjust.
 Identities = 46/189 (24%), Positives = 80/189 (42%), Gaps = 25/189 (13%)

Query: 160 NVFLTAGASTAVDHILPLFAKDESCGVLLPIPQYPLYTAAVTLQKSKLLPY-YLNESNNW 218
           N+ L  G+   VD ++      ++  VL+  P Y +Y+    +  ++++    + E N++
Sbjct: 89  NICLGVGSDEGVDSLIRATCVPKTDKVLVLPPTYSMYSVFAMINDTEVVECPLITEDNSF 148

Query: 219 STDPKQIEQIVIDAIKQNIKPTTLVVINPGNPTGAILTKDSXXXXXXXXXEYGIVIIADE 278
             D       V++ +  +     L +  PGNPTGA ++              GIV++ DE
Sbjct: 149 DMDLDN----VLETLSNDDSIKLLFITTPGNPTGASIST-QKIEMLLNNWSAGIVVV-DE 202

Query: 279 VYQENVYEAFEFHSFKKVLSELRKNYPSKYDNVQLASLHSISKGVNGECGQRGGYMEITG 338
            Y        +F S     + L   YP+      L  + ++SK   G  G R G   +T 
Sbjct: 203 AY-------IDFSSSDSA-APLVNKYPN------LVVIQTLSKSF-GLAGVRLG---LTF 244

Query: 339 FSNDVKKVL 347
            S D+ KVL
Sbjct: 245 ASEDISKVL 253

>TPHA0F01260 Chr6 complement(290133..291311) [1179 bp, 392 aa] {ON}
           Anc_2.252 YIL116W
          Length = 392

 Score = 37.0 bits (84), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 47/206 (22%), Positives = 93/206 (45%), Gaps = 25/206 (12%)

Query: 148 DPTQDLIDETASNVFLTAGASTAVDHILPLFAKDESCGVLLPIPQYPLYTAAVTLQKSKL 207
           D T ++ D +  N+ L  G+   +D ++    K     +++  P Y +Y+    +    +
Sbjct: 74  DNTANVPDLSHKNLCLGVGSDECIDALIRACCKPAVQKIMVLPPTYSMYSVCANINDVDV 133

Query: 208 LPY-YLNESNNWSTDPKQIEQIVIDAIKQNIKPTTLVVINPGNPTGAILT-KDSXXXXXX 265
           +    + E N++  D K+     ++ +K++     L + +PGNPTG I+  KD       
Sbjct: 134 VNCPLIVEDNSFQMDVKR----TLETLKKDDLIRLLFITSPGNPTGKIIAIKD--IIYVL 187

Query: 266 XXXEYGIVIIADEVYQENVYEAFEFHSFKKV----LSELRKNYPSKYDNVQLASLHSISK 321
              + G+V++ DE Y +  +  +     KK     +++L   YP+      L  L ++SK
Sbjct: 188 EHWKNGLVVV-DEAYVD--FSTYFNEETKKTEYFSVAKLVTKYPN------LTVLQTLSK 238

Query: 322 GVNGECGQRGGYMEITGFSNDVKKVL 347
              G  G R G   +T  S ++ ++L
Sbjct: 239 SF-GLAGIRLG---VTFASEELARIL 260

>Kwal_14.2574 s14 complement(818144..819475) [1332 bp, 443 aa] {ON}
           YJL060W (BNA3) - 1:1 [contig 224] FULL
          Length = 443

 Score = 36.6 bits (83), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 40/143 (27%), Positives = 66/143 (46%), Gaps = 18/143 (12%)

Query: 158 ASNVFLTAGASTAVDHILP--LFAKDESCGVLLPIPQYPLYTAAVTLQKSKLL------P 209
           ASNV +T GA+  +   L   L   DE   V++  P +  Y + + +   K+       P
Sbjct: 114 ASNVQVTTGANEGILSCLVGLLNPGDE---VIVFEPFFDQYISNIQIPGGKVTYVPMHPP 170

Query: 210 YYLNESNNWSTDPKQIEQIVIDAIKQNIKPTT--LVVINPGNPTGAILTKDSXXXXXXXX 267
             +N  N   T+      +  D ++  I P T  L++  P NP G + T++         
Sbjct: 171 KEMNVRNTKGTE----WTVNYDELEAAITPKTKALILNTPHNPVGKVFTREELLRIGEIC 226

Query: 268 XEYGIVIIADEVYQENVYEAFEF 290
            ++ +VII+DEVY E++Y   EF
Sbjct: 227 VKHNVVIISDEVY-EHLYFTPEF 248

>SAKL0F02156g Chr6 (185574..187070) [1497 bp, 498 aa] {ON} highly
           similar to uniprot|P53090 Saccharomyces cerevisiae
           YGL202W ARO8 Aromatic aminotransferase expression is
           regulated by general control of amino acid biosynthesis
          Length = 498

 Score = 36.2 bits (82), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 54/224 (24%), Positives = 90/224 (40%), Gaps = 27/224 (12%)

Query: 123 YSSSQGVLDIRKNVARFILKR-DLHHDPTQDLIDETASNVFLTAGASTAVDHILPLFAKD 181
           Y  SQG    +  +  F+ K   L HD     I     +V  TAG + A +  L +F  +
Sbjct: 106 YGFSQG----QPELMEFVRKHTSLVHD-----IKYADWDVLATAGNTNAWESTLRVFC-N 155

Query: 182 ESCGVLLPIPQYPLYTAAVTLQKSKLLPYYLNESNNWSTDPKQIEQIVIDAIKQNIKPTT 241
               +L     +     A   Q   + P  L+E   +   P+++E I+ +   +  KP  
Sbjct: 156 RGDTILAEAYSFSSSLYAAEAQGVNVFPVPLDE---FGIIPEKLESIMDNWNPETPKPKL 212

Query: 242 LVVINPG-NPTGAILTKDSXXXXXXXXXEYGIVIIADEVY----------QENVYEAFEF 290
           L  I  G NPTG+ L+ D          ++  +II DE Y            +  E   +
Sbjct: 213 LYTIPTGQNPTGSSLSDDRKAKIYRIAQKHNFIIIEDEPYYFLQMEPYVKDASAREKKTY 272

Query: 291 HSFKKVLSELRKNYPSKYDNVQLASLHSISKGVNGECGQRGGYM 334
            S  + +  L K++ S   + ++  L S SK +    G R G++
Sbjct: 273 SSHDEFIQSLAKSFISLDTDGRVVRLDSFSKVL--APGTRLGWI 314

>Kwal_47.18982 s47 complement(1051414..1052904) [1491 bp, 496 aa]
           {ON} YGL202W (ARO8) - 1:1 [contig 188] FULL
          Length = 496

 Score = 35.8 bits (81), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 77/326 (23%), Positives = 131/326 (40%), Gaps = 39/326 (11%)

Query: 160 NVFLTAGASTAVDHILPLFAKDESCGVLLPIPQYPLYTA--AVTLQKSKLLPYYLNESNN 217
           NV  T G + + +  L +F    + G  +   QY   ++  A   Q   + P  L+    
Sbjct: 135 NVLATTGNTGSWESTLRIFC---NRGDTILAEQYTFSSSVYAAEAQGINVFPVPLDADG- 190

Query: 218 WSTDPKQIEQIVIDAIKQNIKPTTLVVINPG-NPTGAILTKDSXXXXXXXXXEYGIVIIA 276
               P+++E I+ +      KP  L  I  G NPTG+ L+ D          ++ ++II 
Sbjct: 191 --LIPERLEAILDNWNPDTAKPKLLYTIPTGQNPTGSSLSDDRKVEIYRIAKKHDLLIIE 248

Query: 277 DE--------VYQENVYEAFEFH--SFKKVLSELRKNYPSKYDNVQLASLHSISKGVNGE 326
           DE         YQ++V +  E H  S +  ++ L K++ S     ++  L S SK +   
Sbjct: 249 DEPYYFLQMDAYQKDVSQRKETHFASQEDFVNSLAKSFISLDTEGRVLRLDSFSKVLG-- 306

Query: 327 CGQRGGYMEITGFSNDVKKVLLKVASISICSVVT----GQILVDLMVNPPQPGDESYELD 382
            G R G+  I G     KK+L K   +   ++       Q +V   +N  + G + + LD
Sbjct: 307 PGTRLGW--IVG----SKKILQKYTQLHEMTIQNPSGFSQAIVAGTLN--RWGQDGF-LD 357

Query: 383 QLE--RSVIHSNLILKSNTLYDVFTRLPGISCQKPQGAMYLFPRLHLSENAINAATELNL 440
            L   R   +    +  + LY      P  +   P   M+       S +    AT+   
Sbjct: 358 WLVGLRREYNEKRDVAIDALYKYLPETPAFTINPPIAGMFFTVNTDASAHP-EFATKYQS 416

Query: 441 KPD--EFYCLKLLENTGICTVPGSGF 464
           KP+  E    + +  +G+  VPG  F
Sbjct: 417 KPELVEQAIYEKVIASGVLVVPGVWF 442

>TDEL0D01900 Chr4 (369434..370765) [1332 bp, 443 aa] {ON} Anc_1.321
           YJL060W
          Length = 443

 Score = 35.8 bits (81), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 31/65 (47%), Gaps = 8/65 (12%)

Query: 218 WSTDPKQIEQIVIDAIKQNIKPTTLVVIN-PGNPTGAILTKDSXXXXXXXXXEYGIVIIA 276
           W+ D +Q    + D  K        V+IN P NP G + T++          +  +VII+
Sbjct: 183 WTVDYEQFANAITDKTKA-------VIINTPHNPIGKVFTREELTRIGEICVKKNVVIIS 235

Query: 277 DEVYQ 281
           DEVY+
Sbjct: 236 DEVYE 240

>CAGL0J05126g Chr10 complement(487452..488753) [1302 bp, 433 aa]
           {ON} highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060w
          Length = 433

 Score = 35.4 bits (80), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 44/171 (25%), Positives = 76/171 (44%), Gaps = 23/171 (13%)

Query: 120 VGAYSSSQGVLDIRKNVARFILKRDLHHDPTQDLIDETASNVFLTAGASTAVDHILP--L 177
           V  YS ++G   + K++       +L+     D ID    NV +T GA+  +   L   L
Sbjct: 74  VNQYSPTRGRPSLIKSLV------ELYKPVFGDFIDN--QNVLVTTGANEGILSCLMGIL 125

Query: 178 FAKDESCGVLLPIPQYPLYTAAVTL-----QKSKLLPYYLNESNNWSTDPKQIEQIVIDA 232
            A DE   V++  P +  Y   + L     +   + P    ++ N + D  QI+    DA
Sbjct: 126 NAGDE---VIVFEPFFDQYIPNIELCGGVVRYVPIHPPKEMKTRNTTGDEWQIDW---DA 179

Query: 233 IKQ--NIKPTTLVVINPGNPTGAILTKDSXXXXXXXXXEYGIVIIADEVYQ 281
           +++  N K   +++  P NP G + T+           E+  V+I+DEVY+
Sbjct: 180 LEKTFNNKTKAVIINTPHNPIGKVFTEQELTKLAQLCVEHNTVVISDEVYE 230

>KLLA0F03509g Chr6 (327598..328761) [1164 bp, 387 aa] {ON} similar
           to uniprot|P07172 Saccharomyces cerevisiae YIL116W HIS5
           Histidinol-phosphate aminotransferase catalyzes the
           seventh step in histidine biosynthesis responsive to
           general control of amino acid biosynthesis mutations
           cause histidine auxotrophy and sensitivity to Cu Co and
           Ni salts
          Length = 387

 Score = 35.4 bits (80), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 51/220 (23%), Positives = 99/220 (45%), Gaps = 25/220 (11%)

Query: 130 LDIRKNVARFILKRDLHHDPTQDLIDETASNVFLTAGASTAVDHILPLFAKDESCGVLLP 189
           L+ +K ++ +  K  +  D  Q+L    A N+ L  G+  ++D ++          +L+ 
Sbjct: 61  LEFKKLLSDYRNKTSIFKD--QNLKPLDADNLCLGVGSDESIDALIRACCVPAKEKILIA 118

Query: 190 IPQYPLYTAAVTLQKSK--LLPYYLNESNNWSTDPKQIEQIVIDAIKQNIKPTTLVVINP 247
              Y +YT    +   +   +P  L+E + +  D    E+ +++ ++ +     + + +P
Sbjct: 119 PATYGMYTICSQVNDVEYVTVPLLLSEEDKFQID----EEKILETLQNDPSIKLVFITSP 174

Query: 248 GNPTGAILTKDSXXXXXXXXXEYGIVIIADEVYQENVYEAFEFHSFKKVLSELRKNYPSK 307
           GNPTG  +  +          + G+V++ DE Y +     F   S K  L+ L     +K
Sbjct: 175 GNPTGTFIDVNR-IEKILSQWQTGLVVV-DEAYID-----FVEGSDKGSLAPL----ATK 223

Query: 308 YDNVQLASLHSISKGVNGECGQRGGYMEITGFSNDVKKVL 347
           Y+N+  A L ++SK   G  G R G   +T  S  + +VL
Sbjct: 224 YENI--AVLQTLSKSF-GLAGIRLG---VTYTSKAMSRVL 257

>KNAG0B00660 Chr2 (115417..116907) [1491 bp, 496 aa] {ON} Anc_3.511
           YGL202W
          Length = 496

 Score = 35.0 bits (79), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 33/122 (27%), Positives = 53/122 (43%), Gaps = 5/122 (4%)

Query: 160 NVFLTAGASTAVDHILPLFAKDESCGVLLPIPQYPLYTAAVTLQKSKLLPYYLNESNNWS 219
           +V  T G + A +  L +F  D+   +L     +    AA   Q     P  ++E     
Sbjct: 132 DVVATTGNTNAWESTLRVFC-DKGDVILAEAHSFSSCLAAAQAQGIITFPIPIDEHG--- 187

Query: 220 TDPKQIEQIVIDAIKQNIKPTTLVVINPG-NPTGAILTKDSXXXXXXXXXEYGIVIIADE 278
             P+++EQI+ +  +   KP  L  I  G NPTG+ L+ D          ++  +II DE
Sbjct: 188 IIPEKLEQILDNWTEGAPKPKLLYTIPTGQNPTGSSLSDDRKEKIYKVAQKHDFIIIEDE 247

Query: 279 VY 280
            Y
Sbjct: 248 PY 249

>KNAG0B05320 Chr2 (1028845..1030146) [1302 bp, 433 aa] {ON}
           Anc_1.321 YJL060W
          Length = 433

 Score = 35.0 bits (79), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 36/73 (49%), Gaps = 7/73 (9%)

Query: 218 WSTDPKQIEQIVIDAIKQNIKPTTLVVINPGNPTGAILTKDSXXXXXXXXXEYGIVIIAD 277
           W  D   +E+ +      N +   +++  P NP G + T++          +  IVII+D
Sbjct: 173 WEIDWDILEKTI------NSRTKCVIINTPHNPIGKVFTREELLRLGKICVDNNIVIISD 226

Query: 278 EVYQENVYEAFEF 290
           EVY E++Y + EF
Sbjct: 227 EVY-EHLYFSDEF 238

>KAFR0J01580 Chr10 complement(287313..288464) [1152 bp, 383 aa] {ON}
           Anc_2.252 YIL116W
          Length = 383

 Score = 34.7 bits (78), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 35/131 (26%), Positives = 57/131 (43%), Gaps = 9/131 (6%)

Query: 152 DLIDETASNVFLTAGASTAVDHILPLFAKDESCGVLLPIPQYPLYTAAVTLQKSKLLPY- 210
           DL+  T  N  L  G+  ++D I+          +L+  P Y +Y+    +    ++   
Sbjct: 80  DLVPLTDENFCLGVGSDESIDAIIRASCVPSKEKILVLPPTYSMYSVCANINDVDVVTCP 139

Query: 211 YLNESNNWSTDPKQIEQIVIDAIKQNIKPTTLVVI-NPGNPTGAILTKDSXXXXXXXXXE 269
            + E N++  D  +I  I+      N     LV I +PGNPTGA +  D          +
Sbjct: 140 LITEDNSFQIDATEILNIL-----ANDPLIKLVFITSPGNPTGAKIEIDRIEYLLKNWDQ 194

Query: 270 YGIVIIADEVY 280
            G+VI+ DE Y
Sbjct: 195 -GLVIV-DEAY 203

>Suva_9.78 Chr9 (137747..138907) [1161 bp, 386 aa] {ON} YIL116W
           (REAL)
          Length = 386

 Score = 34.3 bits (77), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 49/192 (25%), Positives = 83/192 (43%), Gaps = 26/192 (13%)

Query: 157 TASNVFLTAGASTAVDHILPLFAKDESCGVLLPIPQYPLYTAAVTLQKSKLLPYYLNESN 216
           TA N+ L  G+  ++D I+          +L+  P Y +Y+    +   +++   L  S+
Sbjct: 86  TADNLCLGVGSDESIDAIIRACCVPGKEKILVLPPTYSMYSVCANINDIEVVQCPLVVSD 145

Query: 217 NWSTDPKQIEQIVIDAIKQNIKPTTLV-VINPGNPTGAILTKDSXXXXXXXXXEYGIVII 275
           N      Q++   +  I +N     LV V +PGNPTGA + K S         + G+V++
Sbjct: 146 N----SFQMDVEAVLTILENDPLIKLVFVTSPGNPTGAKI-KTSLIEQVLQNWQNGLVVV 200

Query: 276 ADEVYQENVYEAFEFHSFKKVLSELRKNYPSKYDNVQLASLHSISKGVNGECGQRGGYME 335
            DE Y        +F       + L   YP+      L +L ++SK      G  G  + 
Sbjct: 201 -DEAY-------IDFCGGST--APLVTKYPN------LVTLQTLSKSF----GLAGIRLG 240

Query: 336 ITGFSNDVKKVL 347
           +T  S D+ K+L
Sbjct: 241 MTYASKDLAKIL 252

>Kwal_34.16018 s34 (159210..160349) [1140 bp, 379 aa] {ON} YJL060W
           (BNA3) - YJL060W [contig 272] FULL
          Length = 379

 Score = 34.3 bits (77), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 42/171 (24%), Positives = 70/171 (40%), Gaps = 42/171 (24%)

Query: 123 YSSSQGVLDIRKNVARFILKRDLHHDPTQDLIDETASNVFLTAGASTA-----------V 171
           Y + QG   +RK +A      D         +  +  NV LT GA  A            
Sbjct: 55  YGAIQGSHALRKLIAEMYSNED---------VTLSEENVILTNGAIAANFLTHYTLAGKG 105

Query: 172 DHILPLFAKDESCGVLLPIPQYPLYTAAVTLQKSKLLPYYLNESNNWSTDPKQIEQIVID 231
           DH + +    +    L  IPQ  ++ A V L        +L +  N+  +  ++E++   
Sbjct: 106 DHFICISPTYQQ---LSSIPQ--MFGAEVEL-------LHLRKETNYQPNIVELERM--- 150

Query: 232 AIKQNIKPTT-LVVIN-PGNPTGAILTKDSXXXXXXXXXEYGIVIIADEVY 280
                IKP T  +V+N P NP  +++  ++         ++GIV+  DEVY
Sbjct: 151 -----IKPNTKCIVLNTPNNPLSSVIPTETLREIAELADKHGIVVFCDEVY 196

>YIL116W Chr9 (142928..144085) [1158 bp, 385 aa] {ON}
           HIS5Histidinol-phosphate aminotransferase, catalyzes the
           seventh step in histidine biosynthesis; responsive to
           general control of amino acid biosynthesis; mutations
           cause histidine auxotrophy and sensitivity to Cu, Co,
           and Ni salts
          Length = 385

 Score = 34.3 bits (77), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 31/125 (24%), Positives = 58/125 (46%), Gaps = 7/125 (5%)

Query: 157 TASNVFLTAGASTAVDHILPLFAKDESCGVLLPIPQYPLYTAAVTLQKSKLLPYYLNESN 216
           TA N+ L  G+  ++D I+          +L+  P Y +Y+    +   +++   L  S+
Sbjct: 86  TADNLCLGVGSDESIDAIIRACCVPGKEKILVLPPTYSMYSVCANINDIEVVQCPLTVSD 145

Query: 217 -NWSTDPKQIEQIVIDAIKQNIKPTTLVVINPGNPTGAILTKDSXXXXXXXXXEYGIVII 275
            ++  D     + V+  +K +     + V +PGNPTGA + K S         + G+V++
Sbjct: 146 GSFQMD----TEAVLTILKNDSLIKLMFVTSPGNPTGAKI-KTSLIEKVLQNWDNGLVVV 200

Query: 276 ADEVY 280
            DE Y
Sbjct: 201 -DEAY 204

>SAKL0D11528g Chr4 complement(960867..962018) [1152 bp, 383 aa] {ON}
           weakly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase, involved in
           biosynthesis of nicotinic acid from tryptophan via
           kynurenine pathway; potential Cdc28p substrate
          Length = 383

 Score = 34.3 bits (77), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 38/161 (23%), Positives = 73/161 (45%), Gaps = 20/161 (12%)

Query: 123 YSSSQGVLDIRKNVARFILKRDLHHDPTQDLIDETA--SNVFLTAGASTAVDHILPLFAK 180
           Y + +G  ++R  VA     +++  D    LI   A  +N  ++   +   DH++ +   
Sbjct: 55  YGAIKGSDELRSLVASLYSDKEVKLDKDNVLITNGAIGANFLVSYTLAGPGDHVICV--- 111

Query: 181 DESCGVLLPIPQYPLYTAAVTLQKSKLLPYYLNESNNWSTDPKQIEQIVIDAIKQNIKPT 240
           D +   L  +P+  ++ A V L +       LN  N++  D  +++ +    IK N K  
Sbjct: 112 DPTYQQLSSVPK--MFGAEVELLE-------LNRENDFIPDIGKLKSM----IKGNTK-- 156

Query: 241 TLVVINPGNPTGAILTKDSXXXXXXXXXEYGIVIIADEVYQ 281
            +V+ NP NP G+++   +         +  I +I DEVY+
Sbjct: 157 CIVLNNPNNPLGSVIPTATLEEIAALARKNEIRVICDEVYR 197

>KAFR0A01710 Chr1 complement(348198..349505) [1308 bp, 435 aa] {ON}
           Anc_1.321 YJL060W
          Length = 435

 Score = 34.3 bits (77), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 42/168 (25%), Positives = 72/168 (42%), Gaps = 17/168 (10%)

Query: 120 VGAYSSSQGVLDIRKNVARFILKRDLHHDPTQDLIDETASNVFLTAGASTAVDHILP--L 177
           V  YS ++G L +  ++ +F       + P  +   E A+N  +  GA+ A+  IL   L
Sbjct: 76  VNQYSPTRGRLSLIDSLVKF-------YTPFYNTKLE-AANFSVFTGANEAIFSILIGLL 127

Query: 178 FAKDESCGVLLPIPQYPLYTAAVTLQKSKLLPYYLNESNNWSTDPKQIEQIVID----AI 233
              DE   V++  P +  Y   + L   K++   +    N  T   + E+  ID      
Sbjct: 128 NPGDE---VIVFEPFFDQYIPNIELSGGKVVYVPITPPKNLDTRVTKGEEWQIDWDSLQA 184

Query: 234 KQNIKPTTLVVINPGNPTGAILTKDSXXXXXXXXXEYGIVIIADEVYQ 281
             N K   +++  P NP G + T+           +  +VII+DEVY+
Sbjct: 185 AMNSKTKAIIINTPHNPIGKVFTEPELRRLGDICVKNNVVIISDEVYE 232

>ZYRO0A01672g Chr1 (136284..137444) [1161 bp, 386 aa] {ON} highly
           similar to uniprot|P07172 Saccharomyces cerevisiae
           YIL116W HIS5 Histidinol-phosphate aminotransferase
           catalyzes the seventh step in histidine biosynthesis
           responsive to general control of amino acid biosynthesis
           mutations cause histidine auxotrophy and sensitivity to
           Cu Co and Ni salts
          Length = 386

 Score = 33.1 bits (74), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 31/127 (24%), Positives = 57/127 (44%), Gaps = 11/127 (8%)

Query: 157 TASNVFLTAGASTAVDHILPLFAKDESCGVLLPIPQYPLYTAAVTLQKSKLLPYYLNESN 216
           TA N+ L  G+  ++D I+          +L+  P Y +Y+    +   +++   L  S+
Sbjct: 85  TAENLCLGVGSDESIDAIIRACCVPAKEKILVLPPTYSMYSVCAHINDVEIVKCPLITSD 144

Query: 217 N---WSTDPKQIEQIVIDAIKQNIKPTTLVVINPGNPTGAILTKDSXXXXXXXXXEYGIV 273
           N    +TD       VI   + +     + + +PGNPTGA + + S         + G+V
Sbjct: 145 NSFQANTDE------VIKTAQNDPSIKLIFITSPGNPTGAKV-ETSRIEKILQNWDRGMV 197

Query: 274 IIADEVY 280
           ++ DE Y
Sbjct: 198 VV-DEAY 203

>Smik_16.318 Chr16 complement(569893..571935) [2043 bp, 680 aa] {ON}
           YPR074C (REAL)
          Length = 680

 Score = 33.5 bits (75), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 31/121 (25%), Positives = 49/121 (40%), Gaps = 21/121 (17%)

Query: 380 ELDQLERSVIHSNLILKSNTLYDVFTRLPGISCQKPQGAMYLFPRLHLSENAINAATELN 439
           +LD + +++  + L     TL  + T +              +  LH   ++++ A    
Sbjct: 223 DLDGISKAIAQAKLSKDKPTLIKISTTIG-------------YGSLHAGSHSVHGAP--- 266

Query: 440 LKPDEFYCLKLLENTGICTVPGSGFGQYPGTY-HLRTTFLPPGIEWINSWEKFHLEFMEK 498
           LKPD+   LK    T     P   F      Y H + T L PG+E  N W K   E+ +K
Sbjct: 267 LKPDDVKQLK----TKFGFNPDKSFVVPQEVYDHYQKTILKPGVEANNKWNKLFSEYQKK 322

Query: 499 Y 499
           Y
Sbjct: 323 Y 323

>KLTH0G19646g Chr7 complement(1699421..1700560) [1140 bp, 379 aa]
           {ON} conserved hypothetical protein
          Length = 379

 Score = 32.7 bits (73), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 29/133 (21%), Positives = 58/133 (43%), Gaps = 11/133 (8%)

Query: 150 TQDLIDETASNVFLTAGASTAVDHILPLFAKDESCGVLLPIPQYPLYTAAVTLQKSKLLP 209
           + D I  TA NV +T GA  A + ++   A      ++   P Y   ++  ++  + +  
Sbjct: 73  SSDEIQLTADNVLITNGAIGA-NFLVHYTAAGPGDHIICVDPTYQQLSSVPSMFGADVEL 131

Query: 210 YYLNESNNWSTDPKQIEQIVIDAIKQNIKPTT--LVVINPGNPTGAILTKDSXXXXXXXX 267
            +L   + ++ +        I  +K  ++  T  +V+ NP NP G++++ +         
Sbjct: 132 LHLEAEDGYTPN--------IQKLKSKVRANTKYIVLNNPNNPLGSVISTEKMTEIIDYA 183

Query: 268 XEYGIVIIADEVY 280
               I I+ DEVY
Sbjct: 184 ERNEIFIVCDEVY 196

>KLLA0F01617g Chr6 complement(154025..155359) [1335 bp, 444 aa] {ON}
           highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase
          Length = 444

 Score = 32.7 bits (73), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 35/76 (46%), Gaps = 3/76 (3%)

Query: 227 QIVIDAIKQNIKPTTLVVI--NPGNPTGAILTKDSXXXXXXXXXEYGIVIIADEVYQENV 284
           +I  D + + I   T  +I   P NP G + T++          +  I II+DEVY E++
Sbjct: 185 KIDFDILNKTINERTKCIILNTPHNPIGKVFTREELTQLGDICVKNNIYIISDEVY-EHL 243

Query: 285 YEAFEFHSFKKVLSEL 300
           Y   EF     +  E+
Sbjct: 244 YFGDEFTRIATISKEI 259

>CAGL0C01243g Chr3 (128629..129780) [1152 bp, 383 aa] {ON} highly
           similar to uniprot|P07172 Saccharomyces cerevisiae
           YIL116w HIS5
          Length = 383

 Score = 32.3 bits (72), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 30/125 (24%), Positives = 52/125 (41%), Gaps = 7/125 (5%)

Query: 157 TASNVFLTAGASTAVDHILPLFAKDESCGVLLPIPQYPLYTAAVTLQKSKLLPYYL-NES 215
           T  N+ L  G+  ++D ++          +L   P Y +Y+    +   ++L   L  E 
Sbjct: 85  TEDNLCLGVGSDESIDAVIRACCVPGKEKILTLPPTYSMYSVCANINDVEVLECPLIYED 144

Query: 216 NNWSTDPKQIEQIVIDAIKQNIKPTTLVVINPGNPTGAILTKDSXXXXXXXXXEYGIVII 275
           N++  D     Q VI  +  +     + + +PGNPTGA +  DS           G  ++
Sbjct: 145 NSFQPD----SQKVISILSSDPLIKLVFLTSPGNPTGAKI--DSNIIIKILESWDGGFVV 198

Query: 276 ADEVY 280
            DE Y
Sbjct: 199 VDEAY 203

>Skud_9.55 Chr9 (119747..120904) [1158 bp, 385 aa] {ON} YIL116W
           (REAL)
          Length = 385

 Score = 32.3 bits (72), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 30/124 (24%), Positives = 55/124 (44%), Gaps = 7/124 (5%)

Query: 158 ASNVFLTAGASTAVDHILPLFAKDESCGVLLPIPQYPLYTAAVTLQKSKLLPYYLNESNN 217
           A N+ L  G+  ++D I+          +L+  P Y +Y+    +   +++   L  S+N
Sbjct: 87  ADNLCLGVGSDESIDAIIRACCVPGKEKILVLPPTYSMYSVCANINDVEVVQCPLTVSDN 146

Query: 218 -WSTDPKQIEQIVIDAIKQNIKPTTLVVINPGNPTGAILTKDSXXXXXXXXXEYGIVIIA 276
            +  D     +  +  +K +     + V +PGNPTGA + K           E G+V++ 
Sbjct: 147 SFQMD----TEAALTILKNDPLIKLIFVTSPGNPTGAKI-KTCLIEKILQNWENGLVVV- 200

Query: 277 DEVY 280
           DE Y
Sbjct: 201 DEAY 204

>NCAS0B06440 Chr2 complement(1218759..1219916) [1158 bp, 385 aa]
           {ON} Anc_2.252 YIL116W
          Length = 385

 Score = 32.3 bits (72), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 23/103 (22%), Positives = 48/103 (46%), Gaps = 5/103 (4%)

Query: 151 QDLIDETASNVFLTAGASTAVDHILPLFAKDESCGVLLPIPQYPLYTAAVTLQKSKLLPY 210
           +DL   T  N+ L  G+  ++D I+          +L+  P Y +Y+    +   +++  
Sbjct: 80  RDLATLTNENLCLGVGSDESIDAIIRACCVPAKEKILVLPPTYSMYSVCANINDIEVVEC 139

Query: 211 -YLNESNNWSTDPKQIEQIVIDAIKQNIKPTTLVVINPGNPTG 252
             + E N++  +  +    V+D +K +     + + +PGNPTG
Sbjct: 140 PLIYEDNSFQLNSDK----VLDILKNDPLIKLVFITSPGNPTG 178

>NDAI0B03730 Chr2 complement(935131..936291) [1161 bp, 386 aa] {ON}
           Anc_2.252 YIL116W
          Length = 386

 Score = 32.3 bits (72), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 45/198 (22%), Positives = 87/198 (43%), Gaps = 26/198 (13%)

Query: 151 QDLIDETASNVFLTAGASTAVDHILPLFAKDESCGVLLPIPQYPLYTAAVTLQKSKLLPY 210
           ++L   T+ N+ L  G+  ++D I+          +L+  P Y +Y+    +   +++  
Sbjct: 81  ENLTPLTSENLCLGVGSDESIDAIIRATCVPGKEKILVLPPTYSMYSVCAEINDIEIVEC 140

Query: 211 -YLNESNNWSTDPKQIEQIVIDAIKQNIKPTTLVVINPGNPTGAILTKDSXXXXXXXXXE 269
             L ++N++  D +     V+  ++ +     L + +PGNPTGA +  +          +
Sbjct: 141 PLLYKNNSFQMDTES----VLTVLQNDPLIKLLFITSPGNPTGARIETERIETVLQNWTD 196

