Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0F013101.319ON74274236140.0
TDEL0D018801.319ON69171210661e-134
ZYRO0G20680g1.319ON69271610551e-133
NCAS0A092101.319ON71072410481e-131
Suva_6.1371.319ON71872310211e-127
Kpol_1035.241.319ON7177349861e-122
Smik_10.1791.319ON7137229751e-121
NDAI0G057501.319ON7347459551e-117
Skud_10.1581.319ON7167329521e-117
YJL061W (NUP82)1.319ON7137179421e-116
SAKL0D06930g1.319ON6907188871e-108
KAFR0A017201.319ON7166958162e-97
TPHA0O014601.319ON7217297917e-94
KNAG0C058401.319ON7477167902e-93
CAGL0J05214g1.319ON7167177575e-89
Kwal_14.25801.319ON6877337242e-84
KLTH0H10692g1.319ON6917366709e-77
Ecym_62901.319ON6717226672e-76
AEL168C1.319ON6737315111e-54
KLLA0F01661g1.319ON6877314254e-43
KNAG0H004002.623ON46747820.27
YOR038C (HIR2)5.634ON87574752.7
KLLA0F04499g2.236ON19143704.4
KAFR0C060105.634ON87445725.1
YLR115W (CFT2)8.308ON85972725.2
NCAS0H026805.551ON42377725.2
Smik_15.2175.634ON87574725.7
Kwal_23.34302.321ON19143696.1
ADL290W2.321ON19143696.2
Kwal_23.47832.236ON19143697.0
ZYRO0C05060g6.104ON71647717.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0F01310
         (742 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0F01310 Chr6 complement(329569..331797) [2229 bp, 742 aa] {O...  1396   0.0  
TDEL0D01880 Chr4 (366715..368790) [2076 bp, 691 aa] {ON} Anc_1.3...   415   e-134
ZYRO0G20680g Chr7 complement(1703031..1705109) [2079 bp, 692 aa]...   410   e-133
NCAS0A09210 Chr1 complement(1820713..1822845) [2133 bp, 710 aa] ...   408   e-131
Suva_6.137 Chr6 complement(228953..231109) [2157 bp, 718 aa] {ON...   397   e-127
Kpol_1035.24 s1035 complement(57897..60050) [2154 bp, 717 aa] {O...   384   e-122
Smik_10.179 Chr10 (311844..313985) [2142 bp, 713 aa] {ON} YJL061...   380   e-121
NDAI0G05750 Chr7 (1424856..1427060) [2205 bp, 734 aa] {ON} Anc_1...   372   e-117
Skud_10.158 Chr10 complement(296754..298904) [2151 bp, 716 aa] {...   371   e-117
YJL061W Chr10 (320016..322157) [2142 bp, 713 aa] {ON}  NUP82Link...   367   e-116
SAKL0D06930g Chr4 complement(573700..575772) [2073 bp, 690 aa] {...   346   e-108
KAFR0A01720 Chr1 complement(349779..351929) [2151 bp, 716 aa] {O...   318   2e-97
TPHA0O01460 Chr15 complement(293395..295560) [2166 bp, 721 aa] {...   309   7e-94
KNAG0C05840 Chr3 (1135516..1137759) [2244 bp, 747 aa] {ON} Anc_1...   308   2e-93
CAGL0J05214g Chr10 complement(501919..504069) [2151 bp, 716 aa] ...   296   5e-89
Kwal_14.2580 s14 complement(821497..823560) [2064 bp, 687 aa] {O...   283   2e-84
KLTH0H10692g Chr8 complement(921787..923862) [2076 bp, 691 aa] {...   262   9e-77
Ecym_6290 Chr6 (543547..545562) [2016 bp, 671 aa] {ON} similar t...   261   2e-76
AEL168C Chr5 complement(320121..322142) [2022 bp, 673 aa] {ON} S...   201   1e-54
KLLA0F01661g Chr6 complement(156609..158672) [2064 bp, 687 aa] {...   168   4e-43
KNAG0H00400 Chr8 complement(58817..60220) [1404 bp, 467 aa] {ON}...    36   0.27 
YOR038C Chr15 complement(402761..405388) [2628 bp, 875 aa] {ON} ...    33   2.7  
KLLA0F04499g Chr6 complement(434569..435144) [576 bp, 191 aa] {O...    32   4.4  
KAFR0C06010 Chr3 complement(1196930..1199554) [2625 bp, 874 aa] ...    32   5.1  
YLR115W Chr12 (377985..380564) [2580 bp, 859 aa] {ON}  CFT2Subun...    32   5.2  
NCAS0H02680 Chr8 (529371..530642) [1272 bp, 423 aa] {ON} Anc_5.551     32   5.2  
Smik_15.217 Chr15 complement(368813..371440) [2628 bp, 875 aa] {...    32   5.7  
Kwal_23.3430 s23 complement(286045..286620) [576 bp, 191 aa] {ON...    31   6.1  
ADL290W Chr4 (191546..192121) [576 bp, 191 aa] {ON} Non-syntenic...    31   6.2  
Kwal_23.4783 s23 (865055..865630) [576 bp, 191 aa] {ON} YNL067W ...    31   7.0  
ZYRO0C05060g Chr3 complement(397083..399233) [2151 bp, 716 aa] {...    32   7.3  

>TBLA0F01310 Chr6 complement(329569..331797) [2229 bp, 742 aa] {ON}
           Anc_1.319 YJL061W
          Length = 742

 Score = 1396 bits (3614), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 693/742 (93%), Positives = 693/742 (93%)

Query: 1   MTTSIESTYLEGHNPTSHPIFKRNYLSSSFQETSPRFFFTTNRDNRVVVVQDGSIRWCYT 60
           MTTSIESTYLEGHNPTSHPIFKRNYLSSSFQETSPRFFFTTNRDNRVVVVQDGSIRWCYT
Sbjct: 1   MTTSIESTYLEGHNPTSHPIFKRNYLSSSFQETSPRFFFTTNRDNRVVVVQDGSIRWCYT 60

Query: 61  FSQNYHSYTIASRNFDIKDSLISNSGSFVCYYSDTDISIMEIPWXXXXXXXXXXXXCIQK 120
           FSQNYHSYTIASRNFDIKDSLISNSGSFVCYYSDTDISIMEIPW            CIQK
Sbjct: 61  FSQNYHSYTIASRNFDIKDSLISNSGSFVCYYSDTDISIMEIPWSHSNSVNASSSHCIQK 120

Query: 121 YRYSFKKYSLTVKQVLFHPLATLESCLVVLLSDDTIVFIXXXXXXXXXXXXYILNKKSKS 180
           YRYSFKKYSLTVKQVLFHPLATLESCLVVLLSDDTIVFI            YILNKKSKS
Sbjct: 121 YRYSFKKYSLTVKQVLFHPLATLESCLVVLLSDDTIVFIDFSKSFDLLSSDYILNKKSKS 180

Query: 181 IGLSSQISDIQSLTFSQDGLTLYALSSSAATDVYAFYPCLPPSAQFSLEQLENLVNKSVV 240
           IGLSSQISDIQSLTFSQDGLTLYALSSSAATDVYAFYPCLPPSAQFSLEQLENLVNKSVV
Sbjct: 181 IGLSSQISDIQSLTFSQDGLTLYALSSSAATDVYAFYPCLPPSAQFSLEQLENLVNKSVV 240

Query: 241 QYEELREDDPTALKINIIKQLKFTSDLYKKGKRALEEDTDSKTWKYDVPLEYRLIRPQGP 300
           QYEELREDDPTALKINIIKQLKFTSDLYKKGKRALEEDTDSKTWKYDVPLEYRLIRPQGP
Sbjct: 241 QYEELREDDPTALKINIIKQLKFTSDLYKKGKRALEEDTDSKTWKYDVPLEYRLIRPQGP 300

Query: 301 FTISPFPDSLYYSSPTHIVSVPIDTTNELLVLSFSDGSVVSLFQDLELTMSWDQDNFNEN 360
           FTISPFPDSLYYSSPTHIVSVPIDTTNELLVLSFSDGSVVSLFQDLELTMSWDQDNFNEN
Sbjct: 301 FTISPFPDSLYYSSPTHIVSVPIDTTNELLVLSFSDGSVVSLFQDLELTMSWDQDNFNEN 360

Query: 361 NSLVLLELIKTKEQNIRKLTTYAHQYGTFYILGSVKNFEVLTSHWSSTLAICIKSSDIRD 420
           NSLVLLELIKTKEQNIRKLTTYAHQYGTFYILGSVKNFEVLTSHWSSTLAICIKSSDIRD
Sbjct: 361 NSLVLLELIKTKEQNIRKLTTYAHQYGTFYILGSVKNFEVLTSHWSSTLAICIKSSDIRD 420

Query: 421 LSNLLIKSVIKPFDNAAYELTSGGWWCSPTISSLLFINKSTVIELNEKPKXXXXXXXXXX 480
           LSNLLIKSVIKPFDNAAYELTSGGWWCSPTISSLLFINKSTVIELNEKPK          
Sbjct: 421 LSNLLIKSVIKPFDNAAYELTSGGWWCSPTISSLLFINKSTVIELNEKPKLLLSDDTTHL 480

Query: 481 XXXXXAQKYIPPLEDKIFKIELPMGILISDLNNMNTVFKEESNKQLTIPIPSQERNVTLF 540
                AQKYIPPLEDKIFKIELPMGILISDLNNMNTVFKEESNKQLTIPIPSQERNVTLF
Sbjct: 481 LTSELAQKYIPPLEDKIFKIELPMGILISDLNNMNTVFKEESNKQLTIPIPSQERNVTLF 540

Query: 541 NKTNENQLETLTKISKVIGIKISMGQSLGFGIYNKILDQQNIVEXXXXXXXXXXEKEKIL 600
           NKTNENQLETLTKISKVIGIKISMGQSLGFGIYNKILDQQNIVE          EKEKIL
Sbjct: 541 NKTNENQLETLTKISKVIGIKISMGQSLGFGIYNKILDQQNIVELQLRQTQRLLEKEKIL 600

Query: 601 NTKYNEQADKLRAFTERQEKLMSRLLIMNEKLKKADLDTNLLNISISKKELEFFKEIRKQ 660
           NTKYNEQADKLRAFTERQEKLMSRLLIMNEKLKKADLDTNLLNISISKKELEFFKEIRKQ
Sbjct: 601 NTKYNEQADKLRAFTERQEKLMSRLLIMNEKLKKADLDTNLLNISISKKELEFFKEIRKQ 660

Query: 661 VLLFNEFVHKQKDQHDTLLFIKKELIRIKGENAIVDENDFKQWDRLRDMLHDDATTIETC 720
           VLLFNEFVHKQKDQHDTLLFIKKELIRIKGENAIVDENDFKQWDRLRDMLHDDATTIETC
Sbjct: 661 VLLFNEFVHKQKDQHDTLLFIKKELIRIKGENAIVDENDFKQWDRLRDMLHDDATTIETC 720

Query: 721 TESIKNINFDLDRALKKDSLSI 742
           TESIKNINFDLDRALKKDSLSI
Sbjct: 721 TESIKNINFDLDRALKKDSLSI 742

>TDEL0D01880 Chr4 (366715..368790) [2076 bp, 691 aa] {ON} Anc_1.319
           YJL061W
          Length = 691

 Score =  415 bits (1066), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 250/712 (35%), Positives = 373/712 (52%), Gaps = 36/712 (5%)

Query: 17  SHPIFKRNYLSSSFQETSPRFFFTTNRDNRVVVVQDGSIRWCYTFSQNYHSYTIASRNFD 76
           +HPIF+    S + Q  S RFF TT+   R VVVQD  IRWC      YHS T+     D
Sbjct: 5   THPIFRP---SLTAQSGSDRFFLTTSDGGRAVVVQDSCIRWCNVSEPGYHSMTLERAFKD 61

Query: 77  IKDSLISNSGSFVCYYSDTDISIMEIPWXXXXXXXXXXXXCIQKYRYSFKKYSLTVKQVL 136
           +K  ++SNSG F+C Y+D ++ I+E+PW              Q +R  F      +KQVL
Sbjct: 62  VKHVVMSNSGEFLCLYNDDELRIIEVPWAYTEVSSMAN--AFQLFR--FVSDEARIKQVL 117

Query: 137 FHPLATLESCLVVLLSDDTIVFIXXXXXXXXXXXXYILNKKSKSIGLSSQISDIQSLTFS 196
           FHPLA  +  +V+L  DD+I  +             +LN  + +  L S I+D++ +TFS
Sbjct: 118 FHPLAYQQETVVILKDDDSITIMNWQDFGDSKPD--VLNLSNGTYSLDSSITDVECITFS 175

Query: 197 QDGLTLYALSSSAATDVYAFYPCLPPSAQFSLEQLENLVNKSVVQYEELREDDPTALKIN 256
           QDGLTLY LS S   D+YAFYPCL P  QF  + L+ L+ KS++QY+ L     + +K N
Sbjct: 176 QDGLTLYVLSVSEGADIYAFYPCLAPRMQFDKQGLDRLMYKSLIQYDVLNVGTDSEVKRN 235

Query: 257 IIKQLKFTSDLYKK--GKRALEEDTDSKTWKYDVPLEYRLIRPQGPFTISPFPDSLYYSS 314
            IKQLKF S L+K+   +R LE           +P   R +R QGPFTI+PFP  +Y S+
Sbjct: 236 TIKQLKFVSGLHKQQNSQRILE-----------IPEAQRQVRGQGPFTIAPFPKQIYSST 284

Query: 315 PTHIVSVPIDTTNELLVLSFSDGSVVSLFQDLELTMSWDQDNFNENNSLVLLELIKTKEQ 374
            T I S+PI+  NELL++S  DG++  L QDL++TM+WD   +N NNS  L+ELI    Q
Sbjct: 285 GTGIASLPINDQNELLIMSLDDGNIAILLQDLDVTMNWDSARYNYNNSFALVELITLGSQ 344

Query: 375 NIRKLTTYAHQYGTFYILGSVKNFEVLTSHWSSTLAICIKSSDIRDLSNLLIKSVIKPFD 434
            I+++    H+YG F ++     F + TS WS  +A C+  SD+R L+   ++S +  F 
Sbjct: 345 EIQQIVVGDHKYGQFSVMTPEGVFSIDTSKWSGVMASCLTESDLRPLAETKLESEVT-FT 403

Query: 435 NAAYELTSGGWWCSPTISSLLFINKSTVIELNEKPKXXXXXXXXXXXXXXXAQKYIPPLE 494
                  S  WW +   S +   N+   ++  +  +                +KY     
Sbjct: 404 ELKDSPKSVAWWNTTPQSVVKVSNRE--VKSKQVSEGVSKQDDDITGSRQEPEKYNAHYS 461

Query: 495 DKIFKIELPMGILISDLNNMNTVFKEESNKQLTIPIPSQERNVTLFNKTNENQLETLTKI 554
                        I+++  +N  F+ ES+K  +  IP +ER   L N+ +E QL+ LT+ 
Sbjct: 462 QP-----------IAEIMQLNQKFQLESSKAPSKVIPPRERQKPLKNEASEIQLDLLTEA 510

Query: 555 SKVIGIKISMGQSLGFGIYNKILDQQNIVEXXXXXXXXXXEKEKILNTKYNEQADKLRAF 614
           SK    KI++GQ+LG  ++N+I +QQ  +           EK++ + T ++ Q+ +  A 
Sbjct: 511 SKDFVSKIAVGQTLGVTLHNRIYEQQLDLTHQLKASGELMEKQQTILTHFHSQSSRSDAV 570

