Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0E044708.267ON94943313e-41
Smik_4.3598.267ON105512092e-22
Kpol_543.428.267ON112492057e-22
TPHA0A017708.267ON104492031e-21
Skud_4.3758.267ON105492012e-21
Suva_2.2748.267ON105492013e-21
YDR115W8.267ON105511995e-21
KAFR0B054908.267ON85491977e-21
NDAI0J013408.267ON141512009e-21
KNAG0H032208.267ON86501942e-20
Ecym_43038.267ON109511935e-20
KLTH0G13574g8.267ON112491902e-19
SAKL0H16918g8.267ON111491883e-19
TDEL0F039408.267ON110491874e-19
ZYRO0C01540g8.267ON97511864e-19
AGR081C8.267ON130491884e-19
Kwal_56.237768.267ON130491877e-19
CAGL0B01793g8.267ON98491831e-18
NCAS0B038208.267ON115491841e-18
KLLA0F19250g8.267ON116491823e-18
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0E04470
         (94 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0E04470 Chr5 (1143613..1143897) [285 bp, 94 aa] {ON} Anc_8.2...   132   3e-41
Smik_4.359 Chr4 (643476..643793) [318 bp, 105 aa] {ON} YDR115W (...    85   2e-22
Kpol_543.42 s543 (92324..92662) [339 bp, 112 aa] {ON} (92324..92...    84   7e-22
TPHA0A01770 Chr1 complement(360221..360535) [315 bp, 104 aa] {ON...    83   1e-21
Skud_4.375 Chr4 (653818..654135) [318 bp, 105 aa] {ON} YDR115W (...    82   2e-21
Suva_2.274 Chr2 (476840..477157) [318 bp, 105 aa] {ON} YDR115W (...    82   3e-21
YDR115W Chr4 (682175..682492) [318 bp, 105 aa] {ON} Putative mit...    81   5e-21
KAFR0B05490 Chr2 complement(1123665..1123922) [258 bp, 85 aa] {O...    80   7e-21
NDAI0J01340 Chr10 complement(310691..311116) [426 bp, 141 aa] {O...    82   9e-21
KNAG0H03220 Chr8 complement(602460..602720) [261 bp, 86 aa] {ON}...    79   2e-20
Ecym_4303 Chr4 complement(647272..647601) [330 bp, 109 aa] {ON} ...    79   5e-20
KLTH0G13574g Chr7 complement(1164609..1164947) [339 bp, 112 aa] ...    78   2e-19
SAKL0H16918g Chr8 complement(1487378..1487713) [336 bp, 111 aa] ...    77   3e-19
TDEL0F03940 Chr6 (732097..732429) [333 bp, 110 aa] {ON} Anc_8.26...    77   4e-19
ZYRO0C01540g Chr3 complement(110968..111261) [294 bp, 97 aa] {ON...    76   4e-19
AGR081C Chr7 complement(882207..882599) [393 bp, 130 aa] {ON} Sy...    77   4e-19
Kwal_56.23776 s56 complement(701147..701539) [393 bp, 130 aa] {O...    77   7e-19
CAGL0B01793g Chr2 (165053..165349) [297 bp, 98 aa] {ON} some sim...    75   1e-18
NCAS0B03820 Chr2 complement(681940..682287) [348 bp, 115 aa] {ON...    75   1e-18
KLLA0F19250g Chr6 (1782824..1783174) [351 bp, 116 aa] {ON} simil...    75   3e-18

>TBLA0E04470 Chr5 (1143613..1143897) [285 bp, 94 aa] {ON}
          Anc_8.267 YDR115W
          Length = 94

 Score =  132 bits (331), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 69/94 (73%), Positives = 69/94 (73%)

Query: 1  MGIFNSLTRIACFSKSTAXXXXXXXXXXXXXXXXXXXXXXXXXDSRRWKSRGNTYQPSTL 60
          MGIFNSLTRIACFSKSTA                         DSRRWKSRGNTYQPSTL
Sbjct: 1  MGIFNSLTRIACFSKSTALNSMSLLNKSLLINNNIIGNNKLMIDSRRWKSRGNTYQPSTL 60

Query: 61 KRKRKHGFLSRAKSYTMNKILKRRKAKGRWFLSH 94
          KRKRKHGFLSRAKSYTMNKILKRRKAKGRWFLSH
Sbjct: 61 KRKRKHGFLSRAKSYTMNKILKRRKAKGRWFLSH 94

>Smik_4.359 Chr4 (643476..643793) [318 bp, 105 aa] {ON} YDR115W
           (REAL)
          Length = 105

 Score = 85.1 bits (209), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 42/51 (82%), Positives = 44/51 (86%)

Query: 44  DSRRWKSRGNTYQPSTLKRKRKHGFLSRAKSYTMNKILKRRKAKGRWFLSH 94
           D RRWKSRGNTYQPSTLKRKR  GFL+RAKS   +KILKRRK KGRWFLSH
Sbjct: 55  DQRRWKSRGNTYQPSTLKRKRTFGFLARAKSKQGSKILKRRKLKGRWFLSH 105

>Kpol_543.42 s543 (92324..92662) [339 bp, 112 aa] {ON}
           (92324..92662) [339 nt, 113 aa]
          Length = 112

 Score = 83.6 bits (205), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 40/49 (81%), Positives = 46/49 (93%)

Query: 46  RRWKSRGNTYQPSTLKRKRKHGFLSRAKSYTMNKILKRRKAKGRWFLSH 94
           RRWKSRGNTYQPSTLKRKRK GFL+RA+S + +KIL+RRKAKGRW+LSH
Sbjct: 64  RRWKSRGNTYQPSTLKRKRKFGFLARARSRSGSKILERRKAKGRWYLSH 112

>TPHA0A01770 Chr1 complement(360221..360535) [315 bp, 104 aa] {ON}
           Anc_8.267 YDR115W
          Length = 104

 Score = 82.8 bits (203), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 39/49 (79%), Positives = 45/49 (91%)

Query: 46  RRWKSRGNTYQPSTLKRKRKHGFLSRAKSYTMNKILKRRKAKGRWFLSH 94
           RRWKSRGNTYQPSTLKRKR+ GFL+RA+S   NKIL+RRKAKGRW+L+H
Sbjct: 56  RRWKSRGNTYQPSTLKRKRRIGFLARARSKQGNKILERRKAKGRWYLTH 104

>Skud_4.375 Chr4 (653818..654135) [318 bp, 105 aa] {ON} YDR115W
           (REAL)
          Length = 105

 Score = 82.0 bits (201), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 41/49 (83%), Positives = 43/49 (87%)

Query: 46  RRWKSRGNTYQPSTLKRKRKHGFLSRAKSYTMNKILKRRKAKGRWFLSH 94
           RRWKSRGNTYQPSTLKRKR  GFL+RAKS   +KILKRRK KGRWFLSH
Sbjct: 57  RRWKSRGNTYQPSTLKRKRTFGFLARAKSKQGSKILKRRKLKGRWFLSH 105

>Suva_2.274 Chr2 (476840..477157) [318 bp, 105 aa] {ON} YDR115W
           (REAL)
          Length = 105

 Score = 82.0 bits (201), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 41/49 (83%), Positives = 43/49 (87%)

Query: 46  RRWKSRGNTYQPSTLKRKRKHGFLSRAKSYTMNKILKRRKAKGRWFLSH 94
           RRWKSRGNTYQPSTLKRKR  GFL+RAKS   +KILKRRK KGRWFLSH
Sbjct: 57  RRWKSRGNTYQPSTLKRKRTFGFLARAKSKQGSKILKRRKLKGRWFLSH 105

>YDR115W Chr4 (682175..682492) [318 bp, 105 aa] {ON} Putative
           mitochondrial ribosomal protein of the large subunit,
           has similarity to E. coli L34 ribosomal protein;
           required for respiratory growth, as are most
           mitochondrial ribosomal proteins
          Length = 105

 Score = 81.3 bits (199), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 41/51 (80%), Positives = 43/51 (84%)

Query: 44  DSRRWKSRGNTYQPSTLKRKRKHGFLSRAKSYTMNKILKRRKAKGRWFLSH 94
             RRWKSRGNTYQPSTLKRKR  GFL+RAKS   +KILKRRK KGRWFLSH
Sbjct: 55  GQRRWKSRGNTYQPSTLKRKRTFGFLARAKSKQGSKILKRRKLKGRWFLSH 105

>KAFR0B05490 Chr2 complement(1123665..1123922) [258 bp, 85 aa]
          {ON} Anc_8.267 YDR115W
          Length = 85

 Score = 80.5 bits (197), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 40/49 (81%), Positives = 43/49 (87%)

Query: 46 RRWKSRGNTYQPSTLKRKRKHGFLSRAKSYTMNKILKRRKAKGRWFLSH 94
          +RWKSRGNTYQPSTLKRKRK GFLSRAKS   +KILK RK KGRW+LSH
Sbjct: 37 KRWKSRGNTYQPSTLKRKRKFGFLSRAKSKQKSKILKDRKEKGRWYLSH 85

>NDAI0J01340 Chr10 complement(310691..311116) [426 bp, 141 aa] {ON}
           Anc_8.267 YDR115W
          Length = 141

 Score = 81.6 bits (200), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 39/51 (76%), Positives = 44/51 (86%)

Query: 44  DSRRWKSRGNTYQPSTLKRKRKHGFLSRAKSYTMNKILKRRKAKGRWFLSH 94
           + +RWKSRGNTYQPSTLKRKRK+GFLSR +    +KILKRRK KGRWFLSH
Sbjct: 91  NQKRWKSRGNTYQPSTLKRKRKYGFLSRMRDRQASKILKRRKLKGRWFLSH 141

>KNAG0H03220 Chr8 complement(602460..602720) [261 bp, 86 aa] {ON}
          Anc_8.267 YDR115W
          Length = 86

 Score = 79.3 bits (194), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 37/50 (74%), Positives = 44/50 (88%)

Query: 45 SRRWKSRGNTYQPSTLKRKRKHGFLSRAKSYTMNKILKRRKAKGRWFLSH 94
          +RRWKSRGNTYQPSTLKRKRK GFL+R ++   +K+LKRRK KGRW+LSH
Sbjct: 37 TRRWKSRGNTYQPSTLKRKRKFGFLARVRASFRSKVLKRRKEKGRWYLSH 86

>Ecym_4303 Chr4 complement(647272..647601) [330 bp, 109 aa] {ON}
           similar to Ashbya gossypii AGR081C
          Length = 109

 Score = 79.0 bits (193), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 37/51 (72%), Positives = 45/51 (88%)

Query: 44  DSRRWKSRGNTYQPSTLKRKRKHGFLSRAKSYTMNKILKRRKAKGRWFLSH 94
           + RRWKSRGNT+QPSTLKRKR+ GFL+RA+S T  KILKRRK KGRW+L++
Sbjct: 59  NQRRWKSRGNTFQPSTLKRKRRVGFLARARSKTGQKILKRRKEKGRWYLTY 109

>KLTH0G13574g Chr7 complement(1164609..1164947) [339 bp, 112 aa]
           {ON} some similarities with uniprot|Q04598 Saccharomyces
           cerevisiae YDR115W
          Length = 112

 Score = 77.8 bits (190), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 37/49 (75%), Positives = 43/49 (87%)

Query: 46  RRWKSRGNTYQPSTLKRKRKHGFLSRAKSYTMNKILKRRKAKGRWFLSH 94
           RRWKSRGNTYQPSTLKRKR+ GFL+RAKS    K+LKRR+ KGRW+L+H
Sbjct: 64  RRWKSRGNTYQPSTLKRKRRVGFLARAKSKQGYKVLKRRREKGRWYLTH 112

>SAKL0H16918g Chr8 complement(1487378..1487713) [336 bp, 111 aa]
           {ON} similar to uniprot|Q04598 Saccharomyces cerevisiae
           YDR115W
          Length = 111

 Score = 77.0 bits (188), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 37/49 (75%), Positives = 43/49 (87%)

Query: 46  RRWKSRGNTYQPSTLKRKRKHGFLSRAKSYTMNKILKRRKAKGRWFLSH 94
           RRWKSRGNTYQPSTLKRKR+ GFL+RAK+   +KILK RK KGRW+L+H
Sbjct: 63  RRWKSRGNTYQPSTLKRKRRVGFLARAKNKQASKILKSRKEKGRWYLTH 111

>TDEL0F03940 Chr6 (732097..732429) [333 bp, 110 aa] {ON} Anc_8.267
           YDR115W
          Length = 110

 Score = 76.6 bits (187), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 46/49 (93%)

Query: 46  RRWKSRGNTYQPSTLKRKRKHGFLSRAKSYTMNKILKRRKAKGRWFLSH 94
           RRWKSRGNT+QPSTLKRKR+ GFL+RA+S T +++L+RRKAKGRW+L++
Sbjct: 62  RRWKSRGNTFQPSTLKRKRRIGFLARARSKTGSRVLQRRKAKGRWYLTY 110

>ZYRO0C01540g Chr3 complement(110968..111261) [294 bp, 97 aa] {ON}
          similar to uniprot|Q04598 Saccharomyces cerevisiae
          YDR115W
          Length = 97

 Score = 76.3 bits (186), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 37/51 (72%), Positives = 44/51 (86%)

Query: 44 DSRRWKSRGNTYQPSTLKRKRKHGFLSRAKSYTMNKILKRRKAKGRWFLSH 94
            RRWKSRGNT+QPSTLKRKR+ GFL+RA+S   +KIL+RRK KGRWFL+H
Sbjct: 47 GQRRWKSRGNTFQPSTLKRKRRVGFLARARSKQGSKILQRRKHKGRWFLTH 97

>AGR081C Chr7 complement(882207..882599) [393 bp, 130 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR115W
          Length = 130

 Score = 77.0 bits (188), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 36/49 (73%), Positives = 43/49 (87%)

Query: 46  RRWKSRGNTYQPSTLKRKRKHGFLSRAKSYTMNKILKRRKAKGRWFLSH 94
           +RWKSRGNTYQPSTLKRKR+ GFL+RA+S T   ILKRR+ KGRW+L+H
Sbjct: 82  KRWKSRGNTYQPSTLKRKRRVGFLARARSRTGRNILKRRREKGRWYLTH 130

>Kwal_56.23776 s56 complement(701147..701539) [393 bp, 130 aa] {ON}
           YDR115W - Hypothetical ORF [contig 173] FULL
          Length = 130

 Score = 76.6 bits (187), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 36/49 (73%), Positives = 43/49 (87%)

Query: 46  RRWKSRGNTYQPSTLKRKRKHGFLSRAKSYTMNKILKRRKAKGRWFLSH 94
           +RWKSRGNTYQPSTLKRKR+ GFL+R KS   +KILKRR+ KGRW+L+H
Sbjct: 82  KRWKSRGNTYQPSTLKRKRRVGFLARVKSKQGSKILKRRREKGRWYLTH 130

>CAGL0B01793g Chr2 (165053..165349) [297 bp, 98 aa] {ON} some
          similarities with uniprot|Q04598 Saccharomyces
          cerevisiae YDR115w
          Length = 98

 Score = 75.1 bits (183), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 36/49 (73%), Positives = 41/49 (83%)

Query: 46 RRWKSRGNTYQPSTLKRKRKHGFLSRAKSYTMNKILKRRKAKGRWFLSH 94
          RRWKSRGNTYQPSTLKRKRK GFL+R  +    KI+KRRK KGRW+L+H
Sbjct: 50 RRWKSRGNTYQPSTLKRKRKFGFLARMTNKRTAKIIKRRKEKGRWYLTH 98

>NCAS0B03820 Chr2 complement(681940..682287) [348 bp, 115 aa] {ON}
           Anc_8.267 YDR115W
          Length = 115

 Score = 75.5 bits (184), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 36/49 (73%), Positives = 42/49 (85%)

Query: 46  RRWKSRGNTYQPSTLKRKRKHGFLSRAKSYTMNKILKRRKAKGRWFLSH 94
           RRWKSRGNTYQPSTLKRKRK GFL++A+     KILKRR+ KGRW+L+H
Sbjct: 67  RRWKSRGNTYQPSTLKRKRKFGFLAKARDSQKCKILKRRRLKGRWYLTH 115

>KLLA0F19250g Chr6 (1782824..1783174) [351 bp, 116 aa] {ON} similar
           to uniprot|Q04598 Saccharomyces cerevisiae YDR115W
          Length = 116

 Score = 74.7 bits (182), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 44/49 (89%)

Query: 46  RRWKSRGNTYQPSTLKRKRKHGFLSRAKSYTMNKILKRRKAKGRWFLSH 94
           RRWKSRGNT+QPSTLKRKR+ GFL+RA+S +  +ILKRRK KGRW+L++
Sbjct: 68  RRWKSRGNTFQPSTLKRKRRVGFLARARSRSGQQILKRRKNKGRWYLTY 116

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.323    0.130    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 6,804,628
Number of extensions: 165092
Number of successful extensions: 588
Number of sequences better than 10.0: 20
Number of HSP's gapped: 587
Number of HSP's successfully gapped: 20
Length of query: 94
Length of database: 53,481,399
Length adjustment: 65
Effective length of query: 29
Effective length of database: 46,028,109
Effective search space: 1334815161
Effective search space used: 1334815161
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 59 (27.3 bits)