Query: 270 YGIVIIADEVYQENVYEAFEFHSFKKVLSELRKNYPSKYDNVQLASLHSISKGVNGECGQ 329
            G+V++ DE Y        +F       + L   YP+      L +L ++SK   G  G 
Sbjct: 197 -GLVVV-DEAY-------IDFCGGST--APLVTKYPN------LVTLQTLSKSF-GLAGI 238

Query: 330 RGGYMEITGFSNDVKKVL 347
           R G   +T  S D+ K+L
Sbjct: 239 RLG---MTYASKDLAKIL 253

>KNAG0G00550 Chr7 (96823..97986) [1164 bp, 387 aa] {ON} Anc_1.472
          Length = 387

 Score = 32.0 bits (71), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 16/54 (29%), Positives = 28/54 (51%), Gaps = 2/54 (3%)

Query: 230 IDAIKQNIKPTTLVVI--NPGNPTGAILTKDSXXXXXXXXXEYGIVIIADEVYQ 281
           +D +K+ IK  T ++I  NP NP G +++ +          E  + +  DEVY+
Sbjct: 142 LDTLKKAIKSNTKLIIINNPNNPLGCVISDELLTSICELCKEKNVYLHCDEVYR 195

>Kpol_480.1 s480 (215..1357) [1143 bp, 380 aa] {ON} (215..1357)
           [1143 nt, 381 aa]
          Length = 380

 Score = 32.0 bits (71), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 28/55 (50%), Gaps = 2/55 (3%)

Query: 227 QIVIDAIKQNIKPTTLVVINPGNPTGAILTKDSXXXXXXXXXEYGIVIIADEVYQ 281
           Q +   IK N K   +++ NP NP G+++ KD          E  I + +DEVY+
Sbjct: 142 QTLKSMIKNNTK--LIIINNPNNPLGSVIKKDLLKQICKLCEENDIYLHSDEVYR 194

>KLTH0G19624g Chr7 complement(1697587..1698993) [1407 bp, 468 aa]
           {ON} similar to uniprot|P10356 Saccharomyces cerevisiae
           YER152C Hypothetical ORF
          Length = 468

 Score = 32.0 bits (71), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 34/70 (48%), Gaps = 4/70 (5%)

Query: 215 SNNWSTDPKQIEQIVI----DAIKQNIKPTTLVVINPGNPTGAILTKDSXXXXXXXXXEY 270
           S+N  +  K  E + I    D  K+  +    +V    NPTGAI ++ S         +Y
Sbjct: 160 SSNGESGQKAEESLRIINAQDGKKKIYRYVIYLVPTYSNPTGAIYSRSSRLKLLELARKY 219

Query: 271 GIVIIADEVY 280
            I+II+D+VY
Sbjct: 220 DILIISDDVY 229

>NDAI0G02390 Chr7 complement(547355..550252) [2898 bp, 965 aa] {ON}
           Anc_8.359 YLR148W
          Length = 965

 Score = 32.0 bits (71), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 20/71 (28%), Positives = 40/71 (56%), Gaps = 3/71 (4%)

Query: 371 PPQPGDESYELDQLERSVIHSNLILKSNTLYDV-FTRLPGISCQKPQGAMYLFPRLHLSE 429
           P    + S +++  E+S+I  N + K +  YD  F     +  ++ + +++L+ +LHL E
Sbjct: 704 PLVSSERSEQMETYEQSII--NFLTKYHDKYDQDFILRLSLKFKRIKVSIFLYSQLHLYE 761

Query: 430 NAINAATELNL 440
           ++IN A + NL
Sbjct: 762 DSINLALQNNL 772

>Kwal_26.9050 s26 (1055019..1056113) [1095 bp, 364 aa] {ON} YCR105W
           - Hypothetical ORF [contig 68] FULL
          Length = 364

 Score = 31.2 bits (69), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 42/142 (29%), Positives = 60/142 (42%), Gaps = 16/142 (11%)

Query: 115 SIGGSVGAYSSSQGVLDIRKNVA--RFILKRDLH----HDPTQDLIDETASNVFLTAGAS 168
           ++G  V A S S   L+  K +    F+   D      H  + DLI  TAS+      + 
Sbjct: 203 ALGAEVTAISRSNRKLEDAKKLGADHFVAMEDKKLVEAHAESLDLIVMTASSF-----SE 257

Query: 169 TAVDHILPLFAKDESCGVLLPIPQYPLYTAAVTLQKSKLLPYYLNESNNWSTDPKQIEQI 228
           + +D +L L A     G  L     P     +TL    +L    + S +    PK IE +
Sbjct: 258 SNIDELLSLLA----AGGQLSFITGPPMQEKLTLNPFTMLLNDYHISGSVIGSPKDIEYM 313

Query: 229 VIDAIKQNIKP-TTLVVINPGN 249
           +  A+K NIKP   LV IN  N
Sbjct: 314 LEVAVKNNIKPWVQLVDINEKN 335

>KLTH0B00176g Chr2 (10791..12137) [1347 bp, 448 aa] {ON} similar to
           uniprot|P10356 Saccharomyces cerevisiae YER152C
           Hypothetical ORF
          Length = 448

 Score = 31.2 bits (69), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 20/32 (62%)

Query: 249 NPTGAILTKDSXXXXXXXXXEYGIVIIADEVY 280
           NPTGAI ++ S         +Y I+II+D+VY
Sbjct: 199 NPTGAIYSRSSRLKLLELARKYDILIISDDVY 230

>Smik_9.53 Chr9 (120672..121838) [1167 bp, 388 aa] {ON} YIL116W
           (REAL)
          Length = 388

 Score = 31.2 bits (69), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 31/134 (23%), Positives = 59/134 (44%), Gaps = 7/134 (5%)

Query: 147 HDPTQDLIDETASNVFLTAGASTAVDHILPLFAKDESCGVLLPIPQYPLYTAAVTLQKSK 206
           +DPT   +  +A N+ L  G+  ++D I+          +L+  P Y +Y+    +   +
Sbjct: 78  NDPTVKPL--SADNLCLGVGSDESIDAIIRACCVPGKEKILVLPPTYSMYSVCANINDVE 135

Query: 207 LLPYYLNESNNWSTDPKQIEQIVIDAIKQNIKPTTLVVINPGNPTGAILTKDSXXXXXXX 266
           ++   L  S+N     +   + V+  +  +     +   +PGNPTGA + K         
Sbjct: 136 VVQCPLTVSDN---SFQMNTEAVLTILNNDPLIKIMFATSPGNPTGAKI-KTCLIEEVLQ 191

Query: 267 XXEYGIVIIADEVY 280
             + GIV++ DE Y
Sbjct: 192 KWDNGIVVV-DEAY 204

>Kwal_47.17462 s47 (413555..415033) [1479 bp, 492 aa] {ON} YGL202W
           (ARO8) - aromatic amino acid aminotransferase [contig
           207] FULL
          Length = 492

 Score = 31.2 bits (69), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 40/152 (26%), Positives = 60/152 (39%), Gaps = 17/152 (11%)

Query: 145 LHHDPTQDLIDETASNVFLTAGASTAVDHILPLFAKDESCGVLLPIPQYPLYTAAVTLQK 204
            H  P QD       ++  T G++   D  L +F  ++   VLL    Y     A   Q 
Sbjct: 123 FHRIPYQDW------DIITTTGSTQGWDASLRIFC-NKGDTVLLEEYTYSSSVEAADAQG 175

Query: 205 SKLLPYYLNESNNWSTDPKQIEQIVI---DAIKQNIKPTTLVVINPG-NPTGAILTKDSX 260
              +P  L+        P+++E+++I   D       P  L  I  G NPTG  L+    
Sbjct: 176 LNCIPMPLDGEG---IIPEKLEEMLINWSDLYPDIPMPKLLYTIPTGQNPTGCTLSDSRK 232

Query: 261 XXXXXXXXEYGIVIIADEVY---QENVYEAFE 289
                   +Y ++II DE Y   Q + YE  E
Sbjct: 233 PYIYHLAQKYDMIIIEDEPYYFLQMDQYEPEE 264

>NCAS0G04050 Chr7 complement(753216..754370) [1155 bp, 384 aa] {ON}
           Anc_1.472
          Length = 384

 Score = 30.8 bits (68), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 29/54 (53%), Gaps = 2/54 (3%)

Query: 230 IDAIKQNIKPTTLVVI--NPGNPTGAILTKDSXXXXXXXXXEYGIVIIADEVYQ 281
           I+ +K+ IK  T ++I  NP NP G+ ++ ++         E  I +  DEVY+
Sbjct: 141 IETLKKMIKSNTKLIIINNPNNPLGSAISTETLNDICQLCEENNIYLHCDEVYK 194

>ZYRO0C06028g Chr3 (457564..459054) [1491 bp, 496 aa] {ON} highly
           similar to uniprot|P53090 Saccharomyces cerevisiae
           YGL202W ARO8 Aromatic aminotransferase expression is
           regulated by general control of amino acid biosynthesis
          Length = 496

 Score = 31.2 bits (69), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 42/160 (26%), Positives = 68/160 (42%), Gaps = 22/160 (13%)

Query: 222 PKQIEQIVIDAIKQNIKPTTLVVINPG-NPTGAILTKDSXXXXXXXXXEYGIVIIADEVY 280
           P+++E ++ +      KP  L  I  G NPTG  L  D          ++  +I+ DE Y
Sbjct: 189 PEKLEDLLDNWTPNAPKPKLLYTIPTGQNPTGTSLPNDRREAIYRIAQKHDFLIVEDEPY 248

Query: 281 --------------QENVYEAFEFHSFKKVLSELRKNYPSKYDNVQLASLHSISKGVNGE 326
                         +E VY A +  S ++    L K++ S     ++  L S SK +   
Sbjct: 249 YFLQVGDYIEDLKKREQVYSAPK-QSHEEFKKSLVKSFLSLDTEGRVIRLDSFSKVLG-- 305

Query: 327 CGQRGGYMEITGFSNDVKKVLLKVASISI-CSVVTGQILV 365
            G R G+  ITG S  + K  + +  ++I C     Q+LV
Sbjct: 306 PGTRLGW--ITG-SKQLMKAYVSLHEMTIQCPSGFSQVLV 342

>Suva_16.403 Chr16 complement(700071..702113) [2043 bp, 680 aa] {ON}
           YPR074C (REAL)
          Length = 680

 Score = 30.8 bits (68), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 12/28 (42%), Positives = 16/28 (57%)

Query: 472 HLRTTFLPPGIEWINSWEKFHLEFMEKY 499
           H + T L PG+E  N W K   E+ +KY
Sbjct: 296 HYQKTILKPGVEANNKWNKLFSEYQKKY 323

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.135    0.391 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 53,696,085
Number of extensions: 2335813
Number of successful extensions: 6563
Number of sequences better than 10.0: 103
Number of HSP's gapped: 6650
Number of HSP's successfully gapped: 103
Length of query: 500
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 386
Effective length of database: 40,409,475
Effective search space: 15598057350
Effective search space used: 15598057350
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 68 (30.8 bits)