Query: 615 TERQEKLMSRLLIMNEKLKKADLDTNLLNISISKKELEFFKEIRKQVLLFNEFVHKQKDQ 674
             R   LMSR     + L +        ++ ISK+E+E+FKEIRKQVL FN  VH QK  
Sbjct: 571 HARHSTLMSRFNKFKDNLGQIQNSQRFKDLEISKEEVEWFKEIRKQVLTFNRDVHNQKRL 630

Query: 675 HDTLLFIKKELIRIKGENAIVDENDFKQWDRLRDMLHDDATTIETCTESIKN 726
            D L+ +K+E+ RI       +     +W  LR ML +D   ++ C   +K+
Sbjct: 631 QDQLIHLKQEMNRIAQVTGDQNSQARDEWHELRHMLEEDTIILQDCNNQLKS 682

>ZYRO0G20680g Chr7 complement(1703031..1705109) [2079 bp, 692 aa]
           {ON} similar to uniprot|P40368 Saccharomyces cerevisiae
           YJL061W NUP82 Subunit of the nuclear pore complex (NPC)
           forms a subcomplex with Nup159p and Nsp1p interacts with
           Nup116p and is required for proper localization of
           Nup116p in the NPC
          Length = 692

 Score =  410 bits (1055), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 249/716 (34%), Positives = 387/716 (54%), Gaps = 43/716 (6%)

Query: 17  SHPIFKRNYLSSSFQETSPRFFFTTNRDNRVVVVQDGSIRWCYTFSQNYHSYTIASRNFD 76
           SH IFKR   SS       RF  T+   ++VV+ QD SIRWC  F   Y    +     D
Sbjct: 5   SHSIFKRASGSSK------RFLCTSQDGSKVVIYQDSSIRWCNAFDSKYEFMLLEPTIED 58

Query: 77  IKDSLISNSGSFVCYYSDTDISIMEIPWXXXXXXXXXXXXCIQKYRYSF-KKYSLTVKQV 135
           ++  ++S +G+ +  Y+  ++ I+EIPW              QK+RYS   +    +K+V
Sbjct: 59  VEHVVLSPTGTLLLLYNSREVRIVEIPWGYSQVSYEG----FQKFRYSVDSRQDPLIKKV 114

Query: 136 LFHPLATLESCLVVLLSDDTIVFIXXXXXXXXXXXXYILNKKSKSIGLSSQISDIQSLTF 195
           LFHPLA  E C+V+L +D+TI  +             +LN+   + G+   ++DI+S+TF
Sbjct: 115 LFHPLAYREHCIVILKTDNTIHLLDRYYPYDKQPKLLVLNQHDGAFGMEGLVTDIESITF 174

Query: 196 SQDGLTLYALSSSAATDVYAFYPCLPPSAQFSLEQLENLVNKSVVQYEELREDDPTALKI 255
           SQDGLTLYALS +   D+YAFYPCLP S +    +L+ L++KS+VQYE L  + P A K 
Sbjct: 175 SQDGLTLYALSVAEGCDIYAFYPCLPCSIEIDSHKLDLLMHKSLVQYENLSVETPDATKR 234

Query: 256 NIIKQLKFTSDLYKKGKRALEEDTDSKTWKYDVPLEYRLIRPQGPFTISPFPDSLYYSSP 315
           N IKQ +F S L    ++ LE D      K D+P+++  +R QGPFTI+PFPD  Y  + 
Sbjct: 235 NTIKQFQFISKL----RQGLENDQT----KIDIPMDWLRVRGQGPFTIAPFPDRYYDRTA 286

Query: 316 THIVSVPIDTTNELLVLSFSDGSVVSLFQDLELTMSWDQDNFNENNSLVLLELIKTKEQN 375
             +  +PI   N+LL++SF DG++V L+QDLELTM WD   ++ NNSLVL+E I+ +   
Sbjct: 287 VQLKILPIGANNDLLLMSFDDGTIVVLYQDLELTMCWDSKGYSYNNSLVLVESIRLERG- 345

Query: 376 IRKLTTYAHQYGTFYILGSVKN-FEVLTSHWSSTLAICIKSSDIRDLSNLLIKSVIKPFD 434
             +L         F++LG   + + V TS WS  L+ CI +SD+  +++L  KS I   +
Sbjct: 346 --ELVLKQGTLSQFFVLGGTSDIYLVDTSPWSKILSNCIDNSDLEPIADLQFKSEISKIE 403

Query: 435 NAAYELTSGGWWCSPTISSLLFINKSTVI----ELNEKPKXXXXXXXXXXXXXXXAQKYI 490
             + ++ S   W   T    +F++K TV      +N++P                A   I
Sbjct: 404 GVS-QIDSYAMWKKDTEPKDVFVSKDTVFVKSTAVNDQP--------STVKDEKKANVDI 454

Query: 491 PPLEDKIFKIELPMGILISDLNNMNTVFKEESNKQLTIPIPSQERNVTLFNKTNENQLET 550
           P       + E+ +   +S++ ++N  F+ E+ K L+  +   +R   L N++NE QLE 
Sbjct: 455 P-------RYEVALNQPMSEILSLNASFQTEAKKPLSKLVEPSKRQTKLNNESNEEQLEI 507

Query: 551 LTKISKVIGIKISMGQSLGFGIYNKILDQQNIVEXXXXXXXXXXEKEKILNTKYNEQADK 610
           LT +SK    KI   Q+LGF ++N+ L+QQ  +            K+  L +K   Q+ +
Sbjct: 508 LTTVSKEFLQKIVKAQALGFNLHNRCLEQQYELTRQLQYSSEILSKQDKLRSKAQSQSSE 567

Query: 611 LRAFTERQEKLMSRLLIMNEKLKKADLDTNLLNISISKKELEFFKEIRKQVLLFNEFVHK 670
             +  +RQ+KL+ R   ++EKL + +       ++I+ KE+ +FKEIR QVL+FN++VH 
Sbjct: 568 CESKIQRQDKLLQRFNSLSEKLGRINESPKFREMNITDKEMAWFKEIRNQVLVFNQYVHH 627

Query: 671 QKDQHDTLLFIKKELIRIKGENAIVDENDFKQWDRLRDMLHDDATTIETCTESIKN 726
           QK+Q D L +++KEL  I  E+  V E    +W  L  +L  D   I+ C   + +
Sbjct: 628 QKNQQDQLRYLQKELENISLEDKDVGEKSKSEWTELLSILESDTKIIKECNNQLAH 683

>NCAS0A09210 Chr1 complement(1820713..1822845) [2133 bp, 710 aa]
           {ON} Anc_1.319 YJL061W
          Length = 710

 Score =  408 bits (1048), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 254/724 (35%), Positives = 393/724 (54%), Gaps = 43/724 (5%)

Query: 16  TSHPIFKRNYLSSSFQETSPRFFFTTNRDNRVVVVQDGSIRWCYTFSQNYHSYTI---AS 72
            SHPIF+        Q+ +PRF FT++   R+VV+Q G +RWC   + +++S TI     
Sbjct: 8   ASHPIFQG---LDCTQDAAPRFLFTSHHGTRMVVLQGGLLRWCSVTASSFNSMTIDFFQP 64

Query: 73  RNFDIKDSLISNSGSFVCYYSDTDISIMEIPWXXXXXXXXXXXXCIQKYRYSFK---KYS 129
            +   + +++SNSG F+C Y++  I ++EIPW              Q + Y+ K    YS
Sbjct: 65  ESTAPQKAILSNSGEFICVYTNHTIEVIEIPWGYVTPSPSMVSK-FQLFSYNNKDDDGYS 123

Query: 130 LTVKQVLFHPLATLESCLVVLLSDDTIVFIXXXXXXXXXXXXYILNKKSKSIGLSSQISD 189
             +KQVLFHP A  +SCLVVL  + TI  +              LNK+  + G+ +QI+D
Sbjct: 124 -PIKQVLFHPEAYKDSCLVVLYDNGTISLMDVTQITKTIT----LNKRVATFGIDTQITD 178

Query: 190 IQSLTFSQDGLTLYALSSSAATDVYAFYPCLPPSAQFSLEQLENLVNKSVVQYEELREDD 249
           I+S+ FS+DG TLYALS S   D+YAFYPCLP   +   E++ +L+++SV+ YE L+ D 
Sbjct: 179 IESICFSKDGWTLYALSISDGGDIYAFYPCLPQQLEVKREKITSLLHESVLLYESLKLDT 238

Query: 250 PTALKINIIKQLKFTSDLYKKGKRALEEDTDSKTWKYDVPLEYRLIRPQGPFTISPFPDS 309
              +K N+I+Q++F + L        E + +S     ++  EYRLIR QGPFTI P+P+ 
Sbjct: 239 DRDVKRNVIRQVQFVNKL---NGLLTENEKNSNEDFIEIEQEYRLIRGQGPFTIDPYPER 295

Query: 310 LYYSSPTHIVSVPIDTTNELLVLSFSDGSVVSLFQDLELTMSWDQDNFNENNSLVLLELI 369
           LY ++   I ++PI++ NEL+ + F DGS+  LF+DL LTMSWD DN+  NNS  L+EL+
Sbjct: 296 LYSATALEISTLPINSNNELMCMIFDDGSIALLFKDLPLTMSWDVDNYVHNNSFSLVELM 355

Query: 370 KTKEQNIRKLTTYAHQYGTFYILGSVKNFEVLTSHWSSTLAICIKSSDIRDLSNLLIKSV 429
           + K+ +++++ +Y   YG F+I G    F V T  WS  LA  I +S++ +L  +   S 
Sbjct: 356 QLKDTDVKRIVSYPDTYGQFFIFGDSSLFLVHTHIWSDLLAKAIDNSNLNELLEMNFTSK 415

Query: 430 IKPFDNAAYELTSGGWWCSPT----ISSLLFINKSTV----IELNEKPKXXXXXXXXXXX 481
           +  F     E T+G   CSP        +LFI K  V    +E+ +              
Sbjct: 416 LDFF-----ETTNGITKCSPCKWRGRDVILFITKEDVYMHPVEMRKSGILGNNKPVLVNN 470

Query: 482 XXXXAQKYIPPLEDKIFKIELPMGILISDLNNMNTVFKEESNKQLTIPIPSQERNVTLFN 541
                Q+Y    +             + +L  +N +F+++ +  ++  I  +ER V L N
Sbjct: 471 EELKHQEYKTSFKQP-----------VEELMALNKLFQQQCSMGVSKLIAPEERQVLLNN 519

Query: 542 KTNENQLETLTKISKVIGIKISMGQSLGFGIYNKILDQQNIVEXXXXXXXXXXEKEKILN 601
           + NE QLE L+ +SK +  KI  GQ+L   +++++L+QQ  +            K+  L 
Sbjct: 520 ENNEVQLELLSDVSKEVISKIGQGQNLALNLHHRLLEQQYELTRQLKIVHTIMSKQSDLR 579

Query: 602 TKYNEQADKLRAFTERQEKLMSRLLIMNEKLKKADLDTNLLNISISKKELEFFKEIRKQV 661
            K  EQ+ +    T R  +L+ RL  ++ K+ + +    L    I+ KELE+FKEIR QV
Sbjct: 580 RKSEEQSRRWDDQTSRSSQLIKRLQDLDAKILEINNSPKLKEYPINDKELEWFKEIRNQV 639

Query: 662 LLFNEFVHKQKDQHDTLLFIKKELIRIKGENA-IVDENDFKQWDRLRDMLHDDATTIETC 720
           L FN FVH Q+D  + L  +KK+L RI  E + + DE   K+WD LRD+L  DA  I+ C
Sbjct: 640 LKFNSFVHNQRDAQEELNHLKKDLARISKETSQLRDEKSDKEWDELRDILKHDAQIIQEC 699

Query: 721 TESI 724
            + +
Sbjct: 700 NKEL 703

>Suva_6.137 Chr6 complement(228953..231109) [2157 bp, 718 aa] {ON}
           YJL061W (REAL)
          Length = 718

 Score =  397 bits (1021), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 253/723 (34%), Positives = 384/723 (53%), Gaps = 36/723 (4%)

Query: 19  PIFKRNYLSSSFQETSPRFFFTTNRDNRVVVVQDGSIRWCYTFSQ-NYHSYTIASRNFDI 77
           PIF+    +S     SPR+ F+++   R+VV+QD  IRWC   +  +YHS    SR+  +
Sbjct: 11  PIFQ----ASLSANQSPRYIFSSHNGTRLVVIQDDIIRWCSLLTDPSYHSLNF-SRHLVL 65

Query: 78  KD---SLISNSGSFVCYYSDTDISIMEIPWXXXXXXXXXXXXCIQKYRYSFKKYSLT--- 131
            D   ++ S SG  +C+YSD +I +MEIPW              Q + YS  +  L    
Sbjct: 66  DDTFHAISSASGDLLCFYSDQEIFVMEIPWGYLNLGDVSIQDAFQVFHYSVDELELGSNS 125

Query: 132 -VKQVLFHPLATLESCLVVLLSDDTIVFIXXXXXXXXXXXXYILNKKSKSIGLSSQISDI 190
            +K+VLFHP +  +SC+VVL +DDTI                ILNK++ S GL ++++DI
Sbjct: 126 PIKKVLFHPKSYNDSCIVVLKNDDTITMFDILNQQEAPI---ILNKRNSSFGLDARVNDI 182

Query: 191 QSLTFSQDGLTLYALSSSAATDVYAFYPCLPPSAQFSLEQLENLVNKSVVQYEELREDDP 250
               FS+DGLTLY L+++   D++AFYP LP     S + L  ++NKS+V YE L     
Sbjct: 183 TDFAFSKDGLTLYCLNTTEGGDIFAFYPFLPSVLSLSEKDLGWILNKSLVMYESLNATTD 242

Query: 251 TALKINIIKQLKFTSDLYKKGKRALEEDTDSKTWKYDVPLEYRLIRPQGPFTISPFPDSL 310
             +K NI KQL+F S L+K        + DSK  K  +  EYRL++ QGPFTI+PFP+ L
Sbjct: 243 YKVKRNITKQLQFVSKLHK--------NWDSKLAKVKIDDEYRLVKMQGPFTINPFPNEL 294

Query: 311 YYSSPTHIVSVPIDTT-NELLVLSFSDGSVVSLFQDLELTMSWDQDNFNENNSLVLLELI 369
           Y  + + I ++PID   NE++ +SF DGS++ LFQDLE++MSWD DN+  NNSL+L+E I
Sbjct: 295 YDFTASKITTIPIDNQQNEIVCVSFDDGSLIILFQDLEMSMSWDVDNYVYNNSLILIERI 354

Query: 370 KTKEQNIRKLTTYAHQYGTFYILGSVKNFEVLTSHWSSTLAICIKSSDIRDLSNLLIKSV 429
           K +++ ++ LT    Q G  Y+       ++  + W+S L+ CI  SD+  L+++     
Sbjct: 355 KLQQKEMKSLTALPDQLGKLYVTLESSVHQLDCTSWTSVLSKCIDESDLNALADV---KF 411

Query: 430 IKPFDNAA--YELTSGGW--WCSPTISSLLFINKSTVIELNEKPKXXXXXXXXXXXXXXX 485
           +  F++ A  ++L++  +  W   +  +L+   K T+  ++   K               
Sbjct: 412 VSKFEDIATIHQLSNFAYINWNDKSSLALISKEKLTIQNISNHKKEQSLNAPAELDTNVN 471

Query: 486 AQKYIPPLEDKIFKIELPMGILISDLNNMNTVFKEESNKQLTIPIPSQERNVTLFNKTNE 545
           + K              P+  ++S    +N  F++         IP  +R + L N+ NE
Sbjct: 472 SDKSDTGKRGYEISFTQPINEILS----LNESFQKVCLSPCERIIPPADRQLPLKNEANE 527

Query: 546 NQLETLTKISKVIGIKISMGQSLGFGIYNKILDQQNIVEXXXXXXXXXXEKEKILNTKYN 605
           NQLE  T ISK    KI   QSLG  IYN+I +QQ  +            K++IL  K  
Sbjct: 528 NQLEIFTDISKEFLRKIIKAQSLGVSIYNRIHEQQFELTRQLQSTSKIIAKDEILQKKLE 587

Query: 606 EQADKLRAFTERQEKLMSRLLIMNEKLKKADLDTNLLNISISKKELEFFKEIRKQVLLFN 665
            Q +K  + + RQ +LM+R   + E L K          +IS  E+E+FKEIR Q+L FN
Sbjct: 588 AQTEKWNSQSSRQAELMTRFGKLTENLSKVAESDKFKEQNISHGEMEWFKEIRNQILQFN 647

Query: 666 EFVHKQKDQHDTLLFIKKELIRIKGENAIVDENDFKQWDRLRDMLHDDATTIETCTESIK 725
            FVH QK     L ++K+ELIRI+ E    D+    +WD LR ML  D+  I+ C E + 
Sbjct: 648 GFVHSQKSIQQDLSYLKRELIRIESETINADKKSQNEWDELRKMLEVDSKIIKECNEELV 707

Query: 726 NIN 728
           +++
Sbjct: 708 HVS 710

>Kpol_1035.24 s1035 complement(57897..60050) [2154 bp, 717 aa] {ON}
           complement(57897..60050) [2154 nt, 718 aa]
          Length = 717

 Score =  384 bits (986), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 247/734 (33%), Positives = 392/734 (53%), Gaps = 49/734 (6%)

Query: 18  HPIFKRNYLSSSFQETSPRFFFTTNRDNRVVVVQDGSIRWCYTFSQNYHSYTIASRN--F 75
           +PIFKR  +S   +E + RFFF+ N   R+++ QD +IRW ++ S N H  ++A R+   
Sbjct: 6   NPIFKRPSVS---RELTKRFFFSANNGTRIILFQDSTIRWSFS-SDNDHYQSMALRDSDM 61

Query: 76  DIKDSLISNSGSFVCYYSDTDISIMEIPWXXXXXXXXXXXXC--IQKYRYSFKKYSLTVK 133
           D+  ++IS+ G ++C Y+   I ++EIPW               +Q+  Y+F +  L+VK
Sbjct: 62  DVTGAIISDPGDYLCLYNSHQIRVIEIPWGLTNVDEISNSMASSLQERVYNFNEDKLSVK 121

Query: 134 QVLFHPLATLESCLVVLLSDDTIVFIXXXXXXXXXXX---XYILNKKSKSIGLSSQISDI 190
           QVLFHPL+     LVVL S   I F+               ++    S  +G+ +++ +I
Sbjct: 122 QVLFHPLSKSSPFLVVLFSGSQIAFVDLKNVFKSSDIPIDCFLNLTDSNVMGIDNRVENI 181

Query: 191 QSLTFSQDGLTLYALSSSAATDVYAFYPCLPPSAQFSLEQLENLVNKSVVQYEELREDDP 250
           Q + F+ D L+LY+L+    TDVY FYPCLPP A  S  +++ L+NKS+V YE L  D  
Sbjct: 182 QYVVFADDCLSLYSLTD---TDVYCFYPCLPPVASLSKNRVDELINKSIVLYENLGIDAD 238

Query: 251 TALKINIIKQLKFTSDLYKKGKRALEEDTDSKTWKYDVPLEYRLIRPQGPFTISPFPDSL 310
             ++ N+IKQL+  S L KK +   E          ++ LE+R  + QG F+ISP+P+SL
Sbjct: 239 DIVRKNVIKQLQLASSLRKKIEE-FENANGEVEVNVEIDLEFRQTKAQGYFSISPYPESL 297

Query: 311 YYSSPTHIVSVPIDTTNELLVLSFSDGSVVSLFQDLELTMSWDQDNFNENNSLVLLELIK 370
           Y  +   I  +PI   NEL ++SF +G+V+ +F+D E TMSWD ++++ NNS  L+E+IK
Sbjct: 298 YTCTGKQISVLPIGEGNELFLVSFDNGTVLVVFKDKESTMSWDVNDYSFNNSFTLVEIIK 357

Query: 371 TKEQNIRKLTTYAHQYGTFYILGSVKNFEVLTSHWSSTLAICIKSSDIRDLSNLLIKSVI 430
            K + +  +     + G F + G      V T+ WSS ++ CI+ +D+R L  L +KS I
Sbjct: 358 FKPEELSNMVVLQGELGKFVVSGEKSTILVDTTKWSSVISKCIRDNDLRPLVGLEMKSTI 417

Query: 431 KPFDNAAYELTSGGWWCSPTISSLLFINKSTVI-------ELNEKPKXXXXXXXXXXXXX 483
               N+  ++ S G W S    SLL ++ + V+       E+  KP+             
Sbjct: 418 THI-NSDMQINSCGIWNSGEAKSLLLVDTNVVVGYQLFKKEVEFKPE------------- 463

Query: 484 XXAQKYIPPLED-KIFKIELPMGILISDLNNMNTVFKEESNKQLTIPIPSQERNVTLFNK 542
             A++    LE+  + K  +P     ++L   N  F+E  +   +  IP+  + V   + 
Sbjct: 464 -SAEEISTELENFTLDKFTVPE----NELKAANYKFQEAVSVPYSKVIPANIKQVPFGSN 518

Query: 543 TNENQLETLTKISKVIGIKISMGQSLGFGIYNKILDQQNIVEXXXXXXXXXXEKEKILNT 602
             E QL+ L  IS+ +G KI  GQSLG  +Y+++L+QQ+ +            + K +  
Sbjct: 519 AMEEQLKILNDISRDVGSKIVQGQSLGLMLYDRLLEQQDKLSEQLIITNKILIRAKKVQG 578

Query: 603 KYNEQADKLRAFTERQEKLMSRLLIMNEKLKKADLDTNLLNISISKKELEFFKEIRKQVL 662
            Y  Q  KL    ++QE L   LL M   L        L ++ +S+KE++ FKE+R Q+L
Sbjct: 579 DYPAQLSKLDEKLKKQEHLEKILLKMESNLNTIQESQKLKSLPLSEKEIQLFKELRSQIL 638

Query: 663 LFNEFVHKQKDQHDTLLFIKKELIRI----KGENAIVDENDFKQWDRLRDMLHDDATTIE 718
           LFN FVHKQKDQ   + F+KKEL +I    + E++   +    +W+ LR +L DDA  I+
Sbjct: 639 LFNNFVHKQKDQKQNIQFLKKELQKIIDISRSESS---KGMLNEWEELRQILADDAKIIK 695

Query: 719 TCTESIKNINFDLD 732
            C E +  I+ +LD
Sbjct: 696 ECNEQLTQISKELD 709

>Smik_10.179 Chr10 (311844..313985) [2142 bp, 713 aa] {ON} YJL061W
           (REAL)
          Length = 713

 Score =  380 bits (975), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 253/722 (35%), Positives = 381/722 (52%), Gaps = 37/722 (5%)

Query: 16  TSHPIFKRNYLSSSFQETSPRFFFTTNRDNRVVVVQDGSIRWCYTFSQ-NYHSYTIASRN 74
            S PIF+ + LS+S    SPR+ FT+    R+V +QD  IRW    +   YHS ++ SR+
Sbjct: 8   ASLPIFQAS-LSAS---QSPRYIFTSQNGTRIVFIQDNIIRWYNVLTDPCYHSLSL-SRH 62

Query: 75  FDIKDS---LISNSGSFVCYYSDTDISIMEIPWXXXXXXXXXXXXCIQKYRYSFKKYSLT 131
             + D+   + S SG  +C+++D +I +ME+PW              Q + YS  +  L 
Sbjct: 63  LVLDDTFHVISSTSGDLLCFFNDQEIFVMEVPWGYSNVENISIQDAFQVFHYSVDETELG 122

Query: 132 ----VKQVLFHPLATLESCLVVLLSDDTIVFIXXXXXXXXXXXXYILNKKSKSIGLSSQI 187
               +K+VLFHP +  +SC+VVL  +DTI+               ILNK + S GL +++
Sbjct: 123 PKSLIKKVLFHPKSYHDSCIVVLKENDTIIMFDILNQQEKPI---ILNKPNNSFGLDARL 179

Query: 188 SDIQSLTFSQDGLTLYALSSSAATDVYAFYPCLPPSAQFSLEQLENLVNKSVVQYEELRE 247
           +DI  L FS+DGLTLY L+++   D++AFYP LP +   +   L  ++NKS+V YE L  
Sbjct: 180 NDITDLVFSKDGLTLYCLNTTEGGDIFAFYPFLPSALLLNENDLSWILNKSLVMYESLDP 239

Query: 248 DDPTALKINIIKQLKFTSDLYKKGKRALEEDTDSKTWKYDVPLEYRLIRPQGPFTISPFP 307
                +K NIIKQL+F S L+        E+ DSK  K D+  EYRL++ QGPFTI+PFP
Sbjct: 240 TTDVTVKRNIIKQLQFVSKLH--------ENWDSKLNKVDIDSEYRLVKVQGPFTINPFP 291

Query: 308 DSLYYSSPTHIVSVPIDTT-NELLVLSFSDGSVVSLFQDLELTMSWDQDNFNENNSLVLL 366
           + LY  +  +I ++ ID   NE+  +SF DGS++ L +DLE++MSWD  N+  N+SLVL+
Sbjct: 292 NELYDYTAKNIATISIDNQQNEIFCISFDDGSLILLLKDLEMSMSWDVGNYVYNDSLVLI 351

Query: 367 ELIKTKEQNIRKLTTYAHQYGTFYILGSVKNFEVLTSHWSSTLAICIKSSDIRDLSNLLI 426
           E +K +++ I  L T   Q G  Y+      ++V ++ W+ST++ CI  SD+  L +L  
Sbjct: 352 ERVKMQKE-IESLITLPEQMGKLYVFSKNFVYQVNSTSWTSTISKCINESDLNPLGDLKF 410

Query: 427 KSVIKPFDNAAYELTSGGWWCSPTISSLLFINKSTVIELNEKPKXXXXXXXXXXXXXXXA 486
           +S I   +N A   T  G    P ++ + + N S +   + K                  
Sbjct: 411 ESKI---ENIA---TVEGM---PNLAHIYWNNTSNLALASNKELTFQTVSVDQKMQSTET 461

Query: 487 QKYIPPLEDKIFKI--ELPMGILISDLNNMNTVFKEESNKQLTIPIPSQERNVTLFNKTN 544
           +  I   E  + K   EL     +S++  +N  F+          IPS +R + L N+ +
Sbjct: 462 ETDIGTEESGLAKCRYELRFTQPLSEILTLNENFQRACISPCEQIIPSTDRQIPLKNEAS 521

Query: 545 ENQLETLTKISKVIGIKISMGQSLGFGIYNKILDQQNIVEXXXXXXXXXXEKEKILNTKY 604
           ENQLE  T +SK    KI+  QSLG  IYN+I +QQ  +            K+  L  K+
Sbjct: 522 ENQLEIFTDVSKEFLQKIAKAQSLGVSIYNRIHEQQLELTRQLQSTCKIISKDVDLRKKF 581

Query: 605 NEQADKLRAFTERQEKLMSRLLIMNEKLKKADLDTNLLNISISKKELEFFKEIRKQVLLF 664
             Q  K  A   RQ KLM R   + E L +          +IS  E+E+FKEIR Q+L F
Sbjct: 582 EAQNKKWDAQIIRQSKLMERFSKLTENLSEISKSNKFKEKNISNAEMEWFKEIRNQILQF 641

Query: 665 NEFVHKQKDQHDTLLFIKKELIRIKGENAIVDENDFKQWDRLRDMLHDDATTIETCTESI 724
           N +VH QK     L ++K+EL RI+ E   VD+    +W+ LR ML  D+  I+ C E +
Sbjct: 642 NCYVHSQKSLQQDLSYLKRELTRIETETIQVDKKSQSEWNELRKMLEIDSKIIKECNEEL 701

Query: 725 KN 726
           ++
Sbjct: 702 QH 703

>NDAI0G05750 Chr7 (1424856..1427060) [2205 bp, 734 aa] {ON}
           Anc_1.319 YJL061W
          Length = 734

 Score =  372 bits (955), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 253/745 (33%), Positives = 383/745 (51%), Gaps = 53/745 (7%)

Query: 16  TSHPIFKRNYLSSSFQETSPRFFFTTNRDNRVVVVQDGSIRWCYTFSQNYHSYTIAS--- 72
            SHPIF  + +++   E S RFFFT+++  R+V++Q   ++WC      YHS  + S   
Sbjct: 9   ASHPIFGTSIITN---EDSQRFFFTSHQGTRMVLLQGCILKWCNVIDTTYHSMKVKSIFN 65

Query: 73  RNFDIKDSLISNSGSFVCYYSDTDISIMEIPWXXXXXXXXXXXXCIQKYRYSFKKYSLT- 131
               I D  +S SG F+C Y+   I I+EIPW              Q + Y     +   
Sbjct: 66  NKRKIIDVKLSESGDFLCIYTTKTIDILEIPWGYEKIPDELLSK-FQPFHYDISSSTSAL 124

Query: 132 -----VKQVLFHPLATLESCLVVLLSDDTIVFIXXXXXXXXXXXXYILNKKSKSIGLSSQ 186
                +KQVLFHP +  E+CLV+L  D  I  I              +N+ + ++G+ ++
Sbjct: 125 SSPSDIKQVLFHPKSYHETCLVILYEDSIIQLIDTTASTETIT----INQPTGTLGVETR 180

Query: 187 ISDIQSLTFSQD-GLTLYALSSSAATDVYAFYPCLPPSAQFSLEQLENLVNKSVVQYEEL 245
           + DI+S+ F +  GL LYALS S   D+YA YPCLP     S ++++ L+ KS+V Y+ L
Sbjct: 181 VIDIESICFDKTTGLILYALSISDGGDIYALYPCLPTRLDVSKKEVDLLLQKSIVLYDSL 240

Query: 246 REDDPTALKINIIKQLKFTSDLYKKGKRALEEDTDSKTWKY---------DVPLEYRLIR 296
           +E+    +K N+IKQL+F + L  +    L+ + D +  ++         DV LEYRL+ 
Sbjct: 241 KENMSNDVKRNVIKQLQFATKLQGQFLEQLKGEKDEERTRHAQKDLKLILDVDLEYRLVN 300

Query: 297 PQGPFTISPFPDSLYYSSPTHIVSVPIDTTNELLVLSFSDGSVVSLFQDLELTMSWDQDN 356
            QGPFTISPFP+ LY ++      + I+  NELL+++F DGSV  LF+DLELTMSWD  N
Sbjct: 301 FQGPFTISPFPNELYSATAKESQCMKINENNELLIMTFDDGSVALLFRDLELTMSWDIAN 360

Query: 357 FNENNSLVLLELIKTKEQNIRKLTTYAHQYGTFYILGSVKNFEVLTSHWSSTLAICIKSS 416
           +  +NS  L+ELIK K  +I +L  Y   +G F++L       V T+ WS  LA  I  S
Sbjct: 361 YIHDNSFALVELIKLKPTDIGRLIIYQDNFGKFFLLSDDVIMLVHTNSWSDKLAKAIDDS 420

Query: 417 DIRDLSNLLIKSVIKPFDNAAYELTSGGW-WCSPT----ISSLLFINKSTVIELNEKPKX 471
           ++  LS +  +S I  FD        G +  C+P       S++F++   V   N   K 
Sbjct: 421 NLNILSEIGFESEITWFD------VMGKFNNCTPCKYHGKESIIFVSSDNVFVENLTKKH 474

Query: 472 XXXXXXXXXXXXXXAQKYIPPLEDKIFKIELPMGILISDLNNMNTVFKEESNKQLTIPIP 531
                          +       +  +K+       I +L  +N +F+++     +  I 
Sbjct: 475 SMNNIKGSSTSNSNEET-----AESEYKVTFKQP--IDELMTLNELFQKQCRMPFSKLIK 527

Query: 532 SQERNVTLFNKTNENQLETLTKISKVIGIKISMGQSLGFGIYNKILDQQNIVEXXXXXXX 591
            ++R + L N++NE QLE LT +SK +  KI  GQ+LGF ++N++ +QQ  +        
Sbjct: 528 PEDRQIELSNESNEIQLEILTDLSKELITKIIDGQTLGFNLHNRLKEQQLELTRQLKHTQ 587

Query: 592 XXXEKEKILNTKYNEQADKLRAFTERQEKLMSRLLIMNEKLKKADLDTNLLNISISKKEL 651
              EK+  +  K  E   +      R  KL  RL  +NEKL   +   NL +  I+  EL
Sbjct: 588 IVFEKQDCIKNKNKEILKRWNEQLNRSVKLTDRLQNLNEKLITINDSPNLSSYPITSVEL 647

Query: 652 EFFKEIRKQVLLFNEFVHKQKDQHDTLLFIKKELIRIKGE-NAIVDENDFKQWDRLRDML 710
           E+FKEIR QV  FN FVH Q+D ++ L F+KKEL RI  +  ++VDE   K+W+ LR +L
Sbjct: 648 EWFKEIRNQVHKFNSFVHTQRDANEELSFLKKELDRISNDVTSVVDEKSKKEWEELRAIL 707

Query: 711 HDDATTIETC-------TESIKNIN 728
             D+  I+ C       TES+  I 
Sbjct: 708 EQDSKIIKECNIELTKTTESMAGIG 732

>Skud_10.158 Chr10 complement(296754..298904) [2151 bp, 716 aa] {ON}
           YJL061W (REAL)
          Length = 716

 Score =  371 bits (952), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 254/732 (34%), Positives = 377/732 (51%), Gaps = 61/732 (8%)

Query: 19  PIFKRNYLSSSFQETSPRFFFTTNRDNRVVVVQDGSIRWCYTFSQNYHSYTIASRNFDIK 78
           PIF+ + LS+S    SP + F+++   RVV +QD  IRWC + +++ +     SR+  + 
Sbjct: 11  PIFQAS-LSAS---QSPSYIFSSHNGTRVVFIQDNIIRWCNSLTESSYQSLDFSRHLILD 66

Query: 79  DS---LISNSGSFVCYYSDTDISIMEIPWXXXXXXXXXXXXCIQKYRYSFKKYS----LT 131
           D+   + S SG  + +++  +I +ME+PW              Q + YS  +        
Sbjct: 67  DTFRVISSASGDLLGFFNVQEIFVMEVPWGYNNIEEASVQDAFQLFHYSVGQVENGSRSL 126

Query: 132 VKQVLFHPLATLESCLVVLLSDDTIVFIXXXXXXXXXXXXYILNKKSKSIGLSSQISDIQ 191
           +K+VLFHP +  +SC+VVL  DDTI                +LNK+S S GL ++++DI 
Sbjct: 127 IKKVLFHPKSYHDSCIVVLKEDDTITMFDILNQQHKP---IVLNKRSNSFGLDARVNDIT 183

Query: 192 SLTFSQDGLTLYALSSSAATDVYAFYPCLPPSAQFSLEQLENLVNKSVVQYEELREDDPT 251
            L FS+DGLTLY L+++   DV+AFYP LPP      + L  ++NKS+V YE L      
Sbjct: 184 DLAFSRDGLTLYCLNTTEGGDVFAFYPLLPPVLLLGEKDLGWILNKSLVMYESLDSTTDI 243

Query: 252 ALKINIIKQLKFTSDLYKKGKRALEEDTDSKTWKYDVPLEYRLIRPQGPFTISPFPDSLY 311
            +K NIIKQL+  S L+        E+ DS+  K ++  EYRL++ QGPFTI+PFPD LY
Sbjct: 244 TVKRNIIKQLQLVSKLH--------ENLDSQLGKVEIDEEYRLVKMQGPFTINPFPDELY 295

Query: 312 YSSPTHIVSVPIDTT-NELLVLSFSDGSVVSLFQDLELTMSWDQDNFNENNSLVLLELIK 370
             +  +I ++PID   NE++ + F DGS+  LFQDLE++MSWD DN+  NNSLVL+E IK
Sbjct: 296 EYTAANITTIPIDNMQNEIVCVGFDDGSLNLLFQDLEMSMSWDVDNYVHNNSLVLIERIK 355

Query: 371 TKEQNIRKLTTYAHQYGTFYILGSVKNFEVLTSHWSSTLAICIKSSDIRDLSNLLIKS-- 428
            +E +I+ L T   + G  Y+       ++ +++WS+ L+ CI+ SD+  L ++  +S  
Sbjct: 356 IQETDIKSLKTLPEELGKLYVFSENSVHQLDSTNWSAILSRCIEESDLNALGDVKFESKL 415

Query: 429 ----VIKPFDNAAY---------ELTSGGWWCSPTISSLLFINKSTVIELNEKPKXXXXX 475
                I+   N AY          LT+ G         L F N S     N+K       
Sbjct: 416 ENIVTIEHPSNLAYISWNDTSNLVLTARG--------KLTFQNIS-----NDKELQTTKF 462

Query: 476 XXXXXXXXXXAQKYIPPLEDKIFKIELPMGILISDLNNMNTVFKEESNKQLTIPIPSQER 535
                     A K+           E+     I+++ ++N  F++         IP   R
Sbjct: 463 DANNKSDRIDAGKH----------YEMSFTQPINEILSLNESFQKACISPCEKIIPPAYR 512

Query: 536 NVTLFNKTNENQLETLTKISKVIGIKISMGQSLGFGIYNKILDQQNIVEXXXXXXXXXXE 595
            + L N+ +ENQLE  T ISK    KI   QSLGF IYN+I +QQ  +            
Sbjct: 513 QMPLKNEASENQLEIFTGISKEFLQKIIKAQSLGFSIYNRIQEQQFELTRQLQATSKIIS 572

Query: 596 KEKILNTKYNEQADKLRAFTERQEKLMSRLLIMNEKLKKADLDTNLLNISISKKELEFFK 655
           K+  L  K   Q  K  A   RQ KLM R   + E L +      L   +I++ E+++FK
Sbjct: 573 KDADLQEKLGAQNKKWDAQVSRQVKLMERFKKLTENLSQIAESKKLREKNINRGEMKWFK 632

Query: 656 EIRKQVLLFNEFVHKQKDQHDTLLFIKKELIRIKGENAIVDENDFKQWDRLRDMLHDDAT 715
           EIR Q+L FN FV  QK     L ++KKEL RI+ E    DE    +WD LR ML +D+ 
Sbjct: 633 EIRNQILQFNNFVRSQKSLQQDLSYMKKELTRIEAETIKTDEKTQNEWDELRKMLEEDSK 692

Query: 716 TIETCTESIKNI 727
            I+ C E + ++
Sbjct: 693 IIKECNEELMHV 704

>YJL061W Chr10 (320016..322157) [2142 bp, 713 aa] {ON}  NUP82Linker
           nucleoporin component of the nuclear pore complex (NPC);
           also part of the NPC cytoplasmic filaments; contributes
           to nucleocytoplasmic transport and NPC biogenesis; forms
           stable associations with three FG-nucleoporins (Nsp1p,
           Nup159p, and Nup116p)
          Length = 713

 Score =  367 bits (942), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 245/717 (34%), Positives = 375/717 (52%), Gaps = 37/717 (5%)

Query: 19  PIFKRNYLSSSFQETSPRFFFTTNRDNRVVVVQDGSIRWCYTFSQN-YHSYTIASRNFDI 77
           PIF+ + LS+S    SPR+ F++    R+V +QD  IRW    + + YHS    SR+  +
Sbjct: 11  PIFQAS-LSAS---QSPRYIFSSQNGTRIVFIQDNIIRWYNVLTDSLYHSLNF-SRHLVL 65

Query: 78  KDS---LISNSGSFVCYYSDTDISIMEIPWXXXXXXXXXXXXCIQKYRYSFKKYSL---- 130
            D+   + S SG  +C ++D +I +ME+PW              Q + YS  +  +    
Sbjct: 66  DDTFHVISSTSGDLLCLFNDNEIFVMEVPWGYSNVEDVSIQDAFQIFHYSIDEEEVGPKS 125

Query: 131 TVKQVLFHPLATLESCLVVLLSDDTIVFIXXXXXXXXXXXXYILNKKSKSIGLSSQISDI 190
           ++K+VLFHP +  +SC+VVL  DDTI                +LNK + S GL ++++DI
Sbjct: 126 SIKKVLFHPKSYRDSCIVVLKEDDTITMFDILNSQEKP---IVLNKPNNSFGLDARVNDI 182

Query: 191 QSLTFSQDGLTLYALSSSAATDVYAFYPCLPPSAQFSLEQLENLVNKSVVQYEELREDDP 250
             L FS+DGLTLY L+++   D++AFYP LP     + + L  ++NKS+V YE L     
Sbjct: 183 TDLEFSKDGLTLYCLNTTEGGDIFAFYPFLPSVLLLNEKDLNLILNKSLVMYESLDSTTD 242

Query: 251 TALKINIIKQLKFTSDLYKKGKRALEEDTDSKTWKYDVPLEYRLIRPQGPFTISPFPDSL 310
             +K N+IKQL+F S L+        E+ +S+  K D+  EYRL + QGPFTI+PFP  L
Sbjct: 243 VIVKRNVIKQLQFVSKLH--------ENWNSRFGKVDIQKEYRLAKVQGPFTINPFPGEL 294

Query: 311 YYSSPTHIVSVPIDTT-NELLVLSFSDGSVVSLFQDLELTMSWDQDNFNENNSLVLLELI 369
           Y  + T+I ++ ID   NE++ +SF DGS++ LF+DLE++MSWD DN+  NNSLVL+E +
Sbjct: 295 YDYTATNIATILIDNGQNEIVCVSFDDGSLILLFKDLEMSMSWDVDNYVYNNSLVLIERV 354

Query: 370 KTKEQNIRKLTTYAHQYGTFYILGSVKNFEVLTSHWSSTLAICIKSSDIRDLSNLLIKSV 429
           K + + I+ L T   Q G  Y++      +V    W+STL+ CI  SD+  L+ L  +S 
Sbjct: 355 KLQRE-IKSLITLPEQLGKLYVISDNIIQQVNFMSWASTLSKCINESDLNPLAGLKFESK 413

Query: 430 IKPFDNAAYELTSGGWWCSPTISSLLFINKSTVIELNEKPKXXXXXXXXXXXXXXXAQKY 489
           ++  D A  E         P ++ + + ++S +  ++ K                 A+  
Sbjct: 414 LE--DIATIERI-------PNLAYINWNDQSNLALMSNKTLTFQNISSDMKPQSTAAETS 464

Query: 490 IPPLEDKIFKIELPMGIL--ISDLNNMNTVFKEESNKQLTIPIPSQERNVTLFNKTNENQ 547
           I   +         M     I+++  +N  F++         IPS +R + L N+ +ENQ
Sbjct: 465 ISTEKSDTVGDGFKMSFTQPINEILILNDNFQKACISPCERIIPSADRQIPLKNEASENQ 524

Query: 548 LETLTKISKVIGIKISMGQSLGFGIYNKILDQQNIVEXXXXXXXXXXEKEKILNTKYNEQ 607
           LE  T ISK    +I   Q+LG  I+N+I +QQ  +            K+  L  K+  Q
Sbjct: 525 LEIFTDISKEFLQRIVKAQTLGVSIHNRIHEQQFELTRQLQSTCKIISKDDDLRRKFEAQ 584

Query: 608 ADKLRAFTERQEKLMSRLLIMNEKLKKADLDTNLLNISISKKELEFFKEIRKQVLLFNEF 667
             K  A   RQ +LM R   +++KL +           IS  E+++FKEIR Q+L FN F
Sbjct: 585 NKKWDAQLSRQSELMERFSKLSKKLSQIAESNKFKEKKISHGEMKWFKEIRNQILQFNSF 644

Query: 668 VHKQKDQHDTLLFIKKELIRIKGENAIVDENDFKQWDRLRDMLHDDATTIETCTESI 724
           VH QK     L ++K EL RI+ E   VD+    +WD LR ML  D+  I+ C E +
Sbjct: 645 VHSQKSLQQDLSYLKSELTRIEAETIKVDKKSQNEWDELRKMLEIDSKIIKECNEEL 701

>SAKL0D06930g Chr4 complement(573700..575772) [2073 bp, 690 aa] {ON}
           similar to uniprot|P40368 Saccharomyces cerevisiae
           YJL061W NUP82 Subunit of the nuclear pore complex (NPC)
           forms a subcomplex with Nup159p and Nsp1p interacts with
           Nup116p and is required for proper localization of
           Nup116p in the NPC
          Length = 690

 Score =  346 bits (887), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 230/718 (32%), Positives = 369/718 (51%), Gaps = 33/718 (4%)

Query: 18  HPIFKRNYLSSSFQETSPRFFFTTNRDNRVVVVQDGSIRWCYTFSQNYHSYTIASRNFDI 77
           HPIF+     S  +E+ P+   TT    RVVV+Q  +IR C + +  Y    I      +
Sbjct: 6   HPIFQN---ISVGKESYPKKLLTTQDGCRVVVIQGDTIRLCSSGNSQYQ--IIECGINTV 60

Query: 78  KDSLISNSGSFVCYYSDTDISIMEIPWXXXXXXXXXXXXCIQKYRYSFKKYSLTVKQVLF 137
             + ++NSG+ +C Y++T++ ++ +P              ++ + Y+    S  +KQV +
Sbjct: 61  AGAALNNSGTLLCAYNETELQVIVLP----SPFVSSHGGILKPHTYNITVKS-PIKQVQW 115

