Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0E044408.263ON56256226570.0
TDEL0F039008.263ON55948617290.0
YLR089C (ALT1)8.263ON59249217250.0
Skud_12.1578.263ON59249217240.0
Suva_10.1738.263ON59249217090.0
Smik_12.1488.263ON59249217090.0
Kpol_392.58.263ON51248416850.0
NDAI0B019908.263ON58848416710.0
ZYRO0C01628g8.263ON53448616620.0
KNAG0G020408.263ON59149616490.0
SAKL0H17006g8.263ON53148316380.0
NCAS0B050208.263ON56848416350.0
KLLA0F19162g8.263ON52848316290.0
CAGL0L12254g8.263ON57448716100.0
NCAS0B038408.263ON49748315970.0
TPHA0J007508.263ON52248315880.0
KAFR0B027308.263ON53948315840.0
KNAG0M012108.263ON52148415750.0
Skud_4.3728.263ON50748515650.0
KAFR0B055308.263ON51448515620.0
KLTH0G13662g8.263ON51947615550.0
Smik_4.3578.263ON50748415460.0
YDR111C (ALT2)8.263ON50748415420.0
Kwal_56.237918.263ON51847715260.0
Suva_2.2718.263ON50748515190.0
Kpol_543.398.263ON49248615110.0
Ecym_43078.263ON53449515110.0
TPHA0A018008.263ON49848015000.0
NDAI0J013608.263ON50148514980.0
KAFR0B05520singletonON51048514950.0
AGR085W8.263ON52149414350.0
TBLA0G01630singletonON50049214280.0
TBLA0F030608.263ON50049914230.0
Kwal_34.160181.472ON3791681312e-07
TPHA0O014501.321ON443731117e-05
Suva_6.1361.321ON4441941053e-04
Kwal_14.25741.321ON443601045e-04
KLLA0F01617g1.321ON444791036e-04
YJL060W (BNA3)1.321ON4441941020.001
ZYRO0G20636g1.321ON4532601020.001
SAKL0D11528g1.472ON3831541000.001
KNAG0B053201.321ON433168980.003
TDEL0A016008.204ON475362980.003
Kpol_1035.231.321ON444378970.003
TDEL0D019001.321ON443416960.004
KAFR0A017101.321ON43564960.005
CAGL0J05126g1.321ON433376950.005
NDAI0B045502.102ON565170960.005
KLLA0F10021g3.511ON497122950.005
Skud_10.1561.321ON46085950.005
KAFR0B023808.204ON443353940.008
SAKL0D06886g1.321ON447144940.008
KLTH0G19646g1.472ON379162940.008
Smik_10.1801.321ON44473930.011
KLLA0F03509g2.252ON387169920.012
KLTH0H10648g1.321ON44374910.020
Kwal_33.145822.102ON525194890.035
AFR548C3.511ON497155870.058
KLTH0G02002g3.511ON496244870.063
CAGL0G01254g3.511ON50448860.066
SAKL0F02156g3.511ON498129860.067
YGL202W (ARO8)3.511ON500129860.074
Smik_5.3198.204ON44347850.090
KAFR0D014203.511ON492160850.096
ZYRO0B11088g8.204ON450199850.096
AEL170C1.321ON458263850.099
TPHA0F012602.252ON392182850.099
TBLA0B093302.420ON408200840.11
Ecym_62921.321ON430222840.11
KNAG0B006603.511ON496122840.12
Ecym_6319singletonON35469840.12
Kpol_1039.222.252ON386168840.12
NCAS0A092001.321ON44575840.13
YER152C8.204ON44393830.14
KNAG0G016808.204ON45234830.17
ADL249W2.252ON387208820.19
Kwal_47.189823.511ON496244820.21
NDAI0G057601.321ON448260820.23
NDAI0I028303.511ON500129820.24
TPHA0O015202.102ON50350820.25
Kpol_278.23.511ON498123820.25
TPHA0D033703.511ON497129810.31
Kpol_480.11.472ON380331800.34
Skud_5.2908.204ON44347790.47
NCAS0G040501.472ON384166790.49
Smik_7.693.511ON500129790.54
NCAS0A038308.204ON446208790.54
NCAS0B072202.102ON51050780.66
NCAS0E006703.511ON497154780.70
KLLA0A04906gna 1ON480124770.78
KNAG0E018502.252ON384124770.80
KLTH0D05478g2.475ON421164770.88
Kpol_1032.398.204ON453188770.90
TBLA0B009902.102ON54650770.96
Ecym_32902.252ON386167761.00
Suva_5.2818.204ON45033761.1
SAKL0E08492g2.252ON384171761.1
ZYRO0A01672g2.252ON386125761.2
Kwal_47.17462na 1ON492128751.4
KLTH0G09614g2.252ON389168751.5
SAKL0H21824gna 1ON499155751.6
SAKL0E12188g2.102ON53051742.1
Suva_7.613.511ON500129742.2
TDEL0D057903.511ON49758742.2
CAGL0L09889g2.669ON71729732.6
TBLA0I011802.475ON443292732.8
Kwal_26.77682.475ON422119732.9
NDAI0B037302.252ON386125723.0
ZYRO0G05346g2.102ON50450733.0
CAGL0G06028g2.102ON537189723.4
KNAG0G005501.472ON38753714.0
Skud_7.693.511ON50058724.0
Kwal_23.48882.252ON389112714.3
KLTH0G19624gsingletonON46852715.2
YIL116W (HIS5)2.252ON385126697.6
Skud_8.1982.102ON517170698.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0E04440
         (562 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0E04440 Chr5 complement(1138820..1140508) [1689 bp, 562 aa] ...  1028   0.0  
TDEL0F03900 Chr6 complement(726159..727838) [1680 bp, 559 aa] {O...   670   0.0  
YLR089C Chr12 complement(318237..320015) [1779 bp, 592 aa] {ON} ...   669   0.0  
Skud_12.157 Chr12 complement(301427..303205) [1779 bp, 592 aa] {...   668   0.0  
Suva_10.173 Chr10 complement(323066..324844) [1779 bp, 592 aa] {...   662   0.0  
Smik_12.148 Chr12 complement(298127..299905) [1779 bp, 592 aa] {...   662   0.0  
Kpol_392.5 s392 (6873..8411) [1539 bp, 512 aa] {ON} (6873..8411)...   653   0.0  
NDAI0B01990 Chr2 complement(493160..494926) [1767 bp, 588 aa] {O...   648   0.0  
ZYRO0C01628g Chr3 (115665..117269) [1605 bp, 534 aa] {ON} simila...   644   0.0  
KNAG0G02040 Chr7 complement(463058..464833) [1776 bp, 591 aa] {O...   639   0.0  
SAKL0H17006g Chr8 (1493272..1494867) [1596 bp, 531 aa] {ON} high...   635   0.0  
NCAS0B05020 Chr2 complement(931456..933162) [1707 bp, 568 aa] {O...   634   0.0  
KLLA0F19162g Chr6 complement(1775240..1776826) [1587 bp, 528 aa]...   632   0.0  
CAGL0L12254g Chr12 complement(1327111..1328835) [1725 bp, 574 aa...   624   0.0  
NCAS0B03840 Chr2 (683781..685274) [1494 bp, 497 aa] {ON} Anc_8.2...   619   0.0  
TPHA0J00750 Chr10 complement(176561..178129) [1569 bp, 522 aa] {...   616   0.0  
KAFR0B02730 Chr2 complement(558858..560477) [1620 bp, 539 aa] {O...   614   0.0  
KNAG0M01210 Chr13 (220612..222177) [1566 bp, 521 aa] {ON} Anc_8....   611   0.0  
Skud_4.372 Chr4 complement(649872..651395) [1524 bp, 507 aa] {ON...   607   0.0  
KAFR0B05530 Chr2 (1132895..1134439) [1545 bp, 514 aa] {ON}            606   0.0  
KLTH0G13662g Chr7 (1169989..1171548) [1560 bp, 519 aa] {ON} simi...   603   0.0  
Smik_4.357 Chr4 complement(639561..641084) [1524 bp, 507 aa] {ON...   600   0.0  
YDR111C Chr4 complement(678241..679764) [1524 bp, 507 aa] {ON}  ...   598   0.0  
Kwal_56.23791 s56 (706946..708502) [1557 bp, 518 aa] {ON} YLR089...   592   0.0  
Suva_2.271 Chr2 complement(472714..474237) [1524 bp, 507 aa] {ON...   589   0.0  
Kpol_543.39 s543 complement(86358..87836) [1479 bp, 492 aa] {ON}...   586   0.0  
Ecym_4307 Chr4 (652209..653813) [1605 bp, 534 aa] {ON} similar t...   586   0.0  
TPHA0A01800 Chr1 (364262..365758) [1497 bp, 498 aa] {ON} Anc_8.2...   582   0.0  
NDAI0J01360 Chr10 (313791..315296) [1506 bp, 501 aa] {ON} Anc_8....   581   0.0  
KAFR0B05520 Chr2 (1130297..1131829) [1533 bp, 510 aa] {ON} Anc_8...   580   0.0  
AGR085W Chr7 (887023..888588) [1566 bp, 521 aa] {ON} Syntenic ho...   557   0.0  
TBLA0G01630 Chr7 (428016..429518) [1503 bp, 500 aa] {ON}              554   0.0  
TBLA0F03060 Chr6 (743646..745148) [1503 bp, 500 aa] {ON} Anc_8.2...   552   0.0  
Kwal_34.16018 s34 (159210..160349) [1140 bp, 379 aa] {ON} YJL060...    55   2e-07
TPHA0O01450 Chr15 complement(291591..292922) [1332 bp, 443 aa] {...    47   7e-05
Suva_6.136 Chr6 complement(227366..228700) [1335 bp, 444 aa] {ON...    45   3e-04
Kwal_14.2574 s14 complement(818144..819475) [1332 bp, 443 aa] {O...    45   5e-04
KLLA0F01617g Chr6 complement(154025..155359) [1335 bp, 444 aa] {...    44   6e-04
YJL060W Chr10 (323386..324720) [1335 bp, 444 aa] {ON}  BNA3Kynur...    44   0.001
ZYRO0G20636g Chr7 complement(1700506..1701867) [1362 bp, 453 aa]...    44   0.001
SAKL0D11528g Chr4 complement(960867..962018) [1152 bp, 383 aa] {...    43   0.001
KNAG0B05320 Chr2 (1028845..1030146) [1302 bp, 433 aa] {ON} Anc_1...    42   0.003
TDEL0A01600 Chr1 (289263..290690) [1428 bp, 475 aa] {ON} Anc_8.2...    42   0.003
Kpol_1035.23 s1035 complement(56123..57457) [1335 bp, 444 aa] {O...    42   0.003
TDEL0D01900 Chr4 (369434..370765) [1332 bp, 443 aa] {ON} Anc_1.3...    42   0.004
KAFR0A01710 Chr1 complement(348198..349505) [1308 bp, 435 aa] {O...    42   0.005
CAGL0J05126g Chr10 complement(487452..488753) [1302 bp, 433 aa] ...    41   0.005
NDAI0B04550 Chr2 (1132653..1134350) [1698 bp, 565 aa] {ON} Anc_2...    42   0.005
KLLA0F10021g Chr6 (926569..928062) [1494 bp, 497 aa] {ON} simila...    41   0.005
Skud_10.156 Chr10 complement(294149..295531) [1383 bp, 460 aa] {...    41   0.005
KAFR0B02380 Chr2 complement(463678..465009) [1332 bp, 443 aa] {O...    41   0.008
SAKL0D06886g Chr4 complement(571478..572821) [1344 bp, 447 aa] {...    41   0.008
KLTH0G19646g Chr7 complement(1699421..1700560) [1140 bp, 379 aa]...    41   0.008
Smik_10.180 Chr10 (315030..316364) [1335 bp, 444 aa] {ON} YJL060...    40   0.011
KLLA0F03509g Chr6 (327598..328761) [1164 bp, 387 aa] {ON} simila...    40   0.012
KLTH0H10648g Chr8 complement(919601..920932) [1332 bp, 443 aa] {...    40   0.020
Kwal_33.14582 s33 complement(728649..730226) [1578 bp, 525 aa] {...    39   0.035
AFR548C Chr6 complement(1422283..1423776) [1494 bp, 497 aa] {ON}...    38   0.058
KLTH0G02002g Chr7 (155219..156709) [1491 bp, 496 aa] {ON} highly...    38   0.063
CAGL0G01254g Chr7 (119281..120795) [1515 bp, 504 aa] {ON} highly...    38   0.066
SAKL0F02156g Chr6 (185574..187070) [1497 bp, 498 aa] {ON} highly...    38   0.067
YGL202W Chr7 (116059..117561) [1503 bp, 500 aa] {ON}  ARO8Aromat...    38   0.074
Smik_5.319 Chr5 complement(477840..479171) [1332 bp, 443 aa] {ON...    37   0.090
KAFR0D01420 Chr4 (284515..285993) [1479 bp, 492 aa] {ON} Anc_3.5...    37   0.096
ZYRO0B11088g Chr2 complement(872804..874156) [1353 bp, 450 aa] {...    37   0.096
AEL170C Chr5 complement(318032..319408) [1377 bp, 458 aa] {ON} S...    37   0.099
TPHA0F01260 Chr6 complement(290133..291311) [1179 bp, 392 aa] {O...    37   0.099
TBLA0B09330 Chr2 (2216165..2217391) [1227 bp, 408 aa] {ON} Anc_2...    37   0.11 
Ecym_6292 Chr6 (547563..548855) [1293 bp, 430 aa] {ON} similar t...    37   0.11 
KNAG0B00660 Chr2 (115417..116907) [1491 bp, 496 aa] {ON} Anc_3.5...    37   0.12 
Ecym_6319 Chr6 complement(607599..608663) [1065 bp, 354 aa] {ON}...    37   0.12 
Kpol_1039.22 s1039 (68736..69896) [1161 bp, 386 aa] {ON} (68736....    37   0.12 
NCAS0A09200 Chr1 complement(1819134..1820471) [1338 bp, 445 aa] ...    37   0.13 
YER152C Chr5 complement(472657..473988) [1332 bp, 443 aa] {ON} P...    37   0.14 
KNAG0G01680 Chr7 complement(369892..371250) [1359 bp, 452 aa] {O...    37   0.17 
ADL249W Chr4 (261227..262390) [1164 bp, 387 aa] {ON} Syntenic ho...    36   0.19 
Kwal_47.18982 s47 complement(1051414..1052904) [1491 bp, 496 aa]...    36   0.21 
NDAI0G05760 Chr7 (1427844..1429190) [1347 bp, 448 aa] {ON} Anc_1...    36   0.23 
NDAI0I02830 Chr9 complement(669885..671387) [1503 bp, 500 aa] {O...    36   0.24 
TPHA0O01520 Chr15 (304547..306058) [1512 bp, 503 aa] {ON} Anc_2....    36   0.25 
Kpol_278.2 s278 (2488..3984) [1497 bp, 498 aa] {ON} (2488..3984)...    36   0.25 
TPHA0D03370 Chr4 complement(704980..706473) [1494 bp, 497 aa] {O...    36   0.31 
Kpol_480.1 s480 (215..1357) [1143 bp, 380 aa] {ON} (215..1357) [...    35   0.34 
Skud_5.290 Chr5 complement(463643..464974) [1332 bp, 443 aa] {ON...    35   0.47 
NCAS0G04050 Chr7 complement(753216..754370) [1155 bp, 384 aa] {O...    35   0.49 
Smik_7.69 Chr7 (111132..112634) [1503 bp, 500 aa] {ON} YGL202W (...    35   0.54 
NCAS0A03830 Chr1 (778327..779667) [1341 bp, 446 aa] {ON} Anc_8.204     35   0.54 
NCAS0B07220 Chr2 (1366278..1367810) [1533 bp, 510 aa] {ON} Anc_2...    35   0.66 
NCAS0E00670 Chr5 (117006..118499) [1494 bp, 497 aa] {ON} Anc_3.511     35   0.70 
KLLA0A04906g Chr1 (437523..438965) [1443 bp, 480 aa] {ON} simila...    34   0.78 
KNAG0E01850 Chr5 (381827..382981) [1155 bp, 384 aa] {ON} Anc_2.2...    34   0.80 
KLTH0D05478g Chr4 (488881..490146) [1266 bp, 421 aa] {ON} simila...    34   0.88 
Kpol_1032.39 s1032 complement(90576..91937) [1362 bp, 453 aa] {O...    34   0.90 
TBLA0B00990 Chr2 complement(221196..222836) [1641 bp, 546 aa] {O...    34   0.96 
Ecym_3290 Chr3 (546773..547933) [1161 bp, 386 aa] {ON} similar t...    34   1.00 
Suva_5.281 Chr5 complement(444090..445442) [1353 bp, 450 aa] {ON...    34   1.1  
SAKL0E08492g Chr5 complement(692049..693203) [1155 bp, 384 aa] {...    34   1.1  
ZYRO0A01672g Chr1 (136284..137444) [1161 bp, 386 aa] {ON} highly...    34   1.2  
Kwal_47.17462 s47 (413555..415033) [1479 bp, 492 aa] {ON} YGL202...    33   1.4  
KLTH0G09614g Chr7 (804939..806108) [1170 bp, 389 aa] {ON} simila...    33   1.5  
SAKL0H21824g Chr8 (1903887..1905386) [1500 bp, 499 aa] {ON} simi...    33   1.6  
SAKL0E12188g Chr5 (1010503..1012095) [1593 bp, 530 aa] {ON} simi...    33   2.1  
Suva_7.61 Chr7 (112022..113524) [1503 bp, 500 aa] {ON} YGL202W (...    33   2.2  
TDEL0D05790 Chr4 complement(1045218..1046711) [1494 bp, 497 aa] ...    33   2.2  
CAGL0L09889g Chr12 (1057762..1059915) [2154 bp, 717 aa] {ON} sim...    33   2.6  
TBLA0I01180 Chr9 complement(252457..253788) [1332 bp, 443 aa] {O...    33   2.8  
Kwal_26.7768 s26 (502609..503877) [1269 bp, 422 aa] {ON} YKL106W...    33   2.9  
NDAI0B03730 Chr2 complement(935131..936291) [1161 bp, 386 aa] {O...    32   3.0  
ZYRO0G05346g Chr7 complement(430373..431887) [1515 bp, 504 aa] {...    33   3.0  
CAGL0G06028g Chr7 complement(579261..580874) [1614 bp, 537 aa] {...    32   3.4  
KNAG0G00550 Chr7 (96823..97986) [1164 bp, 387 aa] {ON} Anc_1.472       32   4.0  
Skud_7.69 Chr7 (120729..122231) [1503 bp, 500 aa] {ON} YGL202W (...    32   4.0  
Kwal_23.4888 s23 (907745..908914) [1170 bp, 389 aa] {ON} YIL116W...    32   4.3  
KLTH0G19624g Chr7 complement(1697587..1698993) [1407 bp, 468 aa]...    32   5.2  
YIL116W Chr9 (142928..144085) [1158 bp, 385 aa] {ON}  HIS5Histid...    31   7.6  
Skud_8.198 Chr8 (349159..350712) [1554 bp, 517 aa] {ON} YHR137W ...    31   8.6  

>TBLA0E04440 Chr5 complement(1138820..1140508) [1689 bp, 562 aa]
           {ON} Anc_8.263 YDR111C
          Length = 562

 Score = 1028 bits (2657), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 502/562 (89%), Positives = 502/562 (89%)

Query: 1   MIKTCNRHSSHSLRGMXXXXXXXXXXXXXXXXXXXXXXXYIPPPXXXXXXXXXXXXXXXX 60
           MIKTCNRHSSHSLRGM                       YIPPP                
Sbjct: 1   MIKTCNRHSSHSLRGMSQTTLFKSPSSSSLFRSTSSSSLYIPPPTALVRSISSSSILSNS 60

Query: 61  XXXXXXXPLSYSTSREKSYFAERLEPEDLNPNVVKAKYAVRGAIPSYADKLKIQLLKHPG 120
                  PLSYSTSREKSYFAERLEPEDLNPNVVKAKYAVRGAIPSYADKLKIQLLKHPG
Sbjct: 61  SNASVTSPLSYSTSREKSYFAERLEPEDLNPNVVKAKYAVRGAIPSYADKLKIQLLKHPG 120

Query: 121 TLPFESVINSNIGNPQQLGQKPLSFGRQVLSILEYPALLDHERTLVDSMGYAPDSIERAK 180
           TLPFESVINSNIGNPQQLGQKPLSFGRQVLSILEYPALLDHERTLVDSMGYAPDSIERAK
Sbjct: 121 TLPFESVINSNIGNPQQLGQKPLSFGRQVLSILEYPALLDHERTLVDSMGYAPDSIERAK 180

Query: 181 TLLTDIGSIGAYSNSQGVHGIRQTVADFITNRDDGEVAYPDDIFLTAGASSAVSTILSIL 240
           TLLTDIGSIGAYSNSQGVHGIRQTVADFITNRDDGEVAYPDDIFLTAGASSAVSTILSIL
Sbjct: 181 TLLTDIGSIGAYSNSQGVHGIRQTVADFITNRDDGEVAYPDDIFLTAGASSAVSTILSIL 240

Query: 241 CKGQQTGVLIPIPQYPXXXXXXXXXXXXXXPYYLDESNGWSTDINEISKVAQDSLEAGIK 300
           CKGQQTGVLIPIPQYP              PYYLDESNGWSTDINEISKVAQDSLEAGIK
Sbjct: 241 CKGQQTGVLIPIPQYPLYTATLTLNDATALPYYLDESNGWSTDINEISKVAQDSLEAGIK 300

Query: 301 PTCLVVINPGNPTGSVLTVEAIKNVFDVAAKYGLVVIADEVYQDNIFPGSEFHSMKKILR 360
           PTCLVVINPGNPTGSVLTVEAIKNVFDVAAKYGLVVIADEVYQDNIFPGSEFHSMKKILR
Sbjct: 301 PTCLVVINPGNPTGSVLTVEAIKNVFDVAAKYGLVVIADEVYQDNIFPGSEFHSMKKILR 360

Query: 361 ILQKEVPNKYDNIQLASLHSCSKGLLGECGHRGGYCEFIGFTPEVKQVITKLSSISLCSS 420
           ILQKEVPNKYDNIQLASLHSCSKGLLGECGHRGGYCEFIGFTPEVKQVITKLSSISLCSS
Sbjct: 361 ILQKEVPNKYDNIQLASLHSCSKGLLGECGHRGGYCEFIGFTPEVKQVITKLSSISLCSS 420

Query: 421 VIGQALVDLMCCPPKKGEPSYELDQHERQTIRTNHKKRSNKLYEMFNSLEGVTCQKPQGA 480
           VIGQALVDLMCCPPKKGEPSYELDQHERQTIRTNHKKRSNKLYEMFNSLEGVTCQKPQGA
Sbjct: 421 VIGQALVDLMCCPPKKGEPSYELDQHERQTIRTNHKKRSNKLYEMFNSLEGVTCQKPQGA 480

Query: 481 MYMFPNIQLPFNAIKMAQNLDITPDEFYCRELLKATGICTVPGSGFGQQPGTYHVRTTFL 540
           MYMFPNIQLPFNAIKMAQNLDITPDEFYCRELLKATGICTVPGSGFGQQPGTYHVRTTFL
Sbjct: 481 MYMFPNIQLPFNAIKMAQNLDITPDEFYCRELLKATGICTVPGSGFGQQPGTYHVRTTFL 540

Query: 541 APGVEWMKRWEKFHIEFFEKYR 562
           APGVEWMKRWEKFHIEFFEKYR
Sbjct: 541 APGVEWMKRWEKFHIEFFEKYR 562

>TDEL0F03900 Chr6 complement(726159..727838) [1680 bp, 559 aa] {ON}
           Anc_8.263 YDR111C
          Length = 559

 Score =  670 bits (1729), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/486 (65%), Positives = 389/486 (80%), Gaps = 2/486 (0%)

Query: 79  YFAERLEPEDLNPNVVKAKYAVRGAIPSYADKLKIQLLKHPGTLPFESVINSNIGNPQQL 138
           Y AE L   DLN NV+KAKYAVRG+IP  A++L+ QL + P +LPF+ ++N+NIGNPQQL
Sbjct: 73  YPAESLTVRDLNENVLKAKYAVRGSIPMRAEELQEQLKRDPSSLPFDKIVNANIGNPQQL 132

Query: 139 GQKPLSFGRQVLSILEYPALLDH-ERTLVDSMGYAPDSIERAKTLLTDIG-SIGAYSNSQ 196
            QKPLSF RQVLSIL+YP +L+  E  L+    +  D+IERAK +L D+G S+GAYS+SQ
Sbjct: 133 NQKPLSFYRQVLSILQYPEVLEQGEEELISKGVFKRDAIERAKRILRDVGGSVGAYSSSQ 192

Query: 197 GVHGIRQTVADFITNRDDGEVAYPDDIFLTAGASSAVSTILSILCKGQQTGVLIPIPQYP 256
           GV+GIR+TVADFIT RD GE AYP+DIFLTAGAS+AVS +LSILC+GQ+TGVLIPIPQYP
Sbjct: 193 GVYGIRKTVADFITERDSGEPAYPEDIFLTAGASAAVSYLLSILCRGQETGVLIPIPQYP 252

Query: 257 XXXXXXXXXXXXXXPYYLDESNGWSTDINEISKVAQDSLEAGIKPTCLVVINPGNPTGSV 316
                         PYYLDE +GWST+  EI  V  +S+E+GI+P+ LVVINPGNPTGSV
Sbjct: 253 LYTATLALNNSHVLPYYLDEESGWSTNTAEIEGVVTESIESGIRPSVLVVINPGNPTGSV 312

Query: 317 LTVEAIKNVFDVAAKYGLVVIADEVYQDNIFPGSEFHSMKKILRILQKEVPNKYDNIQLA 376
           L+VEAI+ +F VAAKYG+VVIADEVYQ+NIF GSEFHSMKK+LR LQKE P  YDN+QL 
Sbjct: 313 LSVEAIEKIFQVAAKYGIVVIADEVYQENIFAGSEFHSMKKVLRQLQKEHPGIYDNVQLV 372

Query: 377 SLHSCSKGLLGECGHRGGYCEFIGFTPEVKQVITKLSSISLCSSVIGQALVDLMCCPPKK 436
           SLHS SKG+ GECG RGGY E  GFT E++QV+ KL+SISLC  V GQALVDLM CPPK 
Sbjct: 373 SLHSTSKGVSGECGQRGGYMELTGFTHEIRQVVLKLASISLCPVVTGQALVDLMVCPPKP 432

Query: 437 GEPSYELDQHERQTIRTNHKKRSNKLYEMFNSLEGVTCQKPQGAMYMFPNIQLPFNAIKM 496
           G+ SYE D+ ER+ I      R+  L++ FNSLEG+ CQKP+GAMY+FP I+LP+ AI+ 
Sbjct: 433 GDESYEQDRKEREMIHEELDHRAGLLHDTFNSLEGIECQKPRGAMYLFPQIKLPYKAIQA 492

Query: 497 AQNLDITPDEFYCRELLKATGICTVPGSGFGQQPGTYHVRTTFLAPGVEWMKRWEKFHIE 556
           AQ+L+ TPDEFYC++LL+ATGICTVPGSGFGQ+PGTYH+RTTFLAPG EW+K+WE FH +
Sbjct: 493 AQHLEKTPDEFYCQKLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIKKWEDFHKK 552

Query: 557 FFEKYR 562
           F+++YR
Sbjct: 553 FYDQYR 558

>YLR089C Chr12 complement(318237..320015) [1779 bp, 592 aa] {ON}
           ALT1Alanine transaminase (glutamic pyruvic
           transaminase); involved in alanine biosynthetic and
           catabolic processes; the authentic, non-tagged protein
           is detected in highly purified mitochondria in
           high-throughput studies
          Length = 592

 Score =  669 bits (1725), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/492 (64%), Positives = 399/492 (81%), Gaps = 2/492 (0%)

Query: 73  TSREKSYFAERLEPEDLNPNVVKAKYAVRGAIPSYADKLKIQLLKHPGTLPFESVINSNI 132
           TS  + Y AE+L  ED+N NV+KAKYAVRGAIP  A++LK QL K P +LPF+ +IN+NI
Sbjct: 100 TSNNEFYPAEQLTLEDVNENVLKAKYAVRGAIPMRAEELKAQLEKDPQSLPFDRIINANI 159

Query: 133 GNPQQLGQKPLSFGRQVLSILEYPALLD-HERTLVDSMGYAPDSIERAKTLLTDIG-SIG 190
           GNPQQL QKPL++ RQVLS+L+YP LL+ +E+ LVDS  +  D+I+RAK+L+ DIG S+G
Sbjct: 160 GNPQQLQQKPLTYYRQVLSLLQYPELLNQNEQQLVDSKLFKLDAIKRAKSLMEDIGGSVG 219

Query: 191 AYSNSQGVHGIRQTVADFITNRDDGEVAYPDDIFLTAGASSAVSTILSILCKGQQTGVLI 250
           AYS+SQGV GIR++VA+FIT RD+GE++YP+DIFLTAGAS+AV+ +LSI C+G +TGVLI
Sbjct: 220 AYSSSQGVEGIRKSVAEFITKRDEGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLI 279

Query: 251 PIPQYPXXXXXXXXXXXXXXPYYLDESNGWSTDINEISKVAQDSLEAGIKPTCLVVINPG 310
           PIPQYP              PYYLDE++GWST+  EI  V +++++  IKPT LVVINPG
Sbjct: 280 PIPQYPLYTATLALNNSQALPYYLDENSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPG 339

Query: 311 NPTGSVLTVEAIKNVFDVAAKYGLVVIADEVYQDNIFPGSEFHSMKKILRILQKEVPNKY 370
           NPTG+VL+ E+I  +F+VAAKYG VVIADEVYQ+NIFPG++FHSMKKILR LQ+E P K+
Sbjct: 340 NPTGAVLSPESIAQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKKILRHLQREHPGKF 399

Query: 371 DNIQLASLHSCSKGLLGECGHRGGYCEFIGFTPEVKQVITKLSSISLCSSVIGQALVDLM 430
           DN+QLASLHS SKG+ GECG RGGY E  GF+ E++QVI KL+SISLC  V GQALVDLM
Sbjct: 400 DNVQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLM 459

Query: 431 CCPPKKGEPSYELDQHERQTIRTNHKKRSNKLYEMFNSLEGVTCQKPQGAMYMFPNIQLP 490
             PP +GE S+E DQ ER +I      R+  LYE FNSLEG+ CQKPQGAMY+FP I LP
Sbjct: 460 VRPPVEGEESFESDQAERNSIHEKLITRAMTLYETFNSLEGIECQKPQGAMYLFPKIDLP 519

Query: 491 FNAIKMAQNLDITPDEFYCRELLKATGICTVPGSGFGQQPGTYHVRTTFLAPGVEWMKRW 550
           F A++ A++L++TPDEFYC++LL++TGICTVPGSGFGQ+PGTYH+RTTFLAPG+EW+K+W
Sbjct: 520 FKAVQEARHLELTPDEFYCKKLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWIKKW 579

Query: 551 EKFHIEFFEKYR 562
           E FH EFF++YR
Sbjct: 580 ESFHKEFFDQYR 591

>Skud_12.157 Chr12 complement(301427..303205) [1779 bp, 592 aa] {ON}
           YLR089C (REAL)
          Length = 592

 Score =  668 bits (1724), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/492 (64%), Positives = 397/492 (80%), Gaps = 2/492 (0%)

Query: 73  TSREKSYFAERLEPEDLNPNVVKAKYAVRGAIPSYADKLKIQLLKHPGTLPFESVINSNI 132
           T  +  Y AE+L  ED+N NV+KAKYAVRGAIP  A++LK QL K P +LPF+ +IN+NI
Sbjct: 100 TGNDDFYPAEQLTLEDVNENVLKAKYAVRGAIPMRAEELKAQLEKDPQSLPFDKIINANI 159

Query: 133 GNPQQLGQKPLSFGRQVLSILEYPALLD-HERTLVDSMGYAPDSIERAKTLLTDIG-SIG 190
           GNPQQL QKPL++ RQVLS+L+YP LL+ +E+ LVDS  +  D+I+RAK+L+ DIG S+G
Sbjct: 160 GNPQQLQQKPLTYYRQVLSLLQYPELLNQNEQQLVDSKLFKLDAIKRAKSLMEDIGGSVG 219

Query: 191 AYSNSQGVHGIRQTVADFITNRDDGEVAYPDDIFLTAGASSAVSTILSILCKGQQTGVLI 250
           AYS+SQGV GIR++VA+FIT RDDGE++YP+DIFLTAGAS+AV+ +LSI C+G +TGVLI
Sbjct: 220 AYSSSQGVEGIRKSVAEFITKRDDGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLI 279

Query: 251 PIPQYPXXXXXXXXXXXXXXPYYLDESNGWSTDINEISKVAQDSLEAGIKPTCLVVINPG 310
           PIPQYP              PYYLDE +GWST+  EI  V +++++  IKPT LVVINPG
Sbjct: 280 PIPQYPLYTATLALNNSQALPYYLDEQSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPG 339

Query: 311 NPTGSVLTVEAIKNVFDVAAKYGLVVIADEVYQDNIFPGSEFHSMKKILRILQKEVPNKY 370
           NPTG+VL+ E++  +F+VAAKYG VVIADEVYQ+NIFPG++FHSMKKILR LQ+E P K+
Sbjct: 340 NPTGAVLSPESVSQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKKILRTLQREHPGKF 399

Query: 371 DNIQLASLHSCSKGLLGECGHRGGYCEFIGFTPEVKQVITKLSSISLCSSVIGQALVDLM 430
           DN+QLASLHS SKG+ GECG RGGY E  GF+ E++QVI KL+SISLC  V GQALVDLM
Sbjct: 400 DNVQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLM 459

Query: 431 CCPPKKGEPSYELDQHERQTIRTNHKKRSNKLYEMFNSLEGVTCQKPQGAMYMFPNIQLP 490
             PP +GE S+ELDQ ER +I      R+  LY+ FNSLEG+ CQKPQGAMY+FP I LP
Sbjct: 460 VRPPVEGEESFELDQAERNSIHEKLITRAMTLYDTFNSLEGIECQKPQGAMYLFPKIDLP 519

Query: 491 FNAIKMAQNLDITPDEFYCRELLKATGICTVPGSGFGQQPGTYHVRTTFLAPGVEWMKRW 550
           F A++ A++L++TPDEFYC+ LL++TGICTVPGSGFGQ+PGTYH+RTTFLAPG+EW+K+W
Sbjct: 520 FKAVQEARHLELTPDEFYCKSLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWIKKW 579

Query: 551 EKFHIEFFEKYR 562
           E FH EFF++YR
Sbjct: 580 ETFHKEFFDQYR 591

>Suva_10.173 Chr10 complement(323066..324844) [1779 bp, 592 aa] {ON}
           YDR111C (REAL)
          Length = 592

 Score =  662 bits (1709), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/492 (64%), Positives = 394/492 (80%), Gaps = 2/492 (0%)

Query: 73  TSREKSYFAERLEPEDLNPNVVKAKYAVRGAIPSYADKLKIQLLKHPGTLPFESVINSNI 132
           T+  + Y AE+L  +D+N NV+KA+YAVRGAIP  A++LK QL K P +LPF  +IN+NI
Sbjct: 100 TANNEFYPAEQLTLDDVNENVLKARYAVRGAIPMRAEELKAQLEKDPQSLPFNKIINANI 159

Query: 133 GNPQQLGQKPLSFGRQVLSILEYPALLDH-ERTLVDSMGYAPDSIERAKTLLTDIG-SIG 190
           GNPQQL QKPL++ RQVLS+L+YP LL+H E+ LV S  +  D+I+RAK+L+ DIG S+G
Sbjct: 160 GNPQQLQQKPLTYYRQVLSLLQYPELLNHNEQELVGSKLFKIDAIKRAKSLIKDIGGSVG 219

Query: 191 AYSNSQGVHGIRQTVADFITNRDDGEVAYPDDIFLTAGASSAVSTILSILCKGQQTGVLI 250
           AYS+SQGV GIR++VADFIT RD GE AYP+DIFLTAGAS+AV+ +LSI C+G +TGVLI
Sbjct: 220 AYSSSQGVEGIRKSVADFITKRDGGETAYPEDIFLTAGASAAVTYLLSIFCRGPETGVLI 279

Query: 251 PIPQYPXXXXXXXXXXXXXXPYYLDESNGWSTDINEISKVAQDSLEAGIKPTCLVVINPG 310
           PIPQYP              PYYLDE++GWST+  EI  V +++++  IKPT LVVINPG
Sbjct: 280 PIPQYPLYTATLALNNSQPLPYYLDENSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPG 339

Query: 311 NPTGSVLTVEAIKNVFDVAAKYGLVVIADEVYQDNIFPGSEFHSMKKILRILQKEVPNKY 370
           NPTG+VL+ E+I  +F+VAAKYG VVIADEVYQ+NIFPG+EF+SMKK+LR LQ++ P K+
Sbjct: 340 NPTGAVLSPESIAQIFEVAAKYGTVVIADEVYQENIFPGTEFNSMKKVLRHLQRDHPGKF 399

Query: 371 DNIQLASLHSCSKGLLGECGHRGGYCEFIGFTPEVKQVITKLSSISLCSSVIGQALVDLM 430
           DN+QLASLHS SKG+ GECG RGGY E  GF+ E++QVI KL+SISLC  V GQALVDLM
Sbjct: 400 DNVQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLM 459

Query: 431 CCPPKKGEPSYELDQHERQTIRTNHKKRSNKLYEMFNSLEGVTCQKPQGAMYMFPNIQLP 490
             PP +GE S+E DQ ER +I      R+  LYE FNSLEG+ CQKPQGAMY+FP I +P
Sbjct: 460 VRPPVEGEESFESDQSERNSIHEKLNTRAMTLYETFNSLEGIECQKPQGAMYLFPKIDVP 519

Query: 491 FNAIKMAQNLDITPDEFYCRELLKATGICTVPGSGFGQQPGTYHVRTTFLAPGVEWMKRW 550
           F AI+ A +L++TPDEFYC++LL++TGICTVPGSGFGQ+PGTYH+RTTFLAPGVEWMK+W
Sbjct: 520 FKAIQEAHHLELTPDEFYCKKLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGVEWMKKW 579

Query: 551 EKFHIEFFEKYR 562
           E FH EFF++YR
Sbjct: 580 EIFHKEFFDQYR 591

>Smik_12.148 Chr12 complement(298127..299905) [1779 bp, 592 aa] {ON}
           YLR089C (REAL)
          Length = 592

 Score =  662 bits (1709), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/492 (63%), Positives = 396/492 (80%), Gaps = 2/492 (0%)

Query: 73  TSREKSYFAERLEPEDLNPNVVKAKYAVRGAIPSYADKLKIQLLKHPGTLPFESVINSNI 132
           TS  + Y AE+L  +D+N NV+KAKYAVRGAIP  A++LK QL K P +LPF  +IN+NI
Sbjct: 100 TSNNEFYPAEQLTLDDVNENVLKAKYAVRGAIPMRAEELKAQLEKDPQSLPFNKIINANI 159

Query: 133 GNPQQLGQKPLSFGRQVLSILEYPALLD-HERTLVDSMGYAPDSIERAKTLLTDIG-SIG 190
           GNPQQL QKPL++ RQVLS+L+YP LL+ +E+ LVDS  +  D+I+RAK+L+ +IG S+G
Sbjct: 160 GNPQQLQQKPLTYYRQVLSLLQYPELLNQNEQQLVDSKLFKLDAIKRAKSLMEEIGGSVG 219

Query: 191 AYSNSQGVHGIRQTVADFITNRDDGEVAYPDDIFLTAGASSAVSTILSILCKGQQTGVLI 250
           AYS+SQGV GIR++VA+FIT RD+GE++YP+DIFLTAGAS+AV+ +LSI C+G +TGVLI
Sbjct: 220 AYSSSQGVEGIRRSVAEFITKRDEGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLI 279

Query: 251 PIPQYPXXXXXXXXXXXXXXPYYLDESNGWSTDINEISKVAQDSLEAGIKPTCLVVINPG 310
           PIPQYP              PYYLDES+GWST+  EI  V ++++E  IK T LVVINPG
Sbjct: 280 PIPQYPLYTATLALNNSQALPYYLDESSGWSTNPEEIETVVKEAIENEIKSTVLVVINPG 339

Query: 311 NPTGSVLTVEAIKNVFDVAAKYGLVVIADEVYQDNIFPGSEFHSMKKILRILQKEVPNKY 370
           NPTG+VL+ E+I  +F+VAAKYG VVIADEVYQ+NIFPG++FHSMKKILR LQ+E P K+
Sbjct: 340 NPTGAVLSPESIAQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKKILRHLQREHPGKF 399

Query: 371 DNIQLASLHSCSKGLLGECGHRGGYCEFIGFTPEVKQVITKLSSISLCSSVIGQALVDLM 430
           DN+QLASLHS SKG+ GECG RGGY E  GF+ E++QVI KL+SISLC  V GQALVDLM
Sbjct: 400 DNVQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLM 459

Query: 431 CCPPKKGEPSYELDQHERQTIRTNHKKRSNKLYEMFNSLEGVTCQKPQGAMYMFPNIQLP 490
             PP +GE S+E DQ ER +I      R+  LY+ FNSLEG+ CQKPQGAMY+FP I LP
Sbjct: 460 VRPPLEGEESFESDQAERNSIHEKLITRAMTLYKTFNSLEGIECQKPQGAMYLFPKIDLP 519

Query: 491 FNAIKMAQNLDITPDEFYCRELLKATGICTVPGSGFGQQPGTYHVRTTFLAPGVEWMKRW 550
           F A++ A++L++TPDEFYC++LL++TGICTVPGSGFGQ+PGTYH+RTTFLAPG+EW+K+W
Sbjct: 520 FRAVQEARHLELTPDEFYCKKLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWIKKW 579

Query: 551 EKFHIEFFEKYR 562
           E FH EFF+ YR
Sbjct: 580 ETFHKEFFDHYR 591

>Kpol_392.5 s392 (6873..8411) [1539 bp, 512 aa] {ON} (6873..8411)
           [1539 nt, 513 aa]
          Length = 512

 Score =  653 bits (1685), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/484 (63%), Positives = 382/484 (78%), Gaps = 6/484 (1%)

Query: 79  YFAERLEPEDLNPNVVKAKYAVRGAIPSYADKLKIQLLKHPGTLPFESVINSNIGNPQQL 138
           Y A++L  +DLN NV+KAKYAVRG+IP  A++LK+  L+    LPF++VIN+NIGNPQQL
Sbjct: 34  YPAQKLRMDDLNKNVLKAKYAVRGSIPLRAEELKL-YLEAGQKLPFDTVINANIGNPQQL 92

Query: 139 GQKPLSFGRQVLSILEYPALLDHERTLVDSMGYAPDSIERAKTLLTDIGSIGAYSNSQGV 198
            QKPL+F RQVLSIL+YP LL+    +     +  D+IERA+ LL +IGS+G+YS+SQG+
Sbjct: 93  KQKPLTFYRQVLSILQYPELLESGSNI-----FKKDAIERARKLLKEIGSVGSYSSSQGI 147

Query: 199 HGIRQTVADFITNRDDGEVAYPDDIFLTAGASSAVSTILSILCKGQQTGVLIPIPQYPXX 258
             IR+TVA+FIT RDDGE++ P+DIFLTAGASSAV  +LSILCK +++GVLIPIPQYP  
Sbjct: 148 PAIRKTVANFITKRDDGEISTPNDIFLTAGASSAVDYLLSILCKNEKSGVLIPIPQYPLY 207

Query: 259 XXXXXXXXXXXXPYYLDESNGWSTDINEISKVAQDSLEAGIKPTCLVVINPGNPTGSVLT 318
                       PYYLDES GWSTDINEI +V  DSL+ GIKPT LV+INPGNPTGS+L+
Sbjct: 208 TATLALNNAHALPYYLDESKGWSTDINEIEEVINDSLDKGIKPTALVIINPGNPTGSILS 267

Query: 319 VEAIKNVFDVAAKYGLVVIADEVYQDNIFPGSEFHSMKKILRILQKEVPNKYDNIQLASL 378
           VE+++ + +VAA +G+V+IADEVYQ+N+F  ++FHSMKK+LR LQK  P +YD +QLASL
Sbjct: 268 VESMEKIIEVAATHGIVIIADEVYQENVFNNAKFHSMKKVLRNLQKAFPGEYDTVQLASL 327

Query: 379 HSCSKGLLGECGHRGGYCEFIGFTPEVKQVITKLSSISLCSSVIGQALVDLMCCPPKKGE 438
           HS SKG+ GECG RGGY E  GF PE+KQVI KL SISLC  V GQALVDLM  PP+KG+
Sbjct: 328 HSTSKGVSGECGQRGGYMELTGFNPEIKQVILKLCSISLCPVVTGQALVDLMVSPPQKGD 387

Query: 439 PSYELDQHERQTIRTNHKKRSNKLYEMFNSLEGVTCQKPQGAMYMFPNIQLPFNAIKMAQ 498
            SYE DQ ER TI  +   R+  L+E FNS+EGV+CQKP+GAMY+FP I LPF  ++ +Q
Sbjct: 388 ESYEQDQLERSTILNDLSNRAILLWEAFNSMEGVSCQKPEGAMYLFPKIDLPFKVLQKSQ 447

Query: 499 NLDITPDEFYCRELLKATGICTVPGSGFGQQPGTYHVRTTFLAPGVEWMKRWEKFHIEFF 558
            LDITPDEFYC+ LL+ATGICTVPGSGFGQQPGTYH+RTTFLAPG EW+ RW KFH EF+
Sbjct: 448 ELDITPDEFYCKALLEATGICTVPGSGFGQQPGTYHLRTTFLAPGTEWIDRWNKFHAEFY 507

Query: 559 EKYR 562
           +KYR
Sbjct: 508 DKYR 511

>NDAI0B01990 Chr2 complement(493160..494926) [1767 bp, 588 aa] {ON}
           Anc_8.263 YDR111C
          Length = 588

 Score =  648 bits (1671), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/484 (63%), Positives = 383/484 (79%), Gaps = 2/484 (0%)

Query: 81  AERLEPEDLNPNVVKAKYAVRGAIPSYADKLKIQLLKHPGTLPFESVINSNIGNPQQLGQ 140
           AE+L   DLN NV+KAKYAVRG+IP  A++LK+QL  +P TLPF  ++N+NIGNPQQL Q
Sbjct: 104 AEQLTLADLNENVLKAKYAVRGSIPMRAEELKVQLENNPSTLPFSQIVNANIGNPQQLKQ 163

Query: 141 KPLSFGRQVLSILEYPALL-DHERTLVDSMGYAPDSIERAKTLLTDIG-SIGAYSNSQGV 198
           KPLSF RQVLSIL+YP +L ++E+ L+D+  Y  D+I+RAK LL++IG S+GAYS SQGV
Sbjct: 164 KPLSFYRQVLSILQYPDILKENEQNLIDAKVYKRDAIDRAKLLLSEIGGSVGAYSASQGV 223

Query: 199 HGIRQTVADFITNRDDGEVAYPDDIFLTAGASSAVSTILSILCKGQQTGVLIPIPQYPXX 258
           +GIR+TVA+FIT RD GE AYP+DIFLT         +LSILC+G +TGVLIPIPQYP  
Sbjct: 224 YGIRKTVANFITERDGGEPAYPEDIFLTVWCFRCCCYLLSILCQGPKTGVLIPIPQYPLY 283

Query: 259 XXXXXXXXXXXXPYYLDESNGWSTDINEISKVAQDSLEAGIKPTCLVVINPGNPTGSVLT 318
                       PYYLDE +GWST+  EI +V QD++E  I P+ LVVINPGNPTG+VLT
Sbjct: 284 TATLALNNSHALPYYLDEKSGWSTNPKEIEEVVQDAMERAINPSVLVVINPGNPTGAVLT 343

Query: 319 VEAIKNVFDVAAKYGLVVIADEVYQDNIFPGSEFHSMKKILRILQKEVPNKYDNIQLASL 378
            E+I+++F++AAKYG+VVIADEVYQ+NI  G +F+SMKK+LR LQK  P K+DN+QLASL
Sbjct: 344 EESIEHIFEIAAKYGIVVIADEVYQENIADGVKFYSMKKVLRKLQKSHPGKFDNVQLASL 403

Query: 379 HSCSKGLLGECGHRGGYCEFIGFTPEVKQVITKLSSISLCSSVIGQALVDLMCCPPKKGE 438
           HS SKG+ GECG RGGY E IGFT EV++VI KL+SISLC  V GQALVDLM  PPKKG+
Sbjct: 404 HSTSKGVSGECGQRGGYMELIGFTHEVRKVILKLASISLCPVVTGQALVDLMVSPPKKGD 463

Query: 439 PSYELDQHERQTIRTNHKKRSNKLYEMFNSLEGVTCQKPQGAMYMFPNIQLPFNAIKMAQ 498
            SYE DQ ER+ I++    R+++LYE F  LEG+ CQKPQGAMY+FP + LPF A++ AQ
Sbjct: 464 ASYEQDQAERRHIKSELSIRASQLYETFVGLEGIECQKPQGAMYLFPKLDLPFKAVQEAQ 523

Query: 499 NLDITPDEFYCRELLKATGICTVPGSGFGQQPGTYHVRTTFLAPGVEWMKRWEKFHIEFF 558
           +L++TPDEFYC+ LL ATGICTVPGSGFGQ+PGTYH+RTTFLAPG EW+K+WE FH EF+
Sbjct: 524 HLEMTPDEFYCKSLLDATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIKKWEAFHKEFY 583

Query: 559 EKYR 562
           + YR
Sbjct: 584 DNYR 587

>ZYRO0C01628g Chr3 (115665..117269) [1605 bp, 534 aa] {ON} similar
           to uniprot|P52893 Saccharomyces cerevisiae YLR089C ALT1
           putative alanine transaminase (glutamyc pyruvic
           transaminase)
          Length = 534

 Score =  644 bits (1662), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/486 (63%), Positives = 379/486 (77%), Gaps = 2/486 (0%)

Query: 79  YFAERLEPEDLNPNVVKAKYAVRGAIPSYADKLKIQLLKHPGTLPFESVINSNIGNPQQL 138
           Y AE+L   ++N NV+KAKYAVRGAIP  A +L  +L K P +LPF++++++NIGNPQ L
Sbjct: 48  YPAEKLGLSEVNENVLKAKYAVRGAIPMLAAELNAKLKKDPHSLPFDNIVSANIGNPQHL 107

Query: 139 GQKPLSFGRQVLSILEYPALLD-HERTLVDSMGYAPDSIERAKTLLTDIGS-IGAYSNSQ 196
            QKPL+F RQVLS+L+YP LL+ +E+ L+DS  Y  D+I RA+ LL DIGS +GAYS SQ
Sbjct: 108 KQKPLTFYRQVLSLLQYPGLLEENEQVLIDSKLYQKDAIARARRLLNDIGSSVGAYSTSQ 167

Query: 197 GVHGIRQTVADFITNRDDGEVAYPDDIFLTAGASSAVSTILSILCKGQQTGVLIPIPQYP 256
           G+ GIR+TVA FIT RD GE AY +DIFLTAGASSAVS +LSILCKGQ+TGVLIPIPQYP
Sbjct: 168 GIQGIRETVAQFITERDGGEKAYAEDIFLTAGASSAVSYLLSILCKGQETGVLIPIPQYP 227

Query: 257 XXXXXXXXXXXXXXPYYLDESNGWSTDINEISKVAQDSLEAGIKPTCLVVINPGNPTGSV 316
                         PYYLDE +GWST+  EI  V  +++E  IKP+ LVVINPGNPTG+V
Sbjct: 228 LYTASLALNNSHPLPYYLDEKSGWSTNPTEIEDVVNNAIEQNIKPSVLVVINPGNPTGAV 287

Query: 317 LTVEAIKNVFDVAAKYGLVVIADEVYQDNIFPGSEFHSMKKILRILQKEVPNKYDNIQLA 376
           L+ E I  +F +AAKYG+VVIADEVYQ+N+F G+EFHSMKKILR LQK  P  +DN+QLA
Sbjct: 288 LSEEDISQIFAIAAKYGIVVIADEVYQENVFDGAEFHSMKKILRKLQKSNPGVFDNVQLA 347

Query: 377 SLHSCSKGLLGECGHRGGYCEFIGFTPEVKQVITKLSSISLCSSVIGQALVDLMCCPPKK 436
           SLHS SKG+ GECG RGGY E  GF  +++QVI KL+SISLC  V GQALVDLM  PPK 
Sbjct: 348 SLHSTSKGVSGECGQRGGYMEITGFNNDIRQVILKLASISLCPVVTGQALVDLMVSPPKP 407

Query: 437 GEPSYELDQHERQTIRTNHKKRSNKLYEMFNSLEGVTCQKPQGAMYMFPNIQLPFNAIKM 496
           G+ SYELDQ ER++I     +R+ KL+  FNSLEG+ CQKP+GAMY+FP + LPF AI+ 
Sbjct: 408 GDESYELDQQERKSIHEALAERAGKLHATFNSLEGIECQKPEGAMYLFPRLLLPFKAIQS 467

Query: 497 AQNLDITPDEFYCRELLKATGICTVPGSGFGQQPGTYHVRTTFLAPGVEWMKRWEKFHIE 556
           A++  +TPD FYC++LL+ATGICTVPGSGFGQ+PGTYH+RTTFLAPG EW++RWE FH  
Sbjct: 468 AEHEGMTPDAFYCKKLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIERWENFHKA 527

Query: 557 FFEKYR 562
           F+E+YR
Sbjct: 528 FYEEYR 533

>KNAG0G02040 Chr7 complement(463058..464833) [1776 bp, 591 aa] {ON}
           Anc_8.263 YDR111C
          Length = 591

 Score =  639 bits (1649), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/496 (62%), Positives = 382/496 (77%), Gaps = 4/496 (0%)

Query: 71  YSTSREKSYFAERLEPEDLNPNVVKAKYAVRGAIPSYADKLKIQLLKHPGTLPFESVINS 130
           +S S  K   A +++  DLN NV+KAKYAVRG+IP  A++L+ QL + P +LPF+ +IN+
Sbjct: 95  HSKSHYKFTPAAQVKIADLNENVLKAKYAVRGSIPMRAEQLQHQLQEDPRSLPFDKIINA 154

Query: 131 NIGNPQQLGQKPLSFGRQVLSILEYPALLD--HERTLVDSMGYAPDSIERAKTLLTDIG- 187
           NIGNPQQL QKPLSF RQVLS+L++P LL+   E     +  Y  D++ RA+ LL DIG 
Sbjct: 155 NIGNPQQLNQKPLSFYRQVLSLLQFPELLNSLKENPAAATSLYKADAVRRAEKLLEDIGG 214

Query: 188 SIGAYSNSQGVHGIRQTVADFITNRDDGEVAYPDDIFLTAGASSAVSTILSILCKGQQTG 247
           S+GAYS SQGV GIR+TVADFIT RD+ E AYP+DIFLTAGAS+AVS +LSI CKG++TG
Sbjct: 215 SVGAYSTSQGVMGIRKTVADFITRRDNNEPAYPEDIFLTAGASAAVSYLLSIFCKGEKTG 274

Query: 248 VLIPIPQYPXXXXXXXXXXXXXXPYYLDESNGWSTDINEISKVAQDSLEAGIKPTCLVVI 307
           VLIPIPQYP              PYYLDE +GWST+  EI  V  D+++  IKP+ LVVI
Sbjct: 275 VLIPIPQYPLYTATLALNNSHTLPYYLDEKSGWSTNTKEIDSVVLDAIDRNIKPSVLVVI 334

Query: 308 NPGNPTGSVLTVEAIKNVFDVAAKYGLVVIADEVYQDNIFPGS-EFHSMKKILRILQKEV 366
           NPGNPTG+VL+ +AI  +F++AAKYG+VVIADEVYQ+NIF    +FHSMKK+LR LQ+E 
Sbjct: 335 NPGNPTGAVLSEKAIAEIFEIAAKYGIVVIADEVYQENIFDEDVKFHSMKKVLRKLQQEH 394

Query: 367 PNKYDNIQLASLHSCSKGLLGECGHRGGYCEFIGFTPEVKQVITKLSSISLCSSVIGQAL 426
           P K+D +QLASLHS SKG+ GECG RGG+ E  GF+ E++QVI KL+SISLC  V GQAL
Sbjct: 395 PGKFDEVQLASLHSTSKGVSGECGQRGGFMELTGFSHEIRQVILKLASISLCPVVTGQAL 454

Query: 427 VDLMCCPPKKGEPSYELDQHERQTIRTNHKKRSNKLYEMFNSLEGVTCQKPQGAMYMFPN 486
           VDLM  PP++GE SYELDQ ER  I +   KR+NKL+E FN LEG+ CQKPQGAMY+FP 
Sbjct: 455 VDLMVHPPQEGEESYELDQAERSHIHSELHKRANKLWETFNRLEGIQCQKPQGAMYLFPR 514

Query: 487 IQLPFNAIKMAQNLDITPDEFYCRELLKATGICTVPGSGFGQQPGTYHVRTTFLAPGVEW 546
           + LPF A++ AQ++++T DEFYC+ELL+ TGICTVPGSGFGQ PGTYH+RTTFLAPG EW
Sbjct: 515 LNLPFKAVQKAQHMEMTADEFYCKELLENTGICTVPGSGFGQVPGTYHLRTTFLAPGTEW 574

Query: 547 MKRWEKFHIEFFEKYR 562
           +  WEKFH EF+ KYR
Sbjct: 575 IDLWEKFHKEFYNKYR 590

>SAKL0H17006g Chr8 (1493272..1494867) [1596 bp, 531 aa] {ON} highly
           similar to gnl|GLV|KLLA0F19162g Kluyveromyces lactis
           KLLA0F19162g and similar to YLR089C uniprot|P52893
           Saccharomyces cerevisiae YLR089C ALT1 putative alanine
           transaminase (glutamyc pyruvic transaminase)
          Length = 531

 Score =  635 bits (1638), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/483 (62%), Positives = 378/483 (78%), Gaps = 1/483 (0%)

Query: 81  AERLEPEDLNPNVVKAKYAVRGAIPSYADKLKIQLLKHPGTLPFESVINSNIGNPQQLGQ 140
           A++L  EDLN NV++AKYAVRG IP  A++LK QL + P +LPF+ +IN+NIGNPQQL Q
Sbjct: 48  ADKLSLEDLNENVLRAKYAVRGKIPQKAEELKNQLARDPKSLPFDRIINANIGNPQQLDQ 107

Query: 141 KPLSFGRQVLSILEYPALLDHERTLVDSMGYAPDSIERAKTLLTDIG-SIGAYSNSQGVH 199
           KPL+F RQVLS+L+ P +L+       S  Y PD+I+RA  LL++IG S+GAYS+SQGV+
Sbjct: 108 KPLTFYRQVLSLLQNPDMLEEIPREQLSQIYKPDAIDRAARLLSNIGGSVGAYSHSQGVY 167

Query: 200 GIRQTVADFITNRDDGEVAYPDDIFLTAGASSAVSTILSILCKGQQTGVLIPIPQYPXXX 259
           G R+TVADFIT RD GE AY +DIFLTAGAS+AVS ILSILC+G QTGVLIPIPQYP   
Sbjct: 168 GFRKTVADFITKRDGGEEAYAEDIFLTAGASAAVSYILSILCRGPQTGVLIPIPQYPLYT 227

Query: 260 XXXXXXXXXXXPYYLDESNGWSTDINEISKVAQDSLEAGIKPTCLVVINPGNPTGSVLTV 319
                      PYYLDE + WST+  EI KV  +S+  G++P CLVVINPGNPTG++L+ 
Sbjct: 228 ASLALNNSHALPYYLDEESNWSTNPEEIEKVVTNSIAKGVEPKCLVVINPGNPTGAILSP 287

Query: 320 EAIKNVFDVAAKYGLVVIADEVYQDNIFPGSEFHSMKKILRILQKEVPNKYDNIQLASLH 379
           E+I+ +F+VAAKYG+VVIADEVYQ+N+F G+EFHSM+K+L+ LQ++   K+DNIQLASLH
Sbjct: 288 ESIEKIFEVAAKYGIVVIADEVYQENVFNGAEFHSMRKVLKDLQRKHHGKFDNIQLASLH 347

Query: 380 SCSKGLLGECGHRGGYCEFIGFTPEVKQVITKLSSISLCSSVIGQALVDLMCCPPKKGEP 439
           S SKG+ GECG RGGY E +GF+ +V+QV  KL+SISLC  V GQALVDLM CPPK G+ 
Sbjct: 348 STSKGVSGECGQRGGYMELLGFSHDVRQVFLKLASISLCPVVTGQALVDLMVCPPKPGDA 407

Query: 440 SYELDQHERQTIRTNHKKRSNKLYEMFNSLEGVTCQKPQGAMYMFPNIQLPFNAIKMAQN 499
           SYE DQ ER  I      R++ LYE FN LEG+ CQKPQGAMY+FP + L + A++ A++
Sbjct: 408 SYEQDQKERSEIHDALDARASMLYETFNRLEGIECQKPQGAMYLFPRLDLSYKAVQKAEH 467

Query: 500 LDITPDEFYCRELLKATGICTVPGSGFGQQPGTYHVRTTFLAPGVEWMKRWEKFHIEFFE 559
           L ++PDEFYC+ELL+ATGICTVPGSGFGQ PGTYH+RTTFLAPG +W+K WE+FH +F+ 
Sbjct: 468 LSLSPDEFYCQELLEATGICTVPGSGFGQVPGTYHLRTTFLAPGTDWIKAWEEFHKKFYN 527

Query: 560 KYR 562
           +YR
Sbjct: 528 EYR 530

>NCAS0B05020 Chr2 complement(931456..933162) [1707 bp, 568 aa] {ON} 
          Length = 568

 Score =  634 bits (1635), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/484 (62%), Positives = 384/484 (79%), Gaps = 2/484 (0%)

Query: 81  AERLEPEDLNPNVVKAKYAVRGAIPSYADKLKIQLLKHPGTLPFESVINSNIGNPQQLGQ 140
           A++L   +LN NV+KAKYAVRGAIP  A++LKIQL + P +LPF+ ++N+NIGNPQQL Q
Sbjct: 84  ADQLTLAELNDNVLKAKYAVRGAIPMRAEELKIQLQEDPSSLPFDHIVNANIGNPQQLNQ 143

Query: 141 KPLSFGRQVLSILEYPALLDH-ERTLVDSMGYAPDSIERAKTLLTDIG-SIGAYSNSQGV 198
           KPLSF RQVLS+L+YP +L   E  LV S  +  D++ERAKTLL +IG ++GAYS SQGV
Sbjct: 144 KPLSFYRQVLSLLQYPEILKQDESKLVASGLFKKDALERAKTLLHEIGGTVGAYSASQGV 203

Query: 199 HGIRQTVADFITNRDDGEVAYPDDIFLTAGASSAVSTILSILCKGQQTGVLIPIPQYPXX 258
           +GIR+TVA+FIT RD+GE AYP+DIFLTAGAS+AV  +LSILCKG +TGVLIPIPQYP  
Sbjct: 204 YGIRKTVANFITKRDNGEPAYPEDIFLTAGASAAVMYLLSILCKGPETGVLIPIPQYPLY 263

Query: 259 XXXXXXXXXXXXPYYLDESNGWSTDINEISKVAQDSLEAGIKPTCLVVINPGNPTGSVLT 318
                       PYYLDE +GWST+  EI +V   + +  I+P+ LVVINPGNPTG+VL+
Sbjct: 264 TASLALNNSHALPYYLDEKSGWSTNPKEIEEVVLAAKDKKIRPSVLVVINPGNPTGAVLS 323

Query: 319 VEAIKNVFDVAAKYGLVVIADEVYQDNIFPGSEFHSMKKILRILQKEVPNKYDNIQLASL 378
            ++I+++F++AAKYG+VVIADEVYQ+N+F   +FHSMKK+LR LQK+ P  YD +QLASL
Sbjct: 324 EKSIEHIFEIAAKYGIVVIADEVYQENVFNEVKFHSMKKVLRNLQKKHPGVYDMVQLASL 383

Query: 379 HSCSKGLLGECGHRGGYCEFIGFTPEVKQVITKLSSISLCSSVIGQALVDLMCCPPKKGE 438
           HS SKG+ GECG RGGY E  GFT EV+ VI KL+SISLC  V GQALVDLM  PPKKG+
Sbjct: 384 HSTSKGVSGECGQRGGYMELTGFTHEVRSVILKLASISLCPVVTGQALVDLMVSPPKKGD 443

Query: 439 PSYELDQHERQTIRTNHKKRSNKLYEMFNSLEGVTCQKPQGAMYMFPNIQLPFNAIKMAQ 498
            S+E DQ ER+ I++    R+ +LY+ FN+LEG+ CQKPQGAMY+FP + LPF A++ AQ
Sbjct: 444 ESFEQDQAERKHIKSELHTRAMQLYKNFNTLEGIECQKPQGAMYLFPRLDLPFKAVQKAQ 503

Query: 499 NLDITPDEFYCRELLKATGICTVPGSGFGQQPGTYHVRTTFLAPGVEWMKRWEKFHIEFF 558
           +L+++PDEFYC+ LL+ATGICTVPGSGFGQ+PGTYH+RTTFLAPG EW+++W+ FH +F+
Sbjct: 504 HLEMSPDEFYCKSLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIEKWKIFHQDFY 563

Query: 559 EKYR 562
             YR
Sbjct: 564 NTYR 567

>KLLA0F19162g Chr6 complement(1775240..1776826) [1587 bp, 528 aa]
           {ON} similar to uniprot|P52893 Saccharomyces cerevisiae
           YLR089C ALT1 putative alanine transaminase (glutamyc
           pyruvic transaminase)
          Length = 528

 Score =  632 bits (1629), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/483 (61%), Positives = 377/483 (78%), Gaps = 2/483 (0%)

Query: 81  AERLEPEDLNPNVVKAKYAVRGAIPSYADKLKIQLLKHPGTLPFESVINSNIGNPQQLGQ 140
           A +L  +D+N NV+KAKYAVRG IP  A++L+ QL K P +LPF  +I++NIGNPQQL Q
Sbjct: 46  APKLSLDDVNENVLKAKYAVRGRIPMRAEELRDQLKKDPSSLPFSKIISANIGNPQQLDQ 105

Query: 141 KPLSFGRQVLSILEYPALLDHERTLVDSMGYAPDSIERAKTLLTDIG-SIGAYSNSQGVH 199
           KPL+F R+VLS+L++P LL+     + ++ Y  DSI+RAK LL+++G S+GAYS SQGV 
Sbjct: 106 KPLTFYREVLSLLQHPELLEEADEALQTL-YKTDSIKRAKRLLSEVGGSVGAYSQSQGVQ 164

Query: 200 GIRQTVADFITNRDDGEVAYPDDIFLTAGASSAVSTILSILCKGQQTGVLIPIPQYPXXX 259
           GIR+TVADFIT RDDGE++YP+DI+LTAGAS+AVS ILSILCKG  TGVLIPIPQYP   
Sbjct: 165 GIRETVADFITKRDDGEISYPEDIYLTAGASAAVSYILSILCKGPNTGVLIPIPQYPLYT 224

Query: 260 XXXXXXXXXXXPYYLDESNGWSTDINEISKVAQDSLEAGIKPTCLVVINPGNPTGSVLTV 319
                      PYYL E   WSTD  EI +V  D+++ GIKPTCLVVINPGNPTG++L+ 
Sbjct: 225 ASLALNNSRPLPYYLREEQNWSTDPEEIEQVVLDAIQKGIKPTCLVVINPGNPTGAILSE 284

Query: 320 EAIKNVFDVAAKYGLVVIADEVYQDNIFPGSEFHSMKKILRILQKEVPNKYDNIQLASLH 379
           ++I+ +F+VAAKYG+VVIADEVYQ+N+F GS+F+SMKK+LR LQK    +YDNIQLASLH
Sbjct: 285 QSIQKIFEVAAKYGIVVIADEVYQENVFKGSKFYSMKKVLRNLQKTYHGQYDNIQLASLH 344

Query: 380 SCSKGLLGECGHRGGYCEFIGFTPEVKQVITKLSSISLCSSVIGQALVDLMCCPPKKGEP 439
           S SKG+ GECG RGGY E +GF  +++QV  KL+SISLC  V GQALVDLM  PP+ G+ 
Sbjct: 345 STSKGVSGECGQRGGYMELVGFNHDIRQVFLKLASISLCPVVTGQALVDLMVSPPQPGDE 404

Query: 440 SYELDQHERQTIRTNHKKRSNKLYEMFNSLEGVTCQKPQGAMYMFPNIQLPFNAIKMAQN 499
           SYE DQ ER+ I     +R++KL+E F+ LEG+ C+KPQGAMY++P + LP+  I+ AQ+
Sbjct: 405 SYEQDQQEREDIHDALDERASKLFETFSRLEGIECRKPQGAMYLYPKLDLPYKVIQEAQH 464

Query: 500 LDITPDEFYCRELLKATGICTVPGSGFGQQPGTYHVRTTFLAPGVEWMKRWEKFHIEFFE 559
           L++ PDEFYC+ LL+ TGICTVPGSGFGQ PGTYH+RTTFL PG EW++ WEKFH  FF+
Sbjct: 465 LEMEPDEFYCKALLENTGICTVPGSGFGQVPGTYHLRTTFLPPGTEWVETWEKFHKAFFD 524

Query: 560 KYR 562
           KYR
Sbjct: 525 KYR 527

>CAGL0L12254g Chr12 complement(1327111..1328835) [1725 bp, 574 aa]
           {ON} similar to uniprot|P52893 Saccharomyces cerevisiae
           YLR089c
          Length = 574

 Score =  624 bits (1610), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/487 (60%), Positives = 378/487 (77%), Gaps = 10/487 (2%)

Query: 81  AERLEPEDLNPNVVKAKYAVRGAIPSYADKLKIQLLKHPGTLPFESVINSNIGNPQQLGQ 140
           AE+   +D+N  V+ AKYAVRGAIP  A++LK QL+++P +LPF  +IN+NIGNPQQL Q
Sbjct: 92  AEQATLKDVNECVLNAKYAVRGAIPMRAEELKTQLMENPHSLPFNDIINANIGNPQQLKQ 151

Query: 141 KPLSFGRQVLSILEYPALL----DHERTLVDSMGYAPDSIERAKTLLTDIG-SIGAYSNS 195
           KPLSF RQVLS+L+YP L+    ++ +T++       D+I+RAK LL DIG S+GAYS+S
Sbjct: 152 KPLSFYRQVLSLLQYPELIPTLENNPQTMIKQ-----DAIDRAKRLLDDIGGSVGAYSSS 206

Query: 196 QGVHGIRQTVADFITNRDDGEVAYPDDIFLTAGASSAVSTILSILCKGQQTGVLIPIPQY 255
           QGV GIR+TVADFITNRDDG +AYP+DIFLTAGASSAV  +LSI C+G++TGVLIPIPQY
Sbjct: 207 QGVLGIRKTVADFITNRDDGIIAYPEDIFLTAGASSAVDYLLSIFCRGEETGVLIPIPQY 266

Query: 256 PXXXXXXXXXXXXXXPYYLDESNGWSTDINEISKVAQDSLEAGIKPTCLVVINPGNPTGS 315
           P              PYYL+E  GWSTD  E+  +  DS+E  IKP+ LVVINPGNPTG+
Sbjct: 267 PLYTATLALQNSHALPYYLNEETGWSTDPEELESIILDSIENNIKPSVLVVINPGNPTGA 326

Query: 316 VLTVEAIKNVFDVAAKYGLVVIADEVYQDNIFPGSEFHSMKKILRILQKEVPNKYDNIQL 375
           VL+ EAI+ +F +AAKYG++VIADEVYQ+N+F   +FHSMKK+LR LQ + P  YDN+QL
Sbjct: 327 VLSEEAIEQIFTLAAKYGIIVIADEVYQENVFEDVKFHSMKKVLRQLQMKQPGLYDNVQL 386

Query: 376 ASLHSCSKGLLGECGHRGGYCEFIGFTPEVKQVITKLSSISLCSSVIGQALVDLMCCPPK 435
           ASLHS SKG+ GECG RGGY E +GFT +++QV+ KL+SISLC  V GQALVDLM CPP+
Sbjct: 387 ASLHSTSKGVSGECGQRGGYMELVGFTHDIRQVVLKLASISLCPVVTGQALVDLMVCPPQ 446

Query: 436 KGEPSYELDQHERQTIRTNHKKRSNKLYEMFNSLEGVTCQKPQGAMYMFPNIQLPFNAIK 495
           KGE SYE DQ ER+ I     KR+  L++ F  L+G++CQKPQGAMY+FP ++LP+ AI+
Sbjct: 447 KGEESYEQDQEERRNIHKELHKRATLLHDAFVKLDGISCQKPQGAMYLFPKLELPYKAIQ 506

Query: 496 MAQNLDITPDEFYCRELLKATGICTVPGSGFGQQPGTYHVRTTFLAPGVEWMKRWEKFHI 555
            A + D++PDEFYC+ LL+ TGICTVPGSGFGQ+PGTYH+RTTFLAPG +W++ W  FH 
Sbjct: 507 EALHQDMSPDEFYCKSLLEKTGICTVPGSGFGQEPGTYHLRTTFLAPGTKWIEDWVDFHQ 566

Query: 556 EFFEKYR 562
           EF+ K++
Sbjct: 567 EFYNKFK 573

>NCAS0B03840 Chr2 (683781..685274) [1494 bp, 497 aa] {ON} Anc_8.263
           YDR111C
          Length = 497

 Score =  619 bits (1597), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/483 (59%), Positives = 372/483 (77%), Gaps = 1/483 (0%)

Query: 81  AERLEPEDLNPNVVKAKYAVRGAIPSYADKLKIQLLKHPGTLPFESVINSNIGNPQQLGQ 140
           A +L  +D+N NVV AK+A+RG+I   A+ L++QL K+P  LPF+ +  +NIGNPQ+L Q
Sbjct: 14  APKLSLKDINENVVDAKFAIRGSISIKAEDLQVQLNKNPHCLPFDEITVANIGNPQELNQ 73

Query: 141 KPLSFGRQVLSILEYPALLDHERTLVDSMGYAPDSIERAKTLLTDIG-SIGAYSNSQGVH 199
           KPL+F RQV+SIL+YP LL++   L     +  DS +RA+ LL DIG S+GAYS SQGV+
Sbjct: 74  KPLTFARQVVSILQYPELLNNRDVLTKEKIFNSDSFDRAERLLRDIGGSVGAYSASQGVY 133

Query: 200 GIRQTVADFITNRDDGEVAYPDDIFLTAGASSAVSTILSILCKGQQTGVLIPIPQYPXXX 259
           GIR+T A++IT RD GE +YP+DIFLT GA+SA S +LS+LC+G QTGVLIPIPQYP   
Sbjct: 134 GIRKTAAEYITKRDGGEPSYPEDIFLTTGATSAASYLLSVLCRGPQTGVLIPIPQYPLYT 193

Query: 260 XXXXXXXXXXXPYYLDESNGWSTDINEISKVAQDSLEAGIKPTCLVVINPGNPTGSVLTV 319
                      PYYLDE + WST+  EI K+  DS++ GIKP+ +VVINPGNPTG+VL+ 
Sbjct: 194 ATLALNKSTMIPYYLDEESAWSTNTTEIEKLVLDSIKKGIKPSVIVVINPGNPTGAVLSE 253

Query: 320 EAIKNVFDVAAKYGLVVIADEVYQDNIFPGSEFHSMKKILRILQKEVPNKYDNIQLASLH 379
            AI  +F +AAKYG+VV+ADEVYQ+NIF G +FHS KK+LR LQK+ P K+DNIQLAS+H
Sbjct: 254 LAIAKIFQIAAKYGIVVLADEVYQENIFDGVQFHSTKKVLRGLQKQYPGKFDNIQLASMH 313

Query: 380 SCSKGLLGECGHRGGYCEFIGFTPEVKQVITKLSSISLCSSVIGQALVDLMCCPPKKGEP 439
           S SKG+ GECG RGGY E +GFT EV+Q++ KL+ +++CS V GQA+VDLM  PPKKG+ 
Sbjct: 314 STSKGVFGECGQRGGYMELVGFTDEVRQLLLKLACLAVCSVVTGQAMVDLMLLPPKKGDA 373

Query: 440 SYELDQHERQTIRTNHKKRSNKLYEMFNSLEGVTCQKPQGAMYMFPNIQLPFNAIKMAQN 499
           SYELD+ ERQ I     +R+ KLY MF+ L+G+ CQKPQGAMY++P++ L   AI  A++
Sbjct: 374 SYELDKKERQEIFDAMYERARKLYAMFDKLDGIECQKPQGAMYLYPSLILSKKAIAKAES 433

Query: 500 LDITPDEFYCRELLKATGICTVPGSGFGQQPGTYHVRTTFLAPGVEWMKRWEKFHIEFFE 559
           L++TPDEFYC ELL ATGICTVPGSGFGQ+ GTYH+RTTFLAPG+EW+ +WEKFH  F+E
Sbjct: 434 LNLTPDEFYCHELLDATGICTVPGSGFGQKKGTYHLRTTFLAPGIEWINKWEKFHKHFYE 493

Query: 560 KYR 562
           KY+
Sbjct: 494 KYQ 496

>TPHA0J00750 Chr10 complement(176561..178129) [1569 bp, 522 aa] {ON}
           Anc_8.263 YDR111C
          Length = 522

 Score =  616 bits (1588), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/483 (61%), Positives = 369/483 (76%), Gaps = 1/483 (0%)

Query: 81  AERLEPEDLNPNVVKAKYAVRGAIPSYADKLKIQLLKHPGTLPFESVINSNIGNPQQLGQ 140
           A++L   DLN NV+KAKYAVRG IP+ A+ LK QL+ +P +LPF+ VIN+NIGNPQQL Q
Sbjct: 39  ADKLTINDLNENVLKAKYAVRGKIPARAEVLKQQLIDNPSSLPFKKVINANIGNPQQLNQ 98

Query: 141 KPLSFGRQVLSILEYPALLDHERTLVDSMGYAPDSIERAKTLLTDIGSIGAYSNSQG-VH 199
           KPL+F RQVLS+L+YP +LD   +      Y  D+IERAK +L DIGS     +S   V 
Sbjct: 99  KPLTFYRQVLSLLQYPMVLDETFSGNTKTLYKQDAIERAKRILNDIGSSVGSYSSSQGVF 158

Query: 200 GIRQTVADFITNRDDGEVAYPDDIFLTAGASSAVSTILSILCKGQQTGVLIPIPQYPXXX 259
           G+R+TVA++I+ RD GE AY +DIFLTAGASSAVS +L+ILCKG+++GVLIPIPQYP   
Sbjct: 159 GLRKTVAEYISRRDGGEKAYAEDIFLTAGASSAVSYLLNILCKGKESGVLIPIPQYPLYT 218

Query: 260 XXXXXXXXXXXPYYLDESNGWSTDINEISKVAQDSLEAGIKPTCLVVINPGNPTGSVLTV 319
                      PYYL+E++GWST++ EI  V  +++   I P  LVVINPGNPTG++L+V
Sbjct: 219 ATLALNNTNALPYYLEENSGWSTNMEEIENVVHNAIREKIIPRVLVVINPGNPTGAILSV 278

Query: 320 EAIKNVFDVAAKYGLVVIADEVYQDNIFPGSEFHSMKKILRILQKEVPNKYDNIQLASLH 379
           E+I+ +FDVAA +G+VVIADEVYQ+NIFPG+EFHSMKK+LR LQ+ VP KY+N+QLASLH
Sbjct: 279 ESIEKIFDVAAHHGIVVIADEVYQENIFPGNEFHSMKKVLRDLQRRVPGKYENVQLASLH 338

Query: 380 SCSKGLLGECGHRGGYCEFIGFTPEVKQVITKLSSISLCSSVIGQALVDLMCCPPKKGEP 439
           S SKG+ GECG RGGY E  GF+ E+K  I KL SISLC  V GQALVDLM CPPKKGE 
Sbjct: 339 STSKGVSGECGQRGGYMELTGFSTEIKHEILKLCSISLCPVVTGQALVDLMTCPPKKGEA 398

Query: 440 SYELDQHERQTIRTNHKKRSNKLYEMFNSLEGVTCQKPQGAMYMFPNIQLPFNAIKMAQN 499
           SYE DQ ER TI +   +R+  L++ FN +EGV+CQKPQG+MY+FP I +P  A++ AQ 
Sbjct: 399 SYEQDQMERSTIHSELYERATYLWKAFNEMEGVSCQKPQGSMYLFPKIDIPHKALEKAQE 458

Query: 500 LDITPDEFYCRELLKATGICTVPGSGFGQQPGTYHVRTTFLAPGVEWMKRWEKFHIEFFE 559
           LDITPDE YC ELL+ATGICTVPGSGFGQ+PGT+H+RTTFLAPG  W+ +W +FH  F  
Sbjct: 459 LDITPDELYCAELLEATGICTVPGSGFGQKPGTFHLRTTFLAPGTSWIDQWREFHQIFCN 518

Query: 560 KYR 562
           KYR
Sbjct: 519 KYR 521

>KAFR0B02730 Chr2 complement(558858..560477) [1620 bp, 539 aa] {ON}
           Anc_8.263 YDR111C
          Length = 539

 Score =  614 bits (1584), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/483 (62%), Positives = 378/483 (78%), Gaps = 2/483 (0%)

Query: 81  AERLEPEDLNPNVVKAKYAVRGAIPSYADKLKIQLLKHPGTLPFESVINSNIGNPQQLGQ 140
           A +L   DLN NV+KAKYAVRG IP+ A++LK QL + P +LPF+ +IN+NIGNPQQL Q
Sbjct: 55  AGQLTIGDLNENVLKAKYAVRGKIPTRAEELKRQLAEKPNSLPFDKIINANIGNPQQLQQ 114

Query: 141 KPLSFGRQVLSILEYPALLDHERTLVDSMG-YAPDSIERAKTLLTDIG-SIGAYSNSQGV 198
           +PLSF RQVLS+L+YP LL    T   S   Y  D+I RAK +L DIG S+GAYS SQGV
Sbjct: 115 QPLSFYRQVLSLLQYPTLLHAIETKPGSSAVYKKDAILRAKKILKDIGGSVGAYSESQGV 174

Query: 199 HGIRQTVADFITNRDDGEVAYPDDIFLTAGASSAVSTILSILCKGQQTGVLIPIPQYPXX 258
           +GIR+TVA+FIT RD GE AYP+DIFLTAGAS+AV+ +LSILCKG++TGVLIPIPQYP  
Sbjct: 175 YGIRRTVANFITERDGGEPAYPEDIFLTAGASAAVNYLLSILCKGEKTGVLIPIPQYPLY 234

Query: 259 XXXXXXXXXXXXPYYLDESNGWSTDINEISKVAQDSLEAGIKPTCLVVINPGNPTGSVLT 318
                       PY+LDE NGWS +  EI  V + +++  IKP  LVVINPGNPTG+VL+
Sbjct: 235 TATLALNNSHALPYFLDEMNGWSINPIEIENVIKKAVQDNIKPDVLVVINPGNPTGAVLS 294

Query: 319 VEAIKNVFDVAAKYGLVVIADEVYQDNIFPGSEFHSMKKILRILQKEVPNKYDNIQLASL 378
            EAI ++ ++AAKYG+VVIADEVYQ+NIF G +FHS+K +LR LQ+E+P K+DN+QLASL
Sbjct: 295 KEAIVSILEIAAKYGIVVIADEVYQENIFDGMKFHSVKGVLRRLQREIPGKFDNVQLASL 354

Query: 379 HSCSKGLLGECGHRGGYCEFIGFTPEVKQVITKLSSISLCSSVIGQALVDLMCCPPKKGE 438
           HS SKG+ GECG RGGY E IGFT EV+QVI KL+SISLC  V GQALVDLM  PPK+GE
Sbjct: 355 HSTSKGVSGECGQRGGYMEIIGFTHEVRQVILKLASISLCPVVTGQALVDLMVSPPKRGE 414

Query: 439 PSYELDQHERQTIRTNHKKRSNKLYEMFNSLEGVTCQKPQGAMYMFPNIQLPFNAIKMAQ 498
            S+ LDQ +R+TI +   +R+  L++ FNSL+G+ CQKP GAMY+FP + LP+ AI+ AQ
Sbjct: 415 ESFALDQAQRKTIHSQLSQRAELLWKTFNSLDGIECQKPNGAMYLFPKLNLPYRAIQEAQ 474

Query: 499 NLDITPDEFYCRELLKATGICTVPGSGFGQQPGTYHVRTTFLAPGVEWMKRWEKFHIEFF 558
            L+++PDEFYC+ELL+ TGICTVPGSGFGQ  GTYH+RTTFLAPG+EW+  W++FHIEF 
Sbjct: 475 RLELSPDEFYCKELLEHTGICTVPGSGFGQVAGTYHLRTTFLAPGIEWIDSWKQFHIEFM 534

Query: 559 EKY 561
           EKY
Sbjct: 535 EKY 537

>KNAG0M01210 Chr13 (220612..222177) [1566 bp, 521 aa] {ON} Anc_8.263
           YDR111C
          Length = 521

 Score =  611 bits (1575), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/484 (59%), Positives = 362/484 (74%), Gaps = 2/484 (0%)

Query: 81  AERLEPEDLNPNVVKAKYAVRGAIPSYADKLKIQLLKHPGTLPFESVINSNIGNPQQLGQ 140
           A +L  +DLN N++ A+YAVRGAIP  A++L+IQL + P  LPF ++  +NIGNPQQL Q
Sbjct: 37  ARKLGADDLNKNIIDAEYAVRGAIPMKAEELEIQLSQQPDLLPFNAITVANIGNPQQLDQ 96

Query: 141 KPLSFGRQVLSILEYPALLDHERTLVDSMGYAPDSIERAKTLLTDIG-SIGAYSNSQGVH 199
           KPL+F RQV+SIL+YP LLD+E  LV S  Y  D+ +RA  LL  IG S+GAYS +QGV+
Sbjct: 97  KPLTFSRQVVSILQYPPLLDYEEQLVTSGAYKRDAFKRAAVLLEQIGGSVGAYSLAQGVY 156

Query: 200 GIRQTVADFITNRDDGEVAYPDDIFLTAGASSAVSTILSILCKGQQTGVLIPIPQYPXXX 259
           GIR++VADFIT RD+GE A PDDIFLT GAS A + +LSILC+   TG++IPIPQYP   
Sbjct: 157 GIRESVADFITRRDEGETASPDDIFLTDGASKAATYLLSILCRDSSTGIMIPIPQYPLYT 216

Query: 260 XXXXXXXXXXXPYYLDESNGWSTDINEISKVAQDSLEAGIKPTCLVVINPGNPTGSVLTV 319
                      PYYLDE +GWST   EI +   DS++ G+ P  +VVINPGNPTG+VL+ 
Sbjct: 217 ASITMYNSVMLPYYLDEESGWSTKAEEIEQQVIDSIKRGVTPRVIVVINPGNPTGAVLSF 276

Query: 320 EAIKNVFDVAAKYGLVVIADEVYQDNIFPGSEFHSMKKILRILQKEVPN-KYDNIQLASL 378
           + I  +  +AAKYG+VV+ADEVYQ+NI+ G +FHSMKK+LR LQ++ PN +YDN+QLAS+
Sbjct: 277 DTIAQILTIAAKYGIVVLADEVYQNNIYKGVKFHSMKKVLRSLQRDHPNGEYDNVQLASM 336

Query: 379 HSCSKGLLGECGHRGGYCEFIGFTPEVKQVITKLSSISLCSSVIGQALVDLMCCPPKKGE 438
           HS SKG+ GECG RGGY E +GF+ EV+QVI KL+SIS+CS V GQALVDLM  PP++G+
Sbjct: 337 HSTSKGVSGECGQRGGYMELVGFSNEVRQVILKLASISICSVVTGQALVDLMLNPPREGD 396

Query: 439 PSYELDQHERQTIRTNHKKRSNKLYEMFNSLEGVTCQKPQGAMYMFPNIQLPFNAIKMAQ 498
            SYELD  ER+ I  N K R   LY+ F  LEG+ CQ+PQGAMY+FP + L   AI+ A+
Sbjct: 397 DSYELDVRERKEIHNNMKTRGYLLYDTFQKLEGIECQEPQGAMYLFPKLLLSKKAIEEAK 456

Query: 499 NLDITPDEFYCRELLKATGICTVPGSGFGQQPGTYHVRTTFLAPGVEWMKRWEKFHIEFF 558
           +L + PDEFYC  LL  TGICTVPGSGFGQ+ GTYHVRTTFLAPG +W+K WE FH  F+
Sbjct: 457 SLGLQPDEFYCHRLLDTTGICTVPGSGFGQKEGTYHVRTTFLAPGTQWIKDWETFHKAFY 516

Query: 559 EKYR 562
           +KYR
Sbjct: 517 DKYR 520

>Skud_4.372 Chr4 complement(649872..651395) [1524 bp, 507 aa] {ON}
           YDR111C (REAL)
          Length = 507

 Score =  607 bits (1565), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/485 (59%), Positives = 367/485 (75%), Gaps = 4/485 (0%)

Query: 81  AERLEPEDLNPNVVKAKYAVRGAIPSYADKLKIQLLKHPGTLPFESVINSNIGNPQQLGQ 140
           A ++  +DLN +V KA+YAVRG+IP+ AD+LK +L K+PG LPF+ +IN+NIGNPQQL Q
Sbjct: 23  AAKITKKDLNGSVTKAEYAVRGSIPTRADELKEELKKNPGLLPFDDIINANIGNPQQLDQ 82

Query: 141 KPLSFGRQVLSILEYPALL--DHERTLVDSMGYAPDSIERAKTLLTDIG-SIGAYSNSQG 197
           KPL+F RQVLSILEYP +L  DHE+ L     ++ D+++RA+ LL DIG S+GAYS+SQG
Sbjct: 83  KPLTFTRQVLSILEYPEILQVDHEK-LASLNLFSKDALKRAECLLKDIGGSVGAYSHSQG 141

Query: 198 VHGIRQTVADFITNRDDGEVAYPDDIFLTAGASSAVSTILSILCKGQQTGVLIPIPQYPX 257
           V GIRQTVADFIT RD GE A P+DI+LT GASSA +++LS+LCK  +TG+LIPIPQYP 
Sbjct: 142 VPGIRQTVADFITARDGGEPATPEDIYLTTGASSAATSLLSLLCKDTRTGLLIPIPQYPL 201

Query: 258 XXXXXXXXXXXXXPYYLDESNGWSTDINEISKVAQDSLEAGIKPTCLVVINPGNPTGSVL 317
                        PYYLDE   WST+ +EI KV QD+LE GI+P+ L+VINPGNPTG+VL
Sbjct: 202 YTASASLFNAQVLPYYLDEECNWSTESDEIEKVVQDALEKGIRPSVLIVINPGNPTGAVL 261

Query: 318 TVEAIKNVFDVAAKYGLVVIADEVYQDNIFPGSEFHSMKKILRILQKEVPNKYDNIQLAS 377
           T E I  +  +AAKYG+ VI+DEVYQ+N+F   +FHSMKK+LR LQ   P K+DN+QLAS
Sbjct: 262 TEETIARICLIAAKYGIAVISDEVYQENVFNDFKFHSMKKVLRKLQHCYPGKFDNVQLAS 321

Query: 378 LHSCSKGLLGECGHRGGYCEFIGFTPEVKQVITKLSSISLCSSVIGQALVDLMCCPPKKG 437
           LHS SKG +GECG RGGY E +GF+ +++  + KL SIS+CS V GQA+VDLM  PP+ G
Sbjct: 322 LHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKLMSISICSVVTGQAIVDLMVNPPQPG 381

Query: 438 EPSYELDQHERQTIRTNHKKRSNKLYEMFNSLEGVTCQKPQGAMYMFPNIQLPFNAIKMA 497
           + SYE D+ ER  I    + R+N LYE FN LEG+ CQ PQGAMY+FP + LP  A + +
Sbjct: 382 DESYEQDRQERSKIFNEMRTRANLLYETFNGLEGIECQNPQGAMYLFPRLILPDKAFRES 441

Query: 498 QNLDITPDEFYCRELLKATGICTVPGSGFGQQPGTYHVRTTFLAPGVEWMKRWEKFHIEF 557
           + L + PDEFYC  LL++TGICTVPGSGFGQ+PGTYHVRTTFLAPG +W++ W+ FH  F
Sbjct: 442 ERLGVEPDEFYCASLLESTGICTVPGSGFGQKPGTYHVRTTFLAPGTQWIQNWKNFHQSF 501

Query: 558 FEKYR 562
           F +YR
Sbjct: 502 FNEYR 506

>KAFR0B05530 Chr2 (1132895..1134439) [1545 bp, 514 aa] {ON} 
          Length = 514

 Score =  606 bits (1562), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/485 (59%), Positives = 371/485 (76%), Gaps = 4/485 (0%)

Query: 81  AERLEPEDLNPNVVKAKYAVRGAIPSYADKLKIQLLKHPGT--LPFESVINSNIGNPQQL 138
           A+++  +DLN NV+K++YAVRG+IP  A++L+ +LL +  +  L FE+++++NIGNPQQL
Sbjct: 31  AKKITLDDLNQNVLKSEYAVRGSIPRRAEELEFELLNNDSSDSLAFENIVHANIGNPQQL 90

Query: 139 GQKPLSFGRQVLSILEYPALLDHERTLVDSMGYAPDSIERAKTLLTDIG-SIGAYSNSQG 197
            QKPL+F RQV+SIL+YP LL+    LV +  +  D++ERA+TLL  IG S+GAYS+SQG
Sbjct: 91  DQKPLTFSRQVISILQYPELLNQRNILVSTGIFKSDAMERAETLLCHIGGSVGAYSSSQG 150

Query: 198 VHGIRQTVADFITNRDDGEVAYPDDIFLTAGASSAVSTILSILCKGQQTGVLIPIPQYPX 257
           V+GIR+TVA++IT RD+GE A PDDIFLT GAS A S +LS+LCK + TGVLIPIPQYP 
Sbjct: 151 VYGIRETVANYITARDNGETASPDDIFLTEGASKAASYLLSLLCKDKNTGVLIPIPQYPL 210

Query: 258 XXXXXXXXXXXXXPYYLDESNGWSTDINEISKVAQDSLEAGIKPTCLVVINPGNPTGSVL 317
                        PYYL+E +GWST+ NEI KV  D++   +KP+ +VVINPGNPTGSVL
Sbjct: 211 YTATITLCDAKMLPYYLNEESGWSTNTNEIEKVVLDAIADNVKPSVMVVINPGNPTGSVL 270

Query: 318 TVEAIKNVFDVAAKYGLVVIADEVYQDNIFPGSEFHSMKKILRILQKEVPNKYDNIQLAS 377
           + + I ++ ++ AKYG+V+IADEVYQ+NIF G EFHSMKK+LR LQK+ P KYD +QLAS
Sbjct: 271 SKDDIIHIINIGAKYGIVLIADEVYQENIFDG-EFHSMKKVLRSLQKQYPGKYDAVQLAS 329

Query: 378 LHSCSKGLLGECGHRGGYCEFIGFTPEVKQVITKLSSISLCSSVIGQALVDLMCCPPKKG 437
           LHS SKG+ GECG RGGY E +GF  E++Q I KL+SISLCS + GQALVDLM  PPKKG
Sbjct: 330 LHSTSKGVSGECGQRGGYMELVGFKDEIRQAILKLASISLCSVITGQALVDLMVNPPKKG 389

Query: 438 EPSYELDQHERQTIRTNHKKRSNKLYEMFNSLEGVTCQKPQGAMYMFPNIQLPFNAIKMA 497
           + SYELD  ER+ I    K+R+ KLY +F  L+GV CQKPQGAMY+FP +  P   I  A
Sbjct: 390 DESYELDNFERKNIHETLKERAEKLYNLFCQLKGVECQKPQGAMYLFPKLHFPQTLITEA 449

Query: 498 QNLDITPDEFYCRELLKATGICTVPGSGFGQQPGTYHVRTTFLAPGVEWMKRWEKFHIEF 557
            N +++PDEFYC  LL+ATGICTVPGSGFGQ+ GTYH+RTTFLAPG +W ++W+ FH EF
Sbjct: 450 INQNMSPDEFYCHALLEATGICTVPGSGFGQKEGTYHLRTTFLAPGNQWTEKWKLFHEEF 509

Query: 558 FEKYR 562
           F KY+
Sbjct: 510 FSKYQ 514

>KLTH0G13662g Chr7 (1169989..1171548) [1560 bp, 519 aa] {ON} similar
           to uniprot|P52893 Saccharomyces cerevisiae YLR089C ALT1
           putative alanine transaminase (glutamyc pyruvic
           transaminase)
          Length = 519

 Score =  603 bits (1555), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/476 (60%), Positives = 361/476 (75%), Gaps = 2/476 (0%)

Query: 88  DLNPNVVKAKYAVRGAIPSYADKLKIQLLKHPGTLPFESVINSNIGNPQQLGQKPLSFGR 147
           D+N  V+ AKYAVRG IP  A++L+ +L++ PG+LPF  +IN+NIGNPQQL QKPL+F R
Sbjct: 44  DVNQCVLNAKYAVRGPIPLRAEELRHKLVEEPGSLPFNKIINANIGNPQQLDQKPLTFYR 103

Query: 148 QVLSILEYPALLDHERTLVDSMGYAPDSIERAKTLLTDIG-SIGAYSNSQGVHGIRQTVA 206
           QVLS+L+ PAL++   T      + PD++ERAK +L  +G S+GAYS SQGV G RQ+VA
Sbjct: 104 QVLSLLQNPALIESLPTGELHKLFKPDAVERAKKMLKQVGGSVGAYSASQGVAGFRQSVA 163

Query: 207 DFITNRDDGEVAYPDDIFLTAGASSAVSTILSILCKGQQTGVLIPIPQYPXXXXXXXXXX 266
           +FI  RD GE A  +DIFLTAGASSAVS ILS+ C G + G LIPIPQYP          
Sbjct: 164 EFIEERD-GEPASANDIFLTAGASSAVSAILSMFCTGSENGALIPIPQYPLYTATLALND 222

Query: 267 XXXXPYYLDESNGWSTDINEISKVAQDSLEAGIKPTCLVVINPGNPTGSVLTVEAIKNVF 326
               PYYLDE++GWS D  ++ +V +D++  G++PTCLVVINPGNPTG++L+ EAI+ + 
Sbjct: 223 AHALPYYLDEASGWSMDTEQVEQVVKDAIRKGVRPTCLVVINPGNPTGAILSPEAIEKIL 282

Query: 327 DVAAKYGLVVIADEVYQDNIFPGSEFHSMKKILRILQKEVPNKYDNIQLASLHSCSKGLL 386
            VAAKY LVVIADEVYQ+N F  ++F SMKK+LR+LQK  P KYDN+QLASLHS SKG+ 
Sbjct: 283 TVAAKYSLVVIADEVYQENGFDDADFVSMKKVLRVLQKTEPGKYDNVQLASLHSTSKGVS 342

Query: 387 GECGHRGGYCEFIGFTPEVKQVITKLSSISLCSSVIGQALVDLMCCPPKKGEPSYELDQH 446
           GECG RGGY E +GF+ EVKQV  KL+SISLC  V GQALVDLM  PPKKG+ SYELD+ 
Sbjct: 343 GECGQRGGYMELVGFSEEVKQVFLKLASISLCPVVTGQALVDLMVRPPKKGDASYELDRQ 402

Query: 447 ERQTIRTNHKKRSNKLYEMFNSLEGVTCQKPQGAMYMFPNIQLPFNAIKMAQNLDITPDE 506
           ER  I  +  ++S  LYE F SLEGV+CQKPQGAMY+FP + L   AI+ A++L + PDE
Sbjct: 403 ERNAIHNSLHQKSTLLYETFQSLEGVSCQKPQGAMYLFPKLDLSRKAIRKAESLGMAPDE 462

Query: 507 FYCRELLKATGICTVPGSGFGQQPGTYHVRTTFLAPGVEWMKRWEKFHIEFFEKYR 562
           +YC+ELL+ATGICTVPGSGF Q PGTYH+RTTFLAPG EW+  W+KFH +F +++R
Sbjct: 463 YYCKELLEATGICTVPGSGFRQVPGTYHLRTTFLAPGTEWVDSWKKFHQKFVDEHR 518

>Smik_4.357 Chr4 complement(639561..641084) [1524 bp, 507 aa] {ON}
           YDR111C (REAL)
          Length = 507

 Score =  600 bits (1546), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/484 (58%), Positives = 364/484 (75%), Gaps = 2/484 (0%)

Query: 81  AERLEPEDLNPNVVKAKYAVRGAIPSYADKLKIQLLKHPGTLPFESVINSNIGNPQQLGQ 140
           A ++  +DLN  V KA+YAVRGAIP+ AD+LK +L + PG LPF+ +IN+NIGNPQQL Q
Sbjct: 23  AAKITKKDLNAGVTKAEYAVRGAIPTRADELKEELKRKPGVLPFDDIINANIGNPQQLDQ 82

Query: 141 KPLSFGRQVLSILEYPALLDHERTLVDSMG-YAPDSIERAKTLLTDIG-SIGAYSNSQGV 198
           KPL+F RQVLSILEYP +L      + S+  +  D++ RA+ LL DIG SIGAYS+SQGV
Sbjct: 83  KPLTFTRQVLSILEYPEILRVGPDKLASLNLFRKDALGRAEHLLEDIGGSIGAYSHSQGV 142

Query: 199 HGIRQTVADFITNRDDGEVAYPDDIFLTAGASSAVSTILSILCKGQQTGVLIPIPQYPXX 258
            GIRQ+VA+FIT RDDGE A P++I+LT GASSA +++LS+LCK  QTG+LIPIPQYP  
Sbjct: 143 PGIRQSVAEFITKRDDGEPAAPENIYLTTGASSAATSLLSLLCKDVQTGLLIPIPQYPLY 202

Query: 259 XXXXXXXXXXXXPYYLDESNGWSTDINEISKVAQDSLEAGIKPTCLVVINPGNPTGSVLT 318
                       PYYLDE + WST  +EI KV +D+LE GIKP+ L+VINPGNPTG+VL+
Sbjct: 203 TASASLFNAQVLPYYLDEGSNWSTKSDEIEKVVKDALEKGIKPSVLIVINPGNPTGAVLS 262

Query: 319 VEAIKNVFDVAAKYGLVVIADEVYQDNIFPGSEFHSMKKILRILQKEVPNKYDNIQLASL 378
            + I  +  +AAKYG+ +I+DEVYQ+N+F G +FHSMKK+LR LQ+  P K+DN+QLASL
Sbjct: 263 EDTIAKICLIAAKYGIAIISDEVYQENVFNGVKFHSMKKVLRKLQRLYPGKFDNVQLASL 322

Query: 379 HSCSKGLLGECGHRGGYCEFIGFTPEVKQVITKLSSISLCSSVIGQALVDLMCCPPKKGE 438
           HS SKG +GECG RGGY E +GF+ +++  + KL SIS+CS V GQA+VDLM  PP+ G+
Sbjct: 323 HSISKGFMGECGQRGGYMEVVGFSKDIRDALFKLMSISICSVVTGQAVVDLMVKPPQPGD 382

Query: 439 PSYELDQHERQTIRTNHKKRSNKLYEMFNSLEGVTCQKPQGAMYMFPNIQLPFNAIKMAQ 498
            SY+ D  ER  I      R+  L+E FN LEG+ CQKPQGAMY+FP + LP  A++ ++
Sbjct: 383 ESYDQDHSERMKIFHEMYTRATLLHETFNELEGIECQKPQGAMYLFPRLVLPEKALRESE 442

Query: 499 NLDITPDEFYCRELLKATGICTVPGSGFGQQPGTYHVRTTFLAPGVEWMKRWEKFHIEFF 558
            L I PDEFYC  LL++TGICTVPGSGFGQQPGTYHVRTTFLAPG +W++ W+ FH +FF
Sbjct: 443 RLGIEPDEFYCTSLLESTGICTVPGSGFGQQPGTYHVRTTFLAPGTQWIQDWKHFHQDFF 502

Query: 559 EKYR 562
            KYR
Sbjct: 503 NKYR 506

>YDR111C Chr4 complement(678241..679764) [1524 bp, 507 aa] {ON}
           ALT2Putative alanine transaminase (glutamic pyruvic
           transaminase)
          Length = 507

 Score =  598 bits (1542), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/484 (59%), Positives = 363/484 (75%), Gaps = 2/484 (0%)

Query: 81  AERLEPEDLNPNVVKAKYAVRGAIPSYADKLKIQLLKHPGTLPFESVINSNIGNPQQLGQ 140
           A ++  +DLN  V KA+YAVRGAIP+ AD+LK +L K+P  LPF+ +IN+NIGNPQQL Q
Sbjct: 23  AGKITKKDLNTGVTKAEYAVRGAIPTRADELKEELKKNPEVLPFDDIINANIGNPQQLDQ 82

Query: 141 KPLSFGRQVLSILEYPALLDHERTLVDSMG-YAPDSIERAKTLLTDIG-SIGAYSNSQGV 198
           KPL+F RQVL+ILEYP +L      + S+  ++ D++ERA+ LL DIG SIGAYS+SQGV
Sbjct: 83  KPLTFTRQVLAILEYPEILRVGHNELASLNLFSRDALERAERLLNDIGGSIGAYSHSQGV 142

Query: 199 HGIRQTVADFITNRDDGEVAYPDDIFLTAGASSAVSTILSILCKGQQTGVLIPIPQYPXX 258
            GIRQTVADFIT RD GE A P+DI+LT GASSA +++LS+LCK  QTG+LIPIPQYP  
Sbjct: 143 PGIRQTVADFITRRDGGEPATPEDIYLTTGASSAATSLLSLLCKDSQTGLLIPIPQYPLY 202

Query: 259 XXXXXXXXXXXXPYYLDESNGWSTDINEISKVAQDSLEAGIKPTCLVVINPGNPTGSVLT 318
                       PYYLDE + WST+ +EI KV QD+L+  I+P+ L+VINPGNPTG+VL+
Sbjct: 203 TASASLFNAQVLPYYLDEESNWSTNSDEIEKVVQDALKKQIRPSVLIVINPGNPTGAVLS 262

Query: 319 VEAIKNVFDVAAKYGLVVIADEVYQDNIFPGSEFHSMKKILRILQKEVPNKYDNIQLASL 378
            E I  +  +AAKYG+ +I+DEVYQ+NIF   +FHSMKK+LR LQ   P K+DN+QLASL
Sbjct: 263 EETIARICLIAAKYGITIISDEVYQENIFNDVKFHSMKKVLRKLQHLYPGKFDNVQLASL 322

Query: 379 HSCSKGLLGECGHRGGYCEFIGFTPEVKQVITKLSSISLCSSVIGQALVDLMCCPPKKGE 438
           HS SKG + ECG RGGY E IGF+ E++  + KL SIS+CS V GQA+VDLM  PP+ G+
Sbjct: 323 HSISKGFMDECGQRGGYMEIIGFSQEIRDALFKLMSISICSVVTGQAVVDLMVKPPQPGD 382

Query: 439 PSYELDQHERQTIRTNHKKRSNKLYEMFNSLEGVTCQKPQGAMYMFPNIQLPFNAIKMAQ 498
            SYE D  ER  I    + R+N LYE F  LEG+ CQKPQGAMY+FP + LP  A+  ++
Sbjct: 383 ESYEQDHDERLKIFHEMRTRANLLYETFKELEGIECQKPQGAMYLFPRLVLPKKALCESE 442

Query: 499 NLDITPDEFYCRELLKATGICTVPGSGFGQQPGTYHVRTTFLAPGVEWMKRWEKFHIEFF 558
            L I PDEFYC  LL++TGICTVPGSGFGQ+PGTYHVRTTFLAPG +W++ W++FH +FF
Sbjct: 443 RLGIEPDEFYCTSLLESTGICTVPGSGFGQRPGTYHVRTTFLAPGTKWIQDWKEFHQDFF 502

Query: 559 EKYR 562
            KYR
Sbjct: 503 SKYR 506

>Kwal_56.23791 s56 (706946..708502) [1557 bp, 518 aa] {ON} YLR089C -
           Hypothetical ORF [contig 173] FULL
          Length = 518

 Score =  592 bits (1526), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/477 (59%), Positives = 355/477 (74%), Gaps = 2/477 (0%)

Query: 87  EDLNPNVVKAKYAVRGAIPSYADKLKIQLLKHPGTLPFESVINSNIGNPQQLGQKPLSFG 146
           +D+N  V+ AKYAVRG IP  A++LK +LL+ PG+LPF+ +IN+NIGNPQQL QKPL+F 
Sbjct: 42  QDINECVLNAKYAVRGLIPLRAEELKQKLLEEPGSLPFDKIINANIGNPQQLDQKPLTFY 101

Query: 147 RQVLSILEYPALLDHERTLVDSMGYAPDSIERAKTLLTDIG-SIGAYSNSQGVHGIRQTV 205
           RQVL++L+ P L+    +      + PD++ERAK +L  +G S+GAYSNSQGV G R++V
Sbjct: 102 RQVLALLQNPDLISDLSSGELHKFFKPDAVERAKKMLKQVGGSVGAYSNSQGVAGFRESV 161

Query: 206 ADFITNRDDGEVAYPDDIFLTAGASSAVSTILSILCKGQQTGVLIPIPQYPXXXXXXXXX 265
           A+FI  RD GE A   DIFLT GAS AVS ILS+ C G + G LIPIPQYP         
Sbjct: 162 AEFIEERD-GEPASAQDIFLTTGASGAVSYILSLFCNGPENGALIPIPQYPLYTASLALN 220

Query: 266 XXXXXPYYLDESNGWSTDINEISKVAQDSLEAGIKPTCLVVINPGNPTGSVLTVEAIKNV 325
                PYYLDE +GWS D  +I KV QDS++ GI+PTCLVVINPGNPTG++L  + I+NV
Sbjct: 221 NSHALPYYLDEESGWSMDTEQIEKVVQDSIKKGIRPTCLVVINPGNPTGALLNTDTIENV 280

Query: 326 FDVAAKYGLVVIADEVYQDNIFPGSEFHSMKKILRILQKEVPNKYDNIQLASLHSCSKGL 385
             VAAKY +V+IADEVYQ+N F  +EF SMKK+LR+LQK  P KYDN+QLASLHS SKG+
Sbjct: 281 IKVAAKYSMVIIADEVYQENGFNDAEFVSMKKVLRVLQKTEPGKYDNVQLASLHSTSKGV 340

Query: 386 LGECGHRGGYCEFIGFTPEVKQVITKLSSISLCSSVIGQALVDLMCCPPKKGEPSYELDQ 445
            GECG RGGY E +GF+ EVKQV  KL+SISLC  V GQAL+DLM  PPKKG+ SYE D+
Sbjct: 341 SGECGQRGGYMELVGFSEEVKQVFLKLASISLCPVVTGQALIDLMVRPPKKGDASYEQDR 400

Query: 446 HERQTIRTNHKKRSNKLYEMFNSLEGVTCQKPQGAMYMFPNIQLPFNAIKMAQNLDITPD 505
            ER  I     KRS  LY+ F S+EGV+CQ+PQGAMY+FP ++L   AI  A++  + PD
Sbjct: 401 QERCDIHDALHKRSGLLYQAFQSMEGVSCQEPQGAMYLFPKLELSNKAIHKAESAGLAPD 460

Query: 506 EFYCRELLKATGICTVPGSGFGQQPGTYHVRTTFLAPGVEWMKRWEKFHIEFFEKYR 562
           E+YC+ELL+ATGICTVPGSGFGQ PGT+H+RTTFLAPG EW+  W+KFH +F E +R
Sbjct: 461 EYYCKELLEATGICTVPGSGFGQVPGTFHLRTTFLAPGTEWIDSWKKFHEKFTEDHR 517

>Suva_2.271 Chr2 complement(472714..474237) [1524 bp, 507 aa] {ON}
           YDR111C (REAL)
          Length = 507

 Score =  589 bits (1519), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/485 (58%), Positives = 361/485 (74%), Gaps = 4/485 (0%)

Query: 81  AERLEPEDLNPNVVKAKYAVRGAIPSYADKLKIQLLKHPGTLPFESVINSNIGNPQQLGQ 140
           A +L  +DLN +V KA+YAVRGAIP+ A++LK +L +   +LPF S+IN+NIGNPQQL Q
Sbjct: 23  AAKLTKKDLNASVTKAEYAVRGAIPTRAEELKEELKRSSNSLPFNSIINANIGNPQQLDQ 82

Query: 141 KPLSFGRQVLSILEYPALL--DHERTLVDSMGYAPDSIERAKTLLTDIG-SIGAYSNSQG 197
           KPL+F RQVLSILEYP +L  DH++ L     +A D+++RA+ LL DIG S+GAYS+SQG
Sbjct: 83  KPLTFTRQVLSILEYPEILRVDHDK-LASLNLFAKDALKRAQRLLDDIGGSVGAYSHSQG 141

Query: 198 VHGIRQTVADFITNRDDGEVAYPDDIFLTAGASSAVSTILSILCKGQQTGVLIPIPQYPX 257
           V GIRQTVADFIT RD GE A P+DI+LT GASSA +++LS+LCK  QTG+L+PIPQYP 
Sbjct: 142 VPGIRQTVADFITERDGGEPAGPEDIYLTTGASSAATSLLSLLCKDSQTGLLLPIPQYPL 201

Query: 258 XXXXXXXXXXXXXPYYLDESNGWSTDINEISKVAQDSLEAGIKPTCLVVINPGNPTGSVL 317
                        PYYLDE   WST+ +EI +V  D+L+ GI+P+ LVVINPGNPTG+VL
Sbjct: 202 YTASASLYNAQVLPYYLDEEADWSTESDEIERVVLDALKKGIRPSVLVVINPGNPTGAVL 261

Query: 318 TVEAIKNVFDVAAKYGLVVIADEVYQDNIFPGSEFHSMKKILRILQKEVPNKYDNIQLAS 377
           T   I  +  +AAKYG+ +I+DEVYQ+NIF   +FHSMKKILR LQ   P K+DN+QLAS
Sbjct: 262 TENTIAKICLIAAKYGITIISDEVYQENIFGDVKFHSMKKILRKLQNLHPGKFDNVQLAS 321

Query: 378 LHSCSKGLLGECGHRGGYCEFIGFTPEVKQVITKLSSISLCSSVIGQALVDLMCCPPKKG 437
           LHS SKG +GECG RGGY E +GF+ +++  + KL SIS+CS   GQA++DLM  PP+ G
Sbjct: 322 LHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKLMSISICSVATGQAIIDLMVKPPQPG 381

Query: 438 EPSYELDQHERQTIRTNHKKRSNKLYEMFNSLEGVTCQKPQGAMYMFPNIQLPFNAIKMA 497
           + SY+ D+ ER  I      R+N LYE FN LEG+ CQKPQGAMY+FP + LP  A++ +
Sbjct: 382 DESYDQDRKERLKIYNEMLTRANLLYETFNELEGIKCQKPQGAMYLFPKLFLPEKALRES 441

Query: 498 QNLDITPDEFYCRELLKATGICTVPGSGFGQQPGTYHVRTTFLAPGVEWMKRWEKFHIEF 557
           + L+I PD  YC  LL++TGICTVPGSGFGQ+ GTYHVRTTFL PG +W++ W +FH +F
Sbjct: 442 ERLNIEPDVLYCTSLLESTGICTVPGSGFGQKSGTYHVRTTFLPPGTQWIQDWRQFHQDF 501

Query: 558 FEKYR 562
           F KYR
Sbjct: 502 FNKYR 506

>Kpol_543.39 s543 complement(86358..87836) [1479 bp, 492 aa] {ON}
           complement(86358..87836) [1479 nt, 493 aa]
          Length = 492

 Score =  586 bits (1511), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/486 (57%), Positives = 355/486 (73%), Gaps = 5/486 (1%)

Query: 81  AERLEPEDLNPNVVKAKYAVRGAIPSYADKLKIQLLKHPGTLPFESVINSNIGNPQQLGQ 140
           AE+L   DLN + V A YAVRG+IP  A++L  Q++  PG+LPF+ +I +NIGNPQQ+GQ
Sbjct: 6   AEKLSVNDLNQHAVHADYAVRGSIPMRAEQLHAQIINDPGSLPFDKIITANIGNPQQVGQ 65

Query: 141 KPLSFGRQVLSILEYPALLDHER---TLVDSMGYAPDSIERAKTLLTDIG-SIGAYSNSQ 196
           KPL+F RQVLSILEYP +L+       LV    Y  D IERA+ +L  IG S+GAYS SQ
Sbjct: 66  KPLTFIRQVLSILEYPNILNDPELLEKLVQLGVYQRDVIERARKMLDSIGGSVGAYSASQ 125

Query: 197 GVHGIRQTVADFITNRDD-GEVAYPDDIFLTAGASSAVSTILSILCKGQQTGVLIPIPQY 255
           GV G RQTVADFI  RD   ++A P+DIFLT GASSAV  +LSILC G + GVLIPIPQY
Sbjct: 126 GVLGFRQTVADFINKRDGCKQLASPNDIFLTGGASSