Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0E044608.265ON27727710831e-150
AGR083W8.265ON2951341191e-06
Ecym_43058.265ON311143940.002
KNAG0H032308.265ON281139910.004
TDEL0F039208.265ON322151890.009
KLLA0F19206g8.265ON263162880.011
ZYRO0C01584g8.265ON282123860.020
SAKL0H16962g8.265ON336152850.026
NDAI0J013508.265ON42232730.85
Skud_4.3748.265ON37360692.7
Suva_2.2738.265ON37641693.2
YDR113C (PDS1)8.265ON37343684.3
NOTE: 8 genes in the same pillar as TBLA0E04460 were not hit in these BLAST results
LIST: Kpol_543.41 Smik_4.358 NCAS0B03830 KAFR0B05510 KLTH0G13618g Kwal_56.23781 TPHA0A01780 CAGL0L12298g

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0E04460
         (277 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0E04460 Chr5 complement(1141836..1142669) [834 bp, 277 aa] {...   421   e-150
AGR083W Chr7 (883948..884835) [888 bp, 295 aa] {ON} Syntenic hom...    50   1e-06
Ecym_4305 Chr4 (649254..650189) [936 bp, 311 aa] {ON} similar to...    41   0.002
KNAG0H03230 Chr8 (602896..603741) [846 bp, 281 aa] {ON} Anc_8.26...    40   0.004
TDEL0F03920 Chr6 complement(729845..730813) [969 bp, 322 aa] {ON...    39   0.009
KLLA0F19206g Chr6 complement(1780093..1780884) [792 bp, 263 aa] ...    39   0.011
ZYRO0C01584g Chr3 (112438..113286) [849 bp, 282 aa] {ON} weakly ...    38   0.020
SAKL0H16962g Chr8 (1489800..1490810) [1011 bp, 336 aa] {ON} weak...    37   0.026
NDAI0J01350 Chr10 (311490..312758) [1269 bp, 422 aa] {ON} Anc_8....    33   0.85 
Skud_4.374 Chr4 complement(652139..653260) [1122 bp, 373 aa] {ON...    31   2.7  
Suva_2.273 Chr2 complement(475164..476294) [1131 bp, 376 aa] {ON...    31   3.2  
YDR113C Chr4 complement(680496..681617) [1122 bp, 373 aa] {ON}  ...    31   4.3  

>TBLA0E04460 Chr5 complement(1141836..1142669) [834 bp, 277 aa] {ON}
           Anc_8.265 YDR113C
          Length = 277

 Score =  421 bits (1083), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 219/277 (79%), Positives = 219/277 (79%)

Query: 1   MNSNKENIFTAPRTPSPQLKRDSSNILKFNSTTHTNVLKSKITDVPSNASGITARRPLAS 60
           MNSNKENIFTAPRTPSPQLKRDSSNILKFNSTTHTNVLKSKITDVPSNASGITARRPLAS
Sbjct: 1   MNSNKENIFTAPRTPSPQLKRDSSNILKFNSTTHTNVLKSKITDVPSNASGITARRPLAS 60

Query: 61  KDKNVRRTALGQVXXXXXXXXXXXXXXXXXXXXXXXMLPMNRLKKYGSVLGYSNNTINSN 120
           KDKNVRRTALGQV                       MLPMNRLKKYGSVLGYSNNTINSN
Sbjct: 61  KDKNVRRTALGQVKSSISSNNSNTNSTNNNDKNKNNMLPMNRLKKYGSVLGYSNNTINSN 120

Query: 121 ASKTLILKDIAPLEKDKHIEDEIETRSYEPKELDYEPENYFGFNQEEIDGLNDYTFNFNL 180
           ASKTLILKDIAPLEKDKHIEDEIETRSYEPKELDYEPENYFGFNQEEIDGLNDYTFNFNL
Sbjct: 121 ASKTLILKDIAPLEKDKHIEDEIETRSYEPKELDYEPENYFGFNQEEIDGLNDYTFNFNL 180

Query: 181 QPXXXXXXXXXXXXXXXXXXXSLTDDTMSISSLEEIVIGTSTXXXXXXXXXXXXXXXXIH 240
           QP                   SLTDDTMSISSLEEIVIGTST                IH
Sbjct: 181 QPNNEFDNNDNDDNEADAGDDSLTDDTMSISSLEEIVIGTSTNENNHVNNKNSNMINNIH 240