Query: 138 HPLATLESCLVVLLSDDTIVFIXXXXXXXXXXXXYILNKKSKSIGLSSQISDIQSLTFSQ 197
           HP   L+S  VVL  DDTI  +             +LN     +G++S I+DI+S+ FS+
Sbjct: 116 HPRGKLDSVPVVLHKDDTIA-MYELYNEDFQQPTAVLNTMQNQLGVTSHITDIESMCFSK 174

Query: 198 DGLTLYALSSSAATDVYAFYPCLPPSAQFSLEQLENLVNKSVVQYEELREDDPTALKINI 257
           DGL LY L+SS   DVYA YP LP       + LE    KS + YE L  DD   +K N+
Sbjct: 175 DGLALYLLNSSEGGDVYALYPFLPSVLVIPEQHLEMCFYKSCINYENLSSDDSPTVKRNV 234

Query: 258 IKQLKFTSDLYKKGKRALEEDTDSKTWKYDVPLEYRLIRPQGPFTISPFPDSLYYSSPTH 317
           IKQL+F S L+K+ K    +   +    +++   YR  + QGPFTI+PF + LY ++ T 
Sbjct: 235 IKQLQFVSRLHKQYKSETVDKARNGDLVFNIQESYRNAKIQGPFTINPFAEKLYSATATQ 294

Query: 318 IVSVPIDTTNELLVLSFSDGSVVSLFQDLELTMSWDQDNFNENNSLVLLELIKTKEQNIR 377
           I ++PID  NEL+++ F +G+++  FQDL+L+M W++ + + NNSLV+LE +      I 
Sbjct: 295 ITTMPIDEFNELILVYFDNGTILQCFQDLDLSMCWEEIDSSSNNSLVVLESLDILSGQII 354

Query: 378 KLTTYAHQYGTFYILGSVKNFEVLTSHWSSTLAICIKSSDIRDLSNLLIKSVIKPFDNAA 437
            LT +      F +LG  K+F V +S W+  L+ CI  S++  LS + IKS I P + A 
Sbjct: 355 CLTPHK-----FAVLGP-KSFVVDSSEWTKALSECINFSNLEVLSQINIKSTITPVNGA- 407

Query: 438 YELTSGGWWCSPTISSLLFINKSTVIELNEKPKXXXXXXXXXXXXXXXAQKYIPPLEDKI 497
              T  G W S     L+F++  +V  +                      KY P     I
Sbjct: 408 --FTQAGLWESNGEKQLIFMSDKSVKSITLPEPNKTKDAVSKTVQPVTEVKYEPVFSQPI 465

Query: 498 FKIELPMGILISDLNNMNTVFKEESNKQLTIPIPSQERNVTLFNKTNENQLETLTKISKV 557
            +I L           +N  F+ E ++     IP    ++ L N +NE+QL  LT ISK 
Sbjct: 466 GEILL-----------LNKKFQSECSRATQTVIPPHLMDLPLQNDSNEDQLALLTDISKE 514

Query: 558 IGIKISMGQSLGFGIYNKILDQQNIVEXXXXXXXXXXEKEKILNTKYNEQADKLRAFTER 617
           +  KI  GQ+LG  I+N++ +Q+  +            K K L  +Y +Q  +    +++
Sbjct: 515 VFSKIIQGQTLGLLIHNRLFEQRYELTRQLERSSEILHKAKCLQERYPDQNSRWEHVSKK 574

Query: 618 QEKLMSRLLIMNEKLKKADLDTNLLNISISKKELEFFKEIRKQVLLFNEFVHKQKDQHDT 677
           QE + SR   +  +L +      L +++IS++E+E+FKEI+ QV LFN+FV +Q+D  + 
Sbjct: 575 QENIDSRFEKLQSRLNEISSSGKLKDLAISQREMEWFKEIKSQVSLFNKFVMQQQDVKEQ 634

Query: 678 LLFIKKELIRIKGENAIVDENDFKQWDRLRDMLHDDATTIETCTESIKNINFDLDRAL 735
           L F++ EL +  GE  +  E+ F  W  L+++L  D+  I+ C E +     +LD  +
Sbjct: 635 LEFVQSEL-KTAGERRVSKEDVFD-WAELQELLSVDSEIIKECNEGLVEAAKELDEKI 690

>KAFR0A01720 Chr1 complement(349779..351929) [2151 bp, 716 aa] {ON}
           Anc_1.319 YJL061W
          Length = 716

 Score =  318 bits (816), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 211/695 (30%), Positives = 348/695 (50%), Gaps = 32/695 (4%)

Query: 48  VVVQDGSI------RWCYTFSQNYHSYTIASRNFD---IKDSLISNSGSFVCYYSDTDIS 98
           ++ QD SI      RW    S  YHS  +    FD    ++ +ISNSG F+C Y    +S
Sbjct: 41  ILAQDSSIYKKNQLRWGSVASSQYHSLPLLF--FDDSAYENVIISNSGQFLCLYDKKSLS 98

Query: 99  IMEIPWXXXXXXXXXXXXCIQKYRYSFKKYSLTVKQVLFHPLATLESCLVVLLSDDTIVF 158
           ++EIPW              + +R   K  S  +K++LFHP A  + C+V+L  +D I  
Sbjct: 99  LIEIPWGYDGAVTSIKSSFQRVFRDVNK--SSDIKKILFHPKAADDGCVVILFENDVICL 156

Query: 159 IXXXXXXXXXXXXYILNKKSKSIGLSSQISDIQSLTFSQDGLTLYALSSSAATDVYAFYP 218
                          LNK +  +G+ ++++DI+ + FSQDGLTLY LS +   D+YAFYP
Sbjct: 157 FDLRKSEK-----LFLNKTANKLGIETRVTDIEDMEFSQDGLTLYMLSVTDGGDIYAFYP 211

Query: 219 CLPPSAQFSLEQLENLVNKSVVQYEELREDDPTALKINIIKQLKFTSDLYKKGKRALEED 278
           CLPP        LE+L NKS + Y+ L       ++ N++KQ+KF + L     R    D
Sbjct: 212 CLPPKLSLKKSVLEDLFNKSRILYDSLDSTVSIEVRKNVLKQIKFIASL-----RDSSSD 266

Query: 279 TDSKTWKYDVPLEYRLIRPQGPFTISPFPDSLYYSSPTHIVSVPIDTTNELLVLSFSDGS 338
            ++K    ++  ++R ++ QGPFT++P+P+ LY ++   I ++ I   NEL  ++F +G+
Sbjct: 267 -ETKNSCLEISNDFRQVKAQGPFTVAPYPEKLYEATAKEIYTLDIGNNNELFAITFDNGT 325

Query: 339 VVSLFQDLELTMSWDQDNFNENNSLVLLELIKTKEQNIRKLTTYAHQYGTFYILGSVKNF 398
           V  L +DLEL+MSW+ DN+  NNS VL+E ++   ++I+ L + +     F         
Sbjct: 326 VTLLLKDLELSMSWNADNYVYNNSFVLIESVEMGPESIKLLKSSSLTGQMFISQNHSSVR 385

Query: 399 EVLTSHWSSTLAICIKSSDIRDLSNLLIKSVIKPFDNAAYELTSGGWWCSPTISSLLFIN 458
           ++ T+ WS  ++ CI +SD+  L ++  KS I   D     +   G W       +LF++
Sbjct: 386 KIDTTAWSFKVSKCITNSDLTSLIDVDFKSKISDLD-IKENVDCYGVWSLRGERGILFVS 444

Query: 459 KSTVIELNEKPKXXXXXXXXXXXXXXXAQKYIPPLEDKIFK-IELPMGILISDLNNMNTV 517
            S+VI     P+                      +ED + K  E+     IS++ N+N  
Sbjct: 445 NSSVIS-RTLPESDSSFVIKLDEMSRSKN-----IEDPVTKKYEVSFTQPISEIMNLNDS 498

Query: 518 FKEESNKQLTIPIPSQERNVTLFNKTNENQLETLTKISKVIGIKISMGQSLGFGIYNKIL 577
           F+          I  +ER   L N +NE QL TLT+IS  +   I  GQSLG  + N++ 
Sbjct: 499 FQRICRHPFKKIISPEERQTVLSNDSNETQLATLTEISNDLVSNIVEGQSLGLVLRNRLY 558

Query: 578 DQQNIVEXXXXXXXXXXEKEKILNTKYNEQADKLRAFTERQEKLMSRLLIMNEKLKKADL 637
           +QQ  +           EK+ +L + Y+++  +     ++Q++L+ R   +N  L K   
Sbjct: 559 EQQYELTKQLKESIQLIEKQSLLKSSYDDKMVRWNKNLKKQDELIQRFNALNGNLAKIHE 618

Query: 638 DTNLLNISISKKELEFFKEIRKQVLLFNEFVHKQKDQHDTLLFIKKELIRIKGENAIVDE 697
              +    IS+KE+E+FKE+R Q+L FN+FVH  ++  + + F++K L RI+ +      
Sbjct: 619 SKEISKTPISEKEVEWFKEVRNQILKFNDFVHVHRNMQEQINFLRKGLSRIESKVGQRSS 678

Query: 698 NDFKQWDRLRDMLHDDATTIETCTESIKNINFDLD 732
           +   +W   + +L  D   I+ C E +   +  LD
Sbjct: 679 HLTSEWAEFKKILETDTNIIKECNEELTKAHTQLD 713

>TPHA0O01460 Chr15 complement(293395..295560) [2166 bp, 721 aa] {ON}
           Anc_1.319 YJL061W
          Length = 721

 Score =  309 bits (791), Expect = 7e-94,   Method: Compositional matrix adjust.
 Identities = 225/729 (30%), Positives = 371/729 (50%), Gaps = 45/729 (6%)

Query: 15  PTSHPIFKRNYLSSSFQETSPRFFFTTNRDNRVVVVQDGSIRWCYT--FSQNYHSYTIAS 72
           P  H IF R    S  + +S R   T +   ++++ Q+ ++R+ +      N+ S T+  
Sbjct: 4   PQLHTIFNR---FSVGKVSSKRSSITVDNGLKIILYQNNTVRYGFVNDADGNFKSITLEK 60

Query: 73  RNFDIKDSLISNSGSFVCYYSDTDISIMEIPWX---XXXXXXXXXXXCIQKYRYSFKKYS 129
                   +    G+++C +++ +I ++E+PW                +Q   Y  K + 
Sbjct: 61  EMIGDVSIIADQIGNYLCLFNEFEIRVIELPWKLWDAKEDSSFQLDNMVQIRSYDLKSFG 120

Query: 130 LTVKQVLFHPLATLESCLVVLLSDDTI--VFIXXXXXXXXXXXXYILNKKSKSI-GLSSQ 186
            T++++LFHPL     CLVVLL +  I  + I             I    +K + GLSS 
Sbjct: 121 TTIQKILFHPLGLAYPCLVVLLKNSNICSIDIKRILKVEEIPSTCITTFHTKGVMGLSSC 180

Query: 187 ISDIQSLTFSQDGLTLYALSSSAATDVYAFYPCLPPSAQFSLEQLENLVNKSVVQYEELR 246
           I DI  ++FS D L+LYAL+    TD+Y FYP L P+   +  +++ L  KS++ +E L 
Sbjct: 181 IDDIIDISFSSDKLSLYALTE---TDIYLFYPFLIPTISVTKNEIDQLFQKSIILFENLE 237

Query: 247 EDDPTALKINIIKQLKFTSDLYKKGKRALEE--DTD-SKTWKYDVPLEYRLIRPQGPFTI 303
            D   A++ NIIKQL+  S L    K  +++  +TD +K +  D+  EYR +  QG F+I
Sbjct: 238 NDSSEAVRRNIIKQLQLLSTLSGDIKTQMKQVKNTDETKIYNIDINTEYRSVNAQGSFSI 297

Query: 304 SPFPDSLYYSSPTHIVSVPIDTTNELLVLSFSDGSVVSLFQDLELTMSWDQDNFNENNSL 363
           +PFP+ LY  S  ++  + I   NEL V+++ DG+V+ L++DLE +MSWD +++  NNS 
Sbjct: 298 APFPEELYKQSAVNLSVIQIGHGNELYVITYDDGTVLILYRDLESSMSWDSNDYTFNNSF 357

Query: 364 VLLELIKTKEQNIRKLTTYAHQYGTFYILGSVKNFEVLTSHWSSTLAICIKSSDIRDLSN 423
           +LLE +K      + +     + G F I G      + TS WS  L+ CIK +DIR+L+ 
Sbjct: 358 ILLEKLKFNPDETKSILDIPFKNGIFAIAGDQTVNLIDTSCWSDILSQCIKDNDIRNLAG 417

Query: 424 LLIKSVIKPFDNAAYELTSGGWWCSPTISSLLFINKSTVIELNEKPKXXXXXXXXXXXXX 483
           L I+S  K   N   E  S   W       LLFI ++ +I                    
Sbjct: 418 LSIESH-KQTINTLEEPNSCILWNEHNKKELLFITETKLI-----------SSDILESNN 465

Query: 484 XXAQKY-IPPLED--KIFKIELP-MGILISDLNNMNTVFKEESNKQLTIPIPSQERNVTL 539
             A+K  +P + D  KI K++L      I ++N     +K+      +  IP+  R    
Sbjct: 466 ESAEKLPVPAINDIKKIEKLQLKNYSQPIKEINIAVQRYKDSCKVPYSKVIPANIRQKPF 525

Query: 540 FNKTNENQLETLTKISKVIGIKISMGQSLGFGIYNKILDQQNIVEXXXXXXXXXXEKEKI 599
            N  NE+QL  +T+IS+ IG KI  GQ++   ++ ++ +QQ++               K 
Sbjct: 526 ANDENEDQLAYITEISQEIGSKILQGQTIALMMHTRLREQQDVFAEQLMHTNKELLHNKT 585

Query: 600 LNTKYNEQADKLRAFTERQEKL---MSRLLIMNEKLKKADLDTNLLNISISKKELEFFKE 656
           +   Y+ Q+ K++  TER  KL    S+L+ M EK+K++       N+ I+  E + FKE
Sbjct: 586 IKQTYDIQSTKIKHITERNTKLNERTSKLIEMMEKIKQSQ---QYKNMPINDSESKLFKE 642

Query: 657 IRKQVLLFNEFVHKQKDQHDTLLFIKKELIRI-----KGENAIVDENDFKQWDRLRDMLH 711
           I+KQVL+FN+ V++Q++Q + + F++ EL  I     +  +AI+D +D  +W+ L D+L+
Sbjct: 643 IKKQVLIFNDAVNRQQEQQEAIKFLQTELNNIIEQPAQSHDAIID-SDEDEWNELCDLLN 701

Query: 712 DDATTIETC 720
            DA  IE C
Sbjct: 702 RDAKIIEDC 710

>KNAG0C05840 Chr3 (1135516..1137759) [2244 bp, 747 aa] {ON}
           Anc_1.319 YJL061W
          Length = 747

 Score =  308 bits (790), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 216/716 (30%), Positives = 341/716 (47%), Gaps = 67/716 (9%)

Query: 34  SPRFFFTTNRDNRVVVVQ--DGSIRWCYTFSQNYHSYTIASRNFDIK--DSLISNSGSFV 89
           S R+ FTT++  + V +   +G +RW       Y+S  +   NF  K  + ++S+SG F+
Sbjct: 37  SSRYVFTTDKGTKYVYLDKTNGLLRWGSVSEDEYNSMPLKISNFADKSVNVILSDSGEFL 96

Query: 90  CYYSDTDISIMEIPWXXXXXXXXXXXXCIQKYRYSFK--KYSLTVKQVLFHPLATLESCL 147
           C YS   ++++E+PW                ++ SFK  +    +K+VLFHP A  ++C+
Sbjct: 97  CVYSKDCVTVIEVPWRYRNPEEMSYV-----FQTSFKEIRKDSFIKKVLFHPRAIKKTCM 151

Query: 148 VVLLSDDTIVFIXXXXXXXXXXXXYILNKKSKSIGLSSQISDIQSLTFSQDGLTLYALSS 207
           V+L  DDTI                 LN  S +IG+  +I+ I  + FSQDGLTLY LS+
Sbjct: 152 VILFEDDTIYLFDVEDNNKIA-----LNVPSGNIGIEDRITSIADIEFSQDGLTLYVLSA 206

Query: 208 SAATDVYAFYPCLPPSAQFSLEQLENLVNKSVVQYEELREDDPTALKINIIKQLKFTSDL 267
               DVYA YPCLPP    S ++L++L+N+SV+ Y+ L E  P+A+K  +IKQ++F S L
Sbjct: 207 EDCGDVYAIYPCLPPILAMSQKELKSLMNRSVLLYDSLTETTPSAVKKGVIKQVEFISQL 266

Query: 268 --YKKGKR----ALEEDTDSKTWKYDVPLEYRLIRPQGPFTISPFPDSLYYSSPTHIVSV 321
                GK      LE DT            YRL +PQGPFTI+PFP+ LY ++ T I  +
Sbjct: 267 QNISHGKEEISNVLEIDTI-----------YRLAKPQGPFTIAPFPEKLYSATATEICPL 315

Query: 322 PIDTTNELLVLSFSDGSVVSLFQDLELTMSWDQDNFNENNSLVLLELIKTKEQNIRKLTT 381
            I   NE+L +++ +G+ + LF+DLEL+M+WD      NNSLVL+E    + ++   +  
Sbjct: 316 NIGGGNEILCIAYDNGTALFLFKDLELSMAWDVGGIYYNNSLVLMEEFDLQTESAVSILK 375

Query: 382 YAHQYG--TFYILGSVKNFEVL---------------------TSHWSSTLAICIKSSDI 418
                G   F +  SV++ +V                      T  WSS ++ CI   DI
Sbjct: 376 SFKMDGLILFKVSDSVQHIDVSKSFIQDGDLLVQQSSMIRCVDTKAWSSVVSDCIDRHDI 435

Query: 419 RDLSNLLIKSVIKPFDNAAYELTSGGWWCSPTISSLLFINKSTVIELNEKPKXXXXXXXX 478
             L  +  KS    +  A  ++TS G W       + +I   +V    E  K        
Sbjct: 436 NALITVSFKSKGHTWAIAGSDITSCGAWNHGGTEGVTWITNKSVT-CKELKKQVSWKPEQ 494

Query: 479 XXXXXXXAQKYIPPLEDKIFKIELPMGILISDLNNMNTVFKEESNKQLTIPIPSQERNVT 538
                   Q +  P             + IS+LN +N  +++         I   +R   
Sbjct: 495 STSSEKKKQAFPKP----------EFSVPISELNALNINYQDTCRIGFHDIISPLDRQKP 544

Query: 539 LFNKTNENQLETLTKISKVIGIKISMGQSLGFGIYNKILDQQNIVEXXXXXXXXXXEKEK 598
           L N +NE QL+ +T +S  +   +  GQ LG  +YN++L+QQ  +            K+ 
Sbjct: 545 LLNPSNEKQLQVMTSLSNYLLATVGKGQGLGMTLYNRLLEQQLELTKQLQCSNKILMKQP 604

Query: 599 ILNTKYNEQADKLRAFTERQEKLMSRLLIMNEKLKKADLDTNLLNISISKKELEFFKEIR 658
            +  K  EQ         +Q KL  R   + +KL   D      ++ I+ +E  +FKE++
Sbjct: 605 AIAKKLEEQKSVWNEKLAKQNKLKERFSSLQQKLAAIDKTKKSTDLVITDEESVWFKEVK 664

Query: 659 KQVLLFNEFVHKQKDQHDTLLFIKKELIRIKGENAIVDENDFKQWDRLRDMLHDDA 714
           K+ L FN+ V+KQ+   D L F+K+EL     ++  +      +W  L++ML  D+
Sbjct: 665 KEALTFNDLVYKQESVQDDLRFLKRELSTFVSDSQRLPGTANTEWHSLQEMLKHDS 720

>CAGL0J05214g Chr10 complement(501919..504069) [2151 bp, 716 aa]
           {ON} similar to uniprot|P40368 Saccharomyces cerevisiae
           YJL061w NUP82 nuclear pore protein
          Length = 716

 Score =  296 bits (757), Expect = 5e-89,   Method: Compositional matrix adjust.
 Identities = 217/717 (30%), Positives = 362/717 (50%), Gaps = 42/717 (5%)

Query: 33  TSPRFFFTTNRDNRVVVVQD-GSIRWCYTFSQNYHSYTIASRNFD------IKDSLISNS 85
            + RF F+++   ++V + D G +RWC++ S  Y S      +FD      ++ ++ S +
Sbjct: 17  AAQRFLFSSSDGTKIVSIADRGHLRWCHSTSTTYKSL-----DFDLQFEGKVEGAVSSTT 71

Query: 86  GSFVCYYSDTDISIMEIPWXXXXXXXXXXXXCIQKYRYSFKKYSLTVKQVLFHPLATLES 145
             +VC Y+  ++ ++E+PW            C   Y + F + + ++KQVLFHP + L+S
Sbjct: 72  ADYVCIYNRDELHVLEVPWMYSGEENGLKHLC-HIYSHKFDE-NHSIKQVLFHPKSYLDS 129

Query: 146 CLVVLLSDDTIVFIXXXXXXXXXXXXYILNKKSKSIGLSSQISDIQSLTFSQDGLTLYAL 205
            ++VL +DD+I F+              LN K+ ++GL  +I+DIQ + FSQDGL+L  L
Sbjct: 130 TILVLTNDDSI-FMINTDDNRSDKNMINLNSKNSALGLYDRINDIQKIIFSQDGLSLLIL 188

Query: 206 SSSAATDVYAFYPCLPPSAQFSLEQLENLVNKSVVQYEELREDDPTALKINIIKQLKFTS 265
           S+    D++  YPCLP     SL +++ L  KS++ Y  +  +     K NI+KQL F  
Sbjct: 189 SAEEGCDIFTIYPCLPRRWDISLHEVDTLFAKSLLLYNNMNVNTTPQEKRNIVKQLNFME 248

Query: 266 DLYKKGKRALEEDTDSKTWKYDVPLE--YRLIRPQGPFTISPFPDSLYYSSPTHIVSVPI 323
            + +  K A   D      K  + LE  Y   +PQGPF+++P+P+ LY    T I  + I
Sbjct: 249 KI-RGQKTAFRND------KKPLILEDAYLNAQPQGPFSMTPYPNELYDFMATDINIIQI 301

Query: 324 DTTNELLVLSFSDGSVVSLFQDLELTMSWDQDNFNENNSLVLLELIKTKEQNIRKLTTYA 383
                LL ++FS+G+V+    DLE  MSWD   F  +NSL LLE IK +  +  K  +  
Sbjct: 302 TQNISLLAIAFSNGTVLLFLSDLEPIMSWDISRFPGSNSLALLEQIKLEITDNAKFLSIP 361

Query: 384 HQYGTFYILGSVK-NFEVLTSHWSSTLAICIKSSDIRDLSNLLIKSVIKPFDNAAYELTS 442
             YG F +  +VK NF V T  WS+ LA  I  SDI+ L+NL +KS I+     A    S
Sbjct: 362 GTYGKFVVTDNVKSNFFVNTCDWSTILAQIIDDSDIKLLANLKVKSNIENLQQLATTFKS 421

Query: 443 GGWWCSPTISSLLFINKSTVIELNEKPKXXXXXXXX---XXXXXXXAQKYIPPLEDKIFK 499
             +W +  IS    I+   + EL+                      ++  +P L++ +++
Sbjct: 422 IIYWKNENISCNYIISDKKIEELDMLDGISSTTKHKLIDQSNSQVESKLDLPELKNGLYE 481

Query: 500 IELPMGILISDLNNMNTVFKEESNKQLTIPIPSQERNVTLFNKTNENQLETLTKISKVIG 559
           ++      ++++ +   ++ +    Q    IP + R+  L N +NENQLE+LTKIS+   
Sbjct: 482 VKFARP--LTEIQHYEQIYYKNLQNQNFTKIPLEIRSAPLKNSSNENQLESLTKISESYM 539

Query: 560 IKISMGQSLGFGIYNKILDQ----QNIVEXXXXXXXXXXEKEKILNTKYNEQADKLRAFT 615
             ISM Q+LG+    +++D        +E            E+I   + N + DK++   
Sbjct: 540 KMISMAQTLGYIYRKRMIDSIEEFSRQIETTYQINKFWDNFEQIREVQ-NTKIDKVK--- 595

Query: 616 ERQEKLMSRLLIMNEKLKKADLDTNLLNISISKKELEFFKEIRKQVLLFNEFVHKQKDQH 675
           E+Q+KLM RL  + +K++      ++ N +IS  E E+F EI++ V+ FN +V K    H
Sbjct: 596 EKQQKLMERLSSLYDKVEGQKEMGSMNNSNISAAESEWFAEIKRSVIEFNSYVRKASTNH 655

Query: 676 DTLLFIKKELIRIKGENAIVDENDFKQWDRLRDMLHDDATTI----ETCTESIKNIN 728
             L FIK++  +I  +   +   + K+W+ L+ +L  D   I    + C  ++  IN
Sbjct: 656 QELEFIKEQQAQIANQKPDISSENGKEWNDLQQLLRTDLKIISEFEKKCDTAVNGIN 712

>Kwal_14.2580 s14 complement(821497..823560) [2064 bp, 687 aa] {ON}
           YJL061W (NUP82) - 82-kDa protein, with putative
           coiled-coil domain, has carboxy-terminal domain,
           containing heptad repeats, that binds Nsp1p; nucleoporin
           [contig 224] FULL
          Length = 687

 Score =  283 bits (724), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 220/733 (30%), Positives = 335/733 (45%), Gaps = 64/733 (8%)

Query: 15  PTSHPIFKRNYLSSSFQETSPRFFFTTNRDNRVVVVQDGSIRWCYTFSQNYHSYTIASRN 74
           P SHPIF     SS     S RF F     ++  V+Q  ++RWC      Y       R 
Sbjct: 3   PESHPIFDTKTNSSG---KSRRFVFNIGIASKYGVLQGNTLRWCSAGGHEYQYLEFEPR- 58

Query: 75  FDIKDSLISNSGSFVCYYSDTDISIMEIPWXXXXXXXXXXXXCIQKYRYSFKKYSLTVKQ 134
            D    +I+ SGS +C Y+   + I+ + W               K           +KQ
Sbjct: 59  IDYTSVVINESGSLLCLYNSKQVQILAVSWDES------------KSDTILISPPAGIKQ 106

Query: 135 VLFHPLATLESCLVVLLSDDTIVFIXXXXXXXXXXXXYILNKKSKSIGLSSQISDIQSLT 194
            L+HP   L SCL VL + D I                ILN  +K +G+ S + DI S++
Sbjct: 107 ALWHPRGRLGSCLAVLTTQDEICLYELLTEDYTEPTT-ILNTCTKELGMGSVVKDITSMS 165

Query: 195 FSQDGLTLYALSSSAATDVYAFYPCLPPSAQFSLEQLENLVNKSVVQYEELREDDPTALK 254
           FS DGLTLY LS+S   D+Y+ YPCLP   + S   L+++ NK+++QY++L ++D   L+
Sbjct: 166 FSSDGLTLYLLSTSEGADIYSIYPCLPSEMEISGALLKSVFNKALLQYQDLNDNDSPDLR 225

Query: 255 INIIKQLKFTSDLYKKGKRALEEDTDSKTWKYDVPLEYRLIRPQGPFTISPFPDSLYYSS 314
             + KQL+F S L KK      +DT+S      +   +R  R QGPFTI+PFPD+LY ++
Sbjct: 226 RKVTKQLQFVSKLQKKNDY---KDTESHV--VTISKAHRSPRAQGPFTINPFPDNLYLAT 280

Query: 315 PTHIVSVPI-DTTNELLVLSFSDGSVVSLFQDLELTMSWDQDNFNENNSLVLLELIKTKE 373
              +  + +     ELL++SF DG+++  F D E  MSW+ + F ENNSL++L  +    
Sbjct: 281 GRQVEVIKLQGCAAELLLISFDDGTILECFPDREPVMSWEDEGFCENNSLIVLGSV---- 336

Query: 374 QNIRKLTTYAHQYGTFYILGSVK----NFEVLTSHWSSTLAIC-IKSSDIRDLSNLLIKS 428
            NI       + Y TF +L S K    +   L     S+L  C I   D  DLS  +++ 
Sbjct: 337 -NIGGEIALVNGY-TFVVLSSAKVTFVSLRKLAQVIESSLNDCDISYFDEADLSEEVVE- 393

Query: 429 VIKPFDNAAYELTSGGWWCSPTISSLLFINKSTVIELNEKPKXXXXXXXXXXXXXXXAQK 488
                          G +CS  I +     KS V  L+E                  A K
Sbjct: 394 -------------KNGRFCSAIICA--SSEKSCVALLSE-----TTTSHIDIPFSLDAPK 433

Query: 489 YIPPLEDKIFKIE--LPMGILISDLNNMNTVFKEESNKQLTIPIPSQERNVTLFNKTNEN 546
               L      +E   P G  ++++  +N   +    K L   +    R   L N++NE+
Sbjct: 434 MRTALGTAKTDVEQYRPYGQPLNEVLALNEKVQALLKKPLQTGVSPSLRQAKLNNESNED 493

Query: 547 QLETLTKISKVIGIKISMGQSLGFGIYNKILDQQNIVEXXXXXXXXXXEKEKILNTKYNE 606
           QL  LT ISK +  +I+  Q+L   +Y ++  QQ  +           E +  +  +  +
Sbjct: 494 QLSLLTSISKEVMTRIASAQTLALSLYLRLSCQQGELTQHLETVSKVEELQSKVLRRLKD 553

Query: 607 QADKLRAFTERQEKLMSRLLIMNEKLKKADLDTNLLNISISKKELEFFKEIRKQVLLFNE 666
           Q+ +  A   + + + SRL  ++ KLK+        +  IS  ELE+FKEIR QV+ FN 
Sbjct: 554 QSSRWEAAQAKNKSISSRLEQISSKLKQVSSSGKFQSQPISNHELEWFKEIRDQVIRFNR 613

Query: 667 FVHKQKDQHDTLLFIKKELIRIK-------GENAIVDENDFKQWDRLRDMLHDDATTIET 719
            VH+Q+   +TL  +K EL  +          ++  D  D   WD LR +L  D   I  
Sbjct: 614 LVHEQQSLGNTLSNLKCELEYVHVESKEGKSGSSSADNKDEVPWDELRALLAKDLRIIGE 673

Query: 720 CTESIKNINFDLD 732
           C +S++ +   LD
Sbjct: 674 CQDSLQGVAKQLD 686

>KLTH0H10692g Chr8 complement(921787..923862) [2076 bp, 691 aa] {ON}
           similar to uniprot|P40368 Saccharomyces cerevisiae
           YJL061W NUP82 Subunit of the nuclear pore complex (NPC)
           forms a subcomplex with Nup159p and Nsp1p interacts with
           Nup116p and is required for proper localization of
           Nup116p in the NPC
          Length = 691

 Score =  262 bits (670), Expect = 9e-77,   Method: Compositional matrix adjust.
 Identities = 197/736 (26%), Positives = 341/736 (46%), Gaps = 66/736 (8%)

Query: 15  PTSHPIFKRNYLSSSFQETSPRFFFTTNRDNRVVVVQDGSIRWCYTFSQNYHSYTI-ASR 73
           P +HPIF+   L  S  E   R    T   +R ++++  S++WC   + NY    + A  
Sbjct: 3   PEAHPIFQARSLGESRSE---RLCLHTKDLSRTILLEGNSLKWCLMDAPNYEYMELNAIS 59

Query: 74  NFDIKDSLISNSGSFVCYYSDTDISIMEIPWXXXXXXXXXXXXCIQKYRYSFKKYSLTVK 133
           N+    +++++SG+ +C  +  +I ++ + W              + YR    K    VK
Sbjct: 60  NY--TSAVLNDSGTLLCLNNVDEIQVLALSWDQTRP---------ESYRI---KVPAGVK 105

Query: 134 QVLFHPLATLESCLVVLLSDDTIVFIXXXXXXXXXXXXYILNKKSKSIGLSSQISDIQSL 193
           QVL+HP   L+SCL VL   D I+               +LN  +  +G+ S + DI+S+
Sbjct: 106 QVLWHPRGRLDSCLTVLNKRDEILLYELLSEDFSAPTT-VLNASTNELGMGSSVKDIESV 164

Query: 194 TFSQDGLTLYALSSSAATDVYAFYPCLPPSAQFSLEQLENLVNKSVVQYEELREDDPTAL 253
            FS DGLTLY +S S   DV++ YPC+P     + + L+   NK+++QY+EL E D   L
Sbjct: 165 CFSADGLTLYLMSVSEGADVFSIYPCMPSELSITRKALKYNFNKALLQYQELSEGDSPEL 224

Query: 254 KINIIKQLKFTSDLYKKGKRALEEDTDSKT---WKYDVPLEYRLIRPQGPFTISPFPDSL 310
           K+   +QL F S LY +   A     DS+T     + +   YR  R QGPFTISPFP+ L
Sbjct: 225 KLKATRQLHFMSSLYNQPHDA----DDSQTNLLQTFHIRKAYRNARAQGPFTISPFPEKL 280

Query: 311 YYSSPTHIVSVPI-DTTNELLVLSFSDGSVVSLFQDLELTMSWDQDNFNENNSLVLLELI 369
           Y ++   I ++ + D T ELL+++F D +++  F DL   MSW+    +E NSL+ +  +
Sbjct: 281 YLATAKQIKAIALEDETTELLLITFDDDTILECFPDLTPVMSWEDSGSSEKNSLISVGSL 340

Query: 370 KTKEQNIRKLTTYAHQYGTFYIL-----GSVKNFEVLTSHWSSTLAICIKSSDIRDLSNL 424
           K          + +  YG+ ++L      +V N   LT     +L  C       D + L
Sbjct: 341 KLP-------GSISLIYGSCFVLISAEKAAVVNLSRLTRSIERSLDDC-------DATEL 386

Query: 425 LIKSVIKPFDNAAYELTSGGWWCSPTISSLLFINKSTVIELNEKPKXXXXXXXXXXXXXX 484
             + + +          S G W    +  ++ +++  +  ++                  
Sbjct: 387 SEEDLTEEITEKKGTFQSAGLWPESGMQKIVLLSEKEITSID------------ISSMQT 434

Query: 485 XAQKYIPPLEDKIFKIELPMGILISDLNNMNTVFKEESNKQLTIPIPSQERNVTLFNKTN 544
            A      +E      + P    +S++  +N   +      L+  IP+  R  TL N  N
Sbjct: 435 PASSTTEKIEKSETNRQRPYSQPLSEVQTLNQKVQSLLKSPLSTVIPAALRQKTLNNTDN 494

Query: 545 ENQLETLTKISKVIGIKISMGQSLGFGIYNKILDQQNIVEXXXXXXXXXXEKEKILNTKY 604
           E+QL  LT ISK +  ++++ Q+LG  ++ ++L QQ+ +            K++ ++   
Sbjct: 495 EDQLSLLTDISKEVLSRVTLAQTLGLSLHLRLLGQQDELAQHLRDVSELRTKKERVSAHL 554

Query: 605 NEQADKLRAFTERQEKLMSRLLIMNEKLKKADLDTNLLNISISKKELEFFKEIRKQVLLF 664
             Q  +  A  E+ + +  R   ++  + +    + L +  I+K E+E+FKE+R QV+ F
Sbjct: 555 ASQKPRWEAIQEKNKSIALRFESLHRNMTQISKSSQLQSQPIAKAEMEWFKELRNQVVRF 614

Query: 665 NEFVHKQKDQHDTLLFIKKELIRIKGENAIVDENDFKQ--------WDRLRDMLHDDATT 716
           N  VH+Q+D  + L  +K  L  ++ ++A       K         WD L+ ML  D+  
Sbjct: 615 NRLVHEQQDLAEALSSLKLSLEYVRVDSAEAASRSKKSAESAGGVPWDELQAMLAKDSRI 674

Query: 717 IETCTESIKNINFDLD 732
           I+ C   ++    +LD
Sbjct: 675 IKECQAELQCTTQELD 690

>Ecym_6290 Chr6 (543547..545562) [2016 bp, 671 aa] {ON} similar to
           Ashbya gossypii AEL168C
          Length = 671

 Score =  261 bits (667), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 196/722 (27%), Positives = 342/722 (47%), Gaps = 62/722 (8%)

Query: 18  HPIFKRNYLSSSFQETSPRFFFTTNRDNRVVVVQDGSIRWCYTFSQNYHSYTIASRNFDI 77
           HPIF+       F+  S           ++V   D ++R+          +T  S++ DI
Sbjct: 6   HPIFQ----VPPFRTLSKLHVHVCKNATQIVTCFDKNLRYARV-----TEHTFKSKHLDI 56

Query: 78  KDS---LISNSGSFVCYYSDTDISIMEIPWXXXXXXXXXXXXCIQKYRYSFKKYSLTVKQ 134
           K S   +++NSG+ + +Y   D+ + ++                   + S  +  L +KQ
Sbjct: 57  KHSEHSILNNSGTLIAFYGSNDVELFDM-----------------DGKKSCLRVELGIKQ 99

Query: 135 VLFHPLATLESCLVVLLSDDTIVFIXXXXXXXXXXXXYILNKKSKSIGLSSQISDIQSLT 194
           VL+HPLA L+SCLVVL  ++TI  +             +LN+K   +G+SS +S+I S+ 
Sbjct: 100 VLWHPLAYLDSCLVVLTKENTIE-LYELAKANFMYPTVVLNEKLPQLGISSHVSEICSMA 158

Query: 195 FSQDGLTLYALSSSAATDVYAFYPCLPPSAQFSLEQLENLVNKSVVQYEELREDDPTALK 254
           FS DGLTLY LS     DVYA +P LP   +      E+   K+   YE + +D P   K
Sbjct: 159 FSPDGLTLYLLSLEEGGDVYALHPLLPSRLRIKRSFWESQWYKATALYESIDKDTPNEKK 218

Query: 255 INIIKQLKFTSDLYKKGKRALEEDTDSKTWKYDVPLEYRLIRPQGPFTISPFPDSLYYSS 314
           I +I+   F S +YK        D DS+ +  ++P   R++ P+GPF+I  FP+ LY ++
Sbjct: 219 IAMIEHFDFVSKIYKMI------DKDSEFFDVNIPEHKRMVTPRGPFSIYGFPEELYNTT 272

Query: 315 PTHIVSVPI-DTTNELLVLSFSDGSVVSLFQDLELTMSWDQDNFNENNSLVLLELIKTKE 373
            T ++++P+ D    +L+LSF DG+++SLF D+EL MSW + + N   S VL+E  +   
Sbjct: 273 ATKLITLPVNDEGAYVLILSFDDGTILSLFPDIELLMSWSR-SLNNACSFVLIEKFRAGG 331

Query: 374 QNIRKLTTYAHQYGTFYILGSVKNFEVLTSHWSSTLAICIKSSDIRDLSNLLIKSVIKPF 433
           +       +A + G   +     N  ++   +   L  CIK  DI  + ++ + S I P 
Sbjct: 332 E------IFAIESGVAIL--EKNNAHIVRFPYLKALGECIKEGDIAPMVDVKLTSDITPL 383

Query: 434 DNAAYELTSGGWWCSPTISSLLFINKSTVIELNEKPKXXXXXXXXXXXXXXXAQKYIPPL 493
             + + + +   W  P+   +LFI  S +  + +                   +  + P 
Sbjct: 384 AGSYHTVVT---WNEPSTKGILFIGNSVIRSIPDD------------VGLSSFKPRVDPA 428

Query: 494 EDKIFKIELPMGILISDLNNMNTVFKEESNKQLTIPIPSQERNVTLFNKTNENQLETLTK 553
             +  K  +     + +L   N   +    + L + +P +++NV L ++ NE+QL TLTK
Sbjct: 429 ISQNGKYTVCFPSTMEELLKTNKALQHTLRQPLPL-VPLEQKNVPLNSEFNEHQLATLTK 487

Query: 554 ISKVIGIKISMGQSLGFGIYNKILDQQNIVEXXXXXXXXXXEKEKILNTKYNEQADKLRA 613
           IS  +  +I + QSLG+ +YN+   QQ  +           ++   L         +L +
Sbjct: 488 ISTEVMDRIILAQSLGYLMYNRAATQQFELCRQLETVSKLNDRSVTLKQNTKSLTCRLDS 547

Query: 614 FTERQEKLMSRLLIMNEKLKKADLDTNLLNISISKKELEFFKEIRKQVLLFNEFVHKQKD 673
            +++   L SRL  + + L K +       + +S KE  +F+E++  VL FNE+V +   
Sbjct: 548 VSKKDIALRSRLEKLQQSLDKVNESPKFNELPLSMKERAWFRELKNDVLAFNEYVLQNSK 607

Query: 674 QHDTLLFIKKELIRIKGENAIVDENDFKQWDRLRDMLHDDATTIETCTESIKNINFDLDR 733
             + L F+KKEL  I+  +  +   +   +++L+D+L  D+  I  C + +     DL+ 
Sbjct: 608 LCEELNFLKKELELIESNHGNIPNEELFNFEKLQDLLTLDSKMIGDCNDQLLAAAKDLEN 667

Query: 734 AL 735
            L
Sbjct: 668 KL 669

>AEL168C Chr5 complement(320121..322142) [2022 bp, 673 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL061W
           (NUP82)
          Length = 673

 Score =  201 bits (511), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 184/731 (25%), Positives = 328/731 (44%), Gaps = 78/731 (10%)

Query: 18  HPIFKRNYLSSSFQETSPRFFFTTNRDN-RVVVVQDGSIRWCYTFSQNYHSYTIASRNFD 76
           HPIF  + L +S      R    T+ D  ++V   +  +R      Q Y S+       D
Sbjct: 6   HPIFNADALGASH-----RLHAHTHGDGTKIVGYYNKHLRLGRFTEQTYKSW---HAEVD 57

Query: 77  IK-DSLISNSGSFVCYYSDTDISIMEIPWXXXXXXXXXXXXCIQKYRYSFKKYSLTV--- 132
            K  S+++ SGS + +Y D  I +++                        KK +LTV   
Sbjct: 58  AKASSILNGSGSLLAFYGDHIIEVVD---------------------REGKKITLTVNGG 96

Query: 133 -KQVLFHPLATLESCLVVLLSDDTIVFIXXXXXXXXXXXXYILNKKSKSIGLSSQISDIQ 191
            KQVL+HPLA L+SCLVVL   +TI  I             +LN+ +  +G+SS++ DI 
Sbjct: 97  IKQVLWHPLAYLDSCLVVLTGQETIE-IYELNEPRYEKPTLVLNEPTSQLGISSRVIDIT 155

Query: 192 SLTFSQDGLTLYALSSSAATDVYAFYPCLPPSAQFSLEQLENLVNKSVVQYEELREDDPT 251
           ++ F+ DGL+LY  S+S   DV+   P LP   +    +     NK+   Y  L +D P 
Sbjct: 156 NIAFAPDGLSLYLFSTSEGGDVHVICPLLPSRIKADRAKWARQWNKATALYSTLTKDTPD 215

Query: 252 ALKINIIKQLKFTSDLYKKGKRALEEDTDSKTWKYDVPLEYRLIRPQGPFTISPFPDSLY 311
             K+  I+ L+F + L +    A+E+  +    +  +P   R    QGP+ I  FP+ LY
Sbjct: 216 DAKVATIEYLEFVTQLLQ----AIEK--NGSDGELVIPEHRRRTISQGPYNIHGFPEKLY 269

Query: 312 YSSPTHIVSVPI-DTTNELLVLSFSDGSVVSLFQDLELTMSWDQDNFNENNSLVLLELIK 370
            +  T +  VP+ ++   LL+LSF D + + LF   E+ MSW +D  N    +++ E   
Sbjct: 270 SAVGTKLTVVPLGESEAHLLLLSFDDSTNILLFPSTEVLMSWTKDLKNAYTLMLVEEFTA 329

Query: 371 TKEQNIRKLTTYAHQYGTFYILG--SVKNFEVLTSHWSSTLAICIKSSDIRDLSNLLIKS 428
           T        T +A   G   +LG  S +  E+    +   L  CI+  ++  L ++   S
Sbjct: 330 TG-------TAFATCDGV-AVLGIDSAQRVEI---PYLQALEDCIRDCNLAALQDINFTS 378

Query: 429 VIKPFDNAAYELTSGGWWCSPTISSLLFI--NKSTVIELNEKPKXXXXXXXXXXXXXXXA 486
            I       + +     + +P    ++ +  + + ++   E  K                
Sbjct: 379 SICKIPGKFHSVAR---FNAPGNKGIILVGDHHAKIVPSTEAAKSDTETELDSQ------ 429

Query: 487 QKYIPPLEDKIFKIELPMGILISDLNNMNTVFKEESNKQLTIPIPSQERNVTLFNKTNEN 546
                P ++  + +  P    + ++ N N   +   ++ L + +P   +N+ L +  NE 
Sbjct: 430 -----PGKEPTYTVCFPNS--LEEILNTNKELQRRKHQPLPL-VPPALKNIPLNSDLNEQ 481

Query: 547 QLETLTKISKVIGIKISMGQSLGFGIYNKILDQQNIVEXXXXXXXXXXEKEKILNTKYNE 606
            L TLT ISK +  +I + QS G  ++N++  QQ  +            +  +L      
Sbjct: 482 HLATLTNISKEVMDRIILSQSAGLLMHNRLSLQQYELHRQVETVADICSRHSVLRDSSEA 541

Query: 607 QADKLRAFTERQEKLMSRLLIMNEKLKKADLDTNLLNISISKKELEFFKEIRKQVLLFNE 666
            + +L +  +R  +L  RL ++   L + +      ++ +SKKE ++F+E++ Q + FN+
Sbjct: 542 MSSRLTSVLKRDRRLKQRLCMLQSTLNRINSSHKFSDLPLSKKEADWFRELKNQAISFND 601

Query: 667 FVHKQKDQHDTLLFIKKELIRIKGENAIVDENDFKQWD--RLRDMLHDDATTIETCTESI 724
           +V +     D L F+K EL  +  E+   D  + + +D  RL+++L  D+  I  CT+++
Sbjct: 602 YVLQSAQLRDELAFLKNELESLP-EHRQHDRQEEEPFDFRRLQELLKLDSKIITECTDNL 660

Query: 725 KNINFDLDRAL 735
                +L+R L
Sbjct: 661 SAAARELERKL 671

>KLLA0F01661g Chr6 complement(156609..158672) [2064 bp, 687 aa] {ON}
           weakly similar to uniprot|P40368 Saccharomyces
           cerevisiae YJL061W NUP82 Subunit of the nuclear pore
           complex (NPC) forms a subcomplex with Nup159p and Nsp1p
           interacts with Nup116p and is required for proper
           localization of Nup116p in the NPC
          Length = 687

 Score =  168 bits (425), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 188/731 (25%), Positives = 305/731 (41%), Gaps = 89/731 (12%)

Query: 20  IFKRNYLSSSFQETS--PRFFFTTNRDNRVVVVQDGSIRWCYTFSQNYHSYTIASRNFDI 77
           +F    L + FQE S  P      N  N + + QD  +R        Y SY +    F  
Sbjct: 3   LFNTEDLKAIFQEVSLNPSDRLVCNNSNTIYLWQDNILRVQSDHETQYRSYNV-ELPFVP 61

Query: 78  KDSLISNSGSFVCYYSDTDISIMEIPWXXXXXXXXXXXXCIQKYRYSFKKYSLTVKQVLF 137
           +  +IS SG  V +++++++ +ME+                 + R  F   SL +K++L+
Sbjct: 62  EQMVISPSGGLVAFHANSELYVMEVNEQ-------------SRLRKHFNT-SLGIKKLLW 107

Query: 138 HPLATLESCLVVLLSDDTIVFIXXXXXXXXXXXXYILNKKSKSIGLSSQISDIQSLTFSQ 197
           HPLAT     V+L  D TI                + N+KS+S GLS  +  +  + F  
Sbjct: 108 HPLATYGLSFVILHDDSTIRIYDLEDLEPESIT--VFNRKSRSFGLSDHVESVCDIAFDP 165

Query: 198 DGLTLYALSSSAATDVYAFYPCLPPSAQFSLEQLEN-------------LVNKSVVQYEE 244
            GLTLY LSS    D+YA +PCLP +         N             +++KS+  Y  
Sbjct: 166 TGLTLYLLSSFNYCDIYAIHPCLPKNFSLRSNDTSNVTSRTKNGSLADYMLHKSLSLYNS 225

Query: 245 LR-------------EDDPTALKINIIKQLKFTSDLYKKGKRALEEDTDSKTWKYDVPLE 291
           L              E D   LK +++KQ++F  D YKK      +  D+ T K      
Sbjct: 226 LDKQLKLISGSDPDVESDYLTLKHDLLKQIQFF-DNYKKN-----DGIDTFTSK-----A 274

Query: 292 YRLIRPQGPFTISPFPDSLYYSSPTHIVSVPIDTTNELLVLSFSDGSVVSLFQDLELTMS 351
            R   PQGPF I  FP +L     T +  +P+     LL L F DG+ V LF D E+ MS
Sbjct: 275 IRNSVPQGPFIIKKFPTALNAKEVTGLTIIPVGERLGLLNLQFIDGTNVVLFSDSEIVMS 334

Query: 352 WDQDNFNENNSLVLLELIKTKEQNIRKLTTYAHQYGTFYILGSVKNFEVLTSHWSSTLAI 411
           W   +    N+L ++ +   K Q   +L   +     F    S    E+    W   LA 
Sbjct: 335 WSLRSNTTFNNLSVITMFNAKGQC--QLLNSSEPKLVFTGDSSTTIMEM---PWLEPLAQ 389

Query: 412 CIKSSDIRDLSNLLIKSVIKPFDNAAYELTSGGWWCSPTISSLLFINKST--VIELNEKP 469
           CI+  D   + ++        F+N    ++        T+S  +  N ++  VIE N+K 
Sbjct: 390 CIRLHDFSIIDDV-------KFENKIRTVSGTFLGVLSTLSGDILYNGNSFKVIESNDK- 441

Query: 470 KXXXXXXXXXXXXXXXAQKYIPPLEDKIFKIELPMGILISDLNNMNTVFKEESNKQLTIP 529
                            QK I   ++  +  +  +     +L+ + T +K E+N  ++  
Sbjct: 442 --------------STTQKPINRTDEVKYTYKPSLPTSGKELDMLLTKYKTEANGFIS-G 486

Query: 530 IPSQERNVTLFNKTNENQLETLTKISKVIGIKISMGQSLGFGIYNKILDQQNIVEXXXXX 589
           IP     + L N +NE QLE ++++ K    ++ +GQ + F ++NK  ++   +      
Sbjct: 487 IPDSLAPLPLKNNSNERQLEVVSELYKETMKRVKLGQMILFRMFNKSNEEVAELHRQLRK 546

Query: 590 XXXXXEKEKILNTKYNEQADKLRAFTERQEKLMSRLLIMNEKLKKADLDTNLLNISISKK 649
                     LN    +  ++   + E+ + L  RL  + E     + +  L   SIS+ 
Sbjct: 547 TNEIEMLRNKLNGNLGDLQERYSRYEEKSKTLEKRLDKLKETFSSIENNEKLRTSSISEA 606

Query: 650 ELEFFKEIRKQVLLFNEFVHKQKDQHDTLLFIKKELIRIKGENAIVDENDFKQWDRLRDM 709
           EL +FK I+ QVL FN +VH      + L F+  +L      +    E +F     L+ M
Sbjct: 607 ELVWFKSIKNQVLKFNNYVHLTNKLREELEFLDTQLRSTTKGDDFFSELEFSS---LQQM 663

Query: 710 LHDDATTIETC 720
           L +D   I +C
Sbjct: 664 LLNDKKVINSC 674

>KNAG0H00400 Chr8 complement(58817..60220) [1404 bp, 467 aa] {ON}
           Anc_2.623 YKL075C
          Length = 467

 Score = 36.2 bits (82), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 21/47 (44%), Positives = 29/47 (61%), Gaps = 1/47 (2%)

Query: 503 PMGILISDLNNMNTVFKEESNKQLTIPIPSQERNVTLFNKTNENQLE 549
           PM  +IS  N  N +  E+S K   +P P+ ER+VTL NK+ EN +E
Sbjct: 265 PMMKIISLYNEYNELM-EKSEKNGFLPSPNSERDVTLMNKSMENGIE 310

>YOR038C Chr15 complement(402761..405388) [2628 bp, 875 aa] {ON}
           HIR2Subunit of the HIR complex, a nucleosome assembly
           complex involved in regulation of histone gene
           transcription; recruits Swi-Snf complexes to histone
           gene promoters; promotes heterochromatic gene silencing
           with Asf1p
          Length = 875

 Score = 33.5 bits (75), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 39/74 (52%), Gaps = 10/74 (13%)

Query: 190 IQSLTFSQDGLTLYALSSSAATDVYAFYP-----CLPPSAQFSLEQLENLVNKSVVQYEE 244
           I  +++SQDG TL+A+S+ A    +AF        LP +   SL++    VNK + + EE
Sbjct: 325 INDMSWSQDGFTLFAISNDATLYTFAFQEKDLGVALPQTEIKSLQE----VNKKLPKLEE 380

Query: 245 -LREDDPTALKINI 257
            L E  P +   NI
Sbjct: 381 PLAEQIPKSFPENI 394

>KLLA0F04499g Chr6 complement(434569..435144) [576 bp, 191 aa] {ON}
           highly similar to uniprot|P05738 Saccharomyces
           cerevisiae uniprot|P05738 Saccharomyces cerevisiae
           YGL147C RPL9A Protein component of the large (60S)
           ribosomal subunit, nearly identical to Rpl9Bp and has
           similarity to E. coli L6 and rat L9 ribosomal proteins
           and to YNL067W uniprot|P51401 Saccharomyces cerevisiae
           YNL067W RPL9B Protein component of the large (60S)
           ribosomal subunit, nearly identical to Rpl9Ap and has
           similarity to E. coli L6 and rat L9 ribosomal proteins
          Length = 191

 Score = 31.6 bits (70), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 12/43 (27%), Positives = 26/43 (60%)

Query: 493 LEDKIFKIELPMGILISDLNNMNTVFKEESNKQLTIPIPSQER 535
           +  +I K+  P G+L  +L +++  F + SN+Q+ I + + +R
Sbjct: 20  IRSRIIKVTGPRGVLTKNLKHIDVTFTKVSNRQIKITVHNGDR 62

>KAFR0C06010 Chr3 complement(1196930..1199554) [2625 bp, 874 aa]
           {ON} Anc_5.634 YOR038C
          Length = 874

 Score = 32.3 bits (72), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 26/45 (57%), Gaps = 2/45 (4%)

Query: 176 KKSKSIGLSSQISD--IQSLTFSQDGLTLYALSSSAATDVYAFYP 218
           K+ K +  + Q+SD  I  + +S DGLTL+A+S       +AF P
Sbjct: 303 KRMKPLFNAVQVSDTPINDMVWSSDGLTLFAISDDGILYTFAFQP 347

>YLR115W Chr12 (377985..380564) [2580 bp, 859 aa] {ON}  CFT2Subunit
           of the mRNA cleavage and polyadenlylation factor (CPF);
           required for pre-mRNA cleavage, polyadenylation and
           poly(A) site recognition, 43% similarity with the
           mammalian CPSF-100 protein.
          Length = 859

 Score = 32.3 bits (72), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 41/72 (56%), Gaps = 9/72 (12%)

Query: 646 ISKKELEFFKEIRKQVLLFNEFVHKQKDQHDTLLFIKKELIRIKGENAIVDENDFKQWDR 705
           +SK+E E FK   K+         K++D++  +L +K+E  ++   NAI+D+ + ++  R
Sbjct: 417 LSKEETEAFKVQLKE---------KKRDRNKKILLVKRESKKLANGNAIIDDTNGERAMR 467

Query: 706 LRDMLHDDATTI 717
            +D+L ++   +
Sbjct: 468 NQDILVENVNGV 479

>NCAS0H02680 Chr8 (529371..530642) [1272 bp, 423 aa] {ON} Anc_5.551
          Length = 423

 Score = 32.3 bits (72), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 45/77 (58%), Gaps = 4/77 (5%)

Query: 504 MGILISDLNNMNTVFKEESNKQLTIPIPSQERNVTLFNKTNENQLETLTKISKVIGIKIS 563
           +G +IS L  M  V K ++N +  I  P  + + T+ +  +E++ ++   I  +IG  ++
Sbjct: 211 IGSIISFLGTM-LVTKSDANSRHLITHPPMKFDTTITSSGDEDEFDS---IQILIGNLLA 266

Query: 564 MGQSLGFGIYNKILDQQ 580
           +G +L +GIY+ +L ++
Sbjct: 267 LGGALFYGIYSTLLKRK 283

>Smik_15.217 Chr15 complement(368813..371440) [2628 bp, 875 aa] {ON}
           YOR038C (REAL)
          Length = 875

 Score = 32.3 bits (72), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 38/74 (51%), Gaps = 10/74 (13%)

Query: 190 IQSLTFSQDGLTLYALSSSAATDVYAFYP-----CLPPSAQFSLEQLENLVNKSVVQYEE 244
           I  +++SQDG TL+A+S+ A    +AF        LP     SL++L    NK + + EE
Sbjct: 325 INDMSWSQDGFTLFAISNDATLYTFAFQEKDLGVALPQKEIKSLQEL----NKKLPKLEE 380

Query: 245 -LREDDPTALKINI 257
            L E  P  L  N+
Sbjct: 381 PLVEQIPKNLSENV 394

>Kwal_23.3430 s23 complement(286045..286620) [576 bp, 191 aa] {ON}
           YNL067W (RPL9B) - Ribosomal protein L9B (L8B) (rp24)
           (YL11) [contig 252] FULL
          Length = 191

 Score = 31.2 bits (69), Expect = 6.1,   Method: Composition-based stats.
 Identities = 12/43 (27%), Positives = 27/43 (62%)

Query: 493 LEDKIFKIELPMGILISDLNNMNTVFKEESNKQLTIPIPSQER 535
           ++ ++ K+  P G+L  +L +++  F + SNKQ+ I + + +R
Sbjct: 20  IKSRVIKVTGPRGVLTKNLKHIDVTFSKVSNKQVKITVHNGDR 62

>ADL290W Chr4 (191546..192121) [576 bp, 191 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YNL067W (RPL9B) and
           Syntenic homolog of Saccharomyces cerevisiae YGL147C
           (RPL9A)
          Length = 191

 Score = 31.2 bits (69), Expect = 6.2,   Method: Composition-based stats.
 Identities = 13/43 (30%), Positives = 27/43 (62%)

Query: 493 LEDKIFKIELPMGILISDLNNMNTVFKEESNKQLTIPIPSQER 535
           ++ ++ K+  P G L  +L +++  F + SNKQ+TI + + +R
Sbjct: 20  IKSRVIKVTGPRGTLEKNLKHIDVTFTKVSNKQITITVHNGDR 62

>Kwal_23.4783 s23 (865055..865630) [576 bp, 191 aa] {ON} YNL067W
           (RPL9B) - 1:1 [contig 5] FULL
          Length = 191

 Score = 31.2 bits (69), Expect = 7.0,   Method: Composition-based stats.
 Identities = 12/43 (27%), Positives = 27/43 (62%)

Query: 493 LEDKIFKIELPMGILISDLNNMNTVFKEESNKQLTIPIPSQER 535
           ++ ++ K+  P G+L  +L +++  F + SNKQ+ I + + +R
Sbjct: 20  IKSRVIKVTGPRGVLTKNLKHIDVTFTKVSNKQVKITVHNGDR 62

>ZYRO0C05060g Chr3 complement(397083..399233) [2151 bp, 716 aa] {ON}
           similar to uniprot|Q75EC3 Ashbya gossypii AAR151W
           AAR151Wp and weakly similar to YBR212W uniprot|P32831
           Saccharomyces cerevisiae YBR212W NGR1 negative growth
           regulatory protein
          Length = 716

 Score = 32.0 bits (71), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 28/47 (59%), Gaps = 1/47 (2%)

Query: 539 LFNKTNENQLETL-TKISKVIGIKISMGQSLGFGIYNKILDQQNIVE 584
           L  K NENQL+TL +    ++ +KI  G++ GF  + K +D +  ++
Sbjct: 428 LTPKINENQLQTLFSPFGNILTVKIPQGKNCGFVKFEKRIDAEAAIQ 474

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.133    0.379 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 76,682,921
Number of extensions: 3492736
Number of successful extensions: 13233
Number of sequences better than 10.0: 121
Number of HSP's gapped: 13628
Number of HSP's successfully gapped: 133
Length of query: 742
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 625
Effective length of database: 40,065,477
Effective search space: 25040923125
Effective search space used: 25040923125
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 70 (31.6 bits)