Query: 241 TKQDQTQSDDELELETMITGHFDGSGLNNQDLFDLLN 277
           TKQDQTQSDDELELETMITGHFDGSGLNNQDLFDLLN
Sbjct: 241 TKQDQTQSDDELELETMITGHFDGSGLNNQDLFDLLN 277

>AGR083W Chr7 (883948..884835) [888 bp, 295 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR113C (PDS1)
          Length = 295

 Score = 50.4 bits (119), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 42/134 (31%), Positives = 57/134 (42%), Gaps = 32/134 (23%)

Query: 4   NKENIFTA-------PRTPSPQLKRDSSNILKFNSTTHTNVLKSKITDVPSNASGITARR 56
           +KEN+ T+       PRTP  QLKR SSN+   NST                      R 
Sbjct: 6   DKENLVTSAGRGAMMPRTPIHQLKRSSSNLAGRNST----------------------RM 43

Query: 57  PLASKDKNVRRTALG-QVXXXXXXXXXXXXXXXXXXXXXXXMLPMNRLKKYGSVLGYSNN 115
           PLASKD+N  +   G +                         +P ++LKKYGSVLG    
Sbjct: 44  PLASKDRNQSQGVFGLKTSGAGGAGGAQAQSKRPASSSIAKNMPDSKLKKYGSVLGVGYG 103

Query: 116 TINSNASKTLILKD 129
           ++    +K+L+LKD
Sbjct: 104 SLAK--AKSLVLKD 115

>Ecym_4305 Chr4 (649254..650189) [936 bp, 311 aa] {ON} similar to
           Ashbya gossypii AGR083W
          Length = 311

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 45/143 (31%), Positives = 59/143 (41%), Gaps = 40/143 (27%)

Query: 4   NKENIFTA--------PRTPSPQLKRDSSNI-LKFNSTTHTNVLKSKITDVPSNASGITA 54
           +KENI T         PRTP  QLKR +SN+ LK NS                       
Sbjct: 6   DKENIPTGSEPSGSIVPRTPMHQLKRSTSNVHLKNNS----------------------- 42

Query: 55  RRPLASKDKNVRRTA------LGQVXXXXXXXXXXXXXXXXXXXXXXXMLPMNRLKKYGS 108
           R PLASKD+N  ++       L Q                         +P ++LKKYGS
Sbjct: 43  RLPLASKDRNRSQSGFNLKQQLVQGHVGGGVMVGQNKSKRPASNSFVKNMPDSKLKKYGS 102

Query: 109 VLGYSNNTINSNASKTLILKDIA 131
           VLG   N  +   +K+L+LKD +
Sbjct: 103 VLGV--NYPHLTKTKSLVLKDAS 123

>KNAG0H03230 Chr8 (602896..603741) [846 bp, 281 aa] {ON} Anc_8.265
           YDR113C
          Length = 281

 Score = 39.7 bits (91), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 42/139 (30%), Positives = 56/139 (40%), Gaps = 21/139 (15%)

Query: 2   NSNKENIFTAPRTPSPQLKRDSSNILKFNSTTHTNVLKSKITDVPSNASGITARRPLASK 61
           N +KEN    P+TP+  +   S  +LK   +         +   P+       R PLASK
Sbjct: 4   NEDKENAVAVPQTPASNILDGSGVVLKPVGSRGKQSFS--VRKSPTRG----GRLPLASK 57

Query: 62  DKNVRRTALGQVXXXXXXXXXXXXXXXXXXXXXXXMLPMNRLKKYGSVLGYSNNTINSNA 121
           D N    A G V                            +LK+YGS+LGY N  +    
Sbjct: 58  DNN----ASGLVVSGKLGRQPADQVREANSS--------RKLKRYGSLLGYDNRQLTR-- 103

Query: 122 SKTLILKDI-APLEKDKHI 139
           SK+LILKD  AP E  K +
Sbjct: 104 SKSLILKDPEAPNESSKSV 122

>TDEL0F03920 Chr6 complement(729845..730813) [969 bp, 322 aa] {ON}
           Anc_8.265 YDR113C
          Length = 322

 Score = 38.9 bits (89), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 43/151 (28%), Positives = 61/151 (40%), Gaps = 26/151 (17%)

Query: 1   MNSNKENIF----------TAPRTPSPQLKRDSSNILKFNSTTHTNVLKSKITDVPSNAS 50
           +N NKEN            + P+TP+  LKR  S ++K +   + + L  +  D P   +
Sbjct: 3   INENKENDLVLNLPESGGVSFPQTPAHLLKRSQSAMMKPSGEENPSNLTYRDCDAPVKRA 62

Query: 51  GIT-----ARRPLASKDKNVRRTALGQVXXXXXXXXXXXXXXXXXXXXXXXMLPMN---- 101
             +      R PLASKD N R T                            ++       
Sbjct: 63  SPSRRVQQGRPPLASKDNN-RSTGFLPQLQKLQQQPSLKRNLSQSKKRNANVVDGQLLTN 121

Query: 102 --RLKKYGSVLGYSNNTINSNASKTLILKDI 130
             RLKKYGSVLGY  N +     K+L+LKD+
Sbjct: 122 PRRLKKYGSVLGY--NALPK--MKSLVLKDV 148

>KLLA0F19206g Chr6 complement(1780093..1780884) [792 bp, 263 aa]
           {ON} weakly similar to uniprot|P40316 Saccharomyces
           cerevisiae YDR113C PDS1 Securin that inhibits anaphase
           by binding separin Esp1p also blocks cyclin destruction
           and mitotic exit essential for cell cycle arrest in
           mitosis in the presence of DNA damage or aberrant
           mitotic spindles also present in meiotic nuclei
          Length = 263

 Score = 38.5 bits (88), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 46/162 (28%), Positives = 61/162 (37%), Gaps = 40/162 (24%)

Query: 55  RRPLASKDKNVRRTALGQVXXXXXXXXXXXXXXXXXXXXXXXMLPMNRLKKYGSVLGYSN 114
           RRPLASKD N R  ++  V                       M P N+LKKYGSVLG   
Sbjct: 39  RRPLASKDNN-RTQSILSVKNNAALGKSDHPLKRPASSFMKNM-PENKLKKYGSVLGM-- 94

Query: 115 NTINSNASKTLILKD-----------------------------------IAPLEKDKHI 139
           NT     +K+L+LKD                                   +  L ++K  
Sbjct: 95  NTFMPR-TKSLVLKDTELNEKNDDEDEEDEEDDLPIFPSGKSLNLGFGNGLKALIREKED 153

Query: 140 EDEIETRSYEPKELDYEPENYFGFNQEEIDGLNDYTFNFNLQ 181
           E  IE      KEL Y P  Y  F++E I+ L  +   F ++
Sbjct: 154 ELNIEYAPKRQKELPYIPNGYDPFDKESIEKLQHHRSPFQVE 195

>ZYRO0C01584g Chr3 (112438..113286) [849 bp, 282 aa] {ON} weakly
           similar to uniprot|P40316 Saccharomyces cerevisiae
           YDR113C PDS1 Securin that inhibits anaphase by binding
           separin Esp1p also blocks cyclin destruction and mitotic
           exit essential for cell cycle arrest in mitosis in the
           presence of DNA damage or aberrant mitotic spindles also
           present in meiotic nuclei
          Length = 282

 Score = 37.7 bits (86), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 39/123 (31%), Positives = 55/123 (44%), Gaps = 27/123 (21%)

Query: 9   FTAPRTPSPQLKRDSSNILKFNSTTHTNVLKSKITDVPSNASGITARR--PLASKDKNVR 66
              P+TP   LKR   N+LK     +T V KS+      + S +  +R  PLASKD N +
Sbjct: 23  LALPQTPIHLLKRSQPNVLK--PEENTPVKKSR------SVSPVRGQRRLPLASKDHN-K 73

Query: 67  RTALGQVXXXXXXXXXXXXXXXXXXXXXXXMLPMNRLKKYGSVLGYSNNTINSNASKTLI 126
            +A G V                            +L+KYGSVLGY++       +K+L+
Sbjct: 74  SSAAGPVKKRQPTLQGELLSNP------------RKLQKYGSVLGYTDLP----RTKSLV 117

Query: 127 LKD 129
           LKD
Sbjct: 118 LKD 120

>SAKL0H16962g Chr8 (1489800..1490810) [1011 bp, 336 aa] {ON} weakly
           similar to uniprot|P40316 Saccharomyces cerevisiae
           YDR113C PDS1 Securin that inhibits anaphase by binding
           separin Esp1p also blocks cyclin destruction and mitotic
           exit essential for cell cycle arrest in mitosis in the
           presence of DNA damage or aberrant mitotic spindles also
           present in meiotic nuclei
          Length = 336

 Score = 37.4 bits (85), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 47/152 (30%), Positives = 60/152 (39%), Gaps = 43/152 (28%)

Query: 4   NKEN-IFTA---PRTPSPQLKRDSSNILKFNSTTHTNVLKSKITDVPSNASGITARRPLA 59
           NKEN IF++   P TPS  LKR  S             +K   ++ P+  SG   R PLA
Sbjct: 6   NKENVIFSSENLPTTPSHLLKRSQS------------FMKPLASNSPTKKSG--KRLPLA 51

Query: 60  SKDKNVRRTAL--GQVXX-------------------XXXXXXXXXXXXXXXXXXXXXML 98
           SKD N   T +  GQ                                           +L
Sbjct: 52  SKDNNKSNTLINNGQKSALVNLAPNNSLLHGGKLKRNRPVVSNTGSFINTNTSKSSFPLL 111

Query: 99  PMNRLKKYGSVLGYSNNTINSNASKTLILKDI 130
           P +RLKKYGSVLGY+         K+L+LKD+
Sbjct: 112 PDSRLKKYGSVLGYNGLP----RVKSLVLKDV 139

>NDAI0J01350 Chr10 (311490..312758) [1269 bp, 422 aa] {ON} Anc_8.265
           YDR113C
          Length = 422

 Score = 32.7 bits (73), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 21/32 (65%), Gaps = 3/32 (9%)

Query: 102 RLKKYGSVLGY---SNNTINSNASKTLILKDI 130
           RLKKYGSVLG     NN  N    K+L+LKDI
Sbjct: 118 RLKKYGSVLGLGTDGNNHNNLTRIKSLVLKDI 149

>Skud_4.374 Chr4 complement(652139..653260) [1122 bp, 373 aa] {ON}
           YDR113C (REAL)
          Length = 373

 Score = 31.2 bits (69), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 34/60 (56%), Gaps = 4/60 (6%)

Query: 102 RLKKYGSVLGYSNNTINSNASKTLILKDIAPLEKDKHIEDEIETRSYEPKELDYEPENYF 161
           +L+KYGSVLGY  N +     K+L+LKD+A   K++   D+ +       +L  + +N F
Sbjct: 153 KLQKYGSVLGY--NALPK--MKSLVLKDLAGPAKNQESSDDDDGSEGPESKLGVKLQNAF 208

>Suva_2.273 Chr2 complement(475164..476294) [1131 bp, 376 aa] {ON}
           YDR113C (REAL)
          Length = 376

 Score = 31.2 bits (69), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 27/41 (65%), Gaps = 4/41 (9%)

Query: 102 RLKKYGSVLGYSNNTINSNASKTLILKDIAPLEKDKHIEDE 142
           +L+KYGSVLGY  N +     K+L+LKD+A   K++   D+
Sbjct: 153 KLQKYGSVLGY--NALPK--MKSLVLKDLADPAKNQESSDD 189

>YDR113C Chr4 complement(680496..681617) [1122 bp, 373 aa] {ON}
           PDS1Securin, inhibits anaphase by binding separin Esp1p;
           blocks cyclin destruction and mitotic exit, essential
           for meiotic progression and mitotic cell cycle arrest;
           localization is cell-cycle dependent and regulated by
           Cdc28p phosphorylation
          Length = 373

 Score = 30.8 bits (68), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 28/43 (65%), Gaps = 4/43 (9%)

Query: 102 RLKKYGSVLGYSNNTINSNASKTLILKDIAPLEKDKHIEDEIE 144
           +L+KYGSVLGY  N +     K+L+LKD+A   K++   D+ E
Sbjct: 152 KLQKYGSVLGY--NALPK--MKSLVLKDLADSGKNEESSDDDE 190

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.309    0.129    0.351 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 26,295,815
Number of extensions: 1048513
Number of successful extensions: 3335
Number of sequences better than 10.0: 30
Number of HSP's gapped: 3392
Number of HSP's successfully gapped: 34
Length of query: 277
Length of database: 53,481,399
Length adjustment: 108
Effective length of query: 169
Effective length of database: 41,097,471
Effective search space: 6945472599
Effective search space used: 6945472599
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 65 (29.6 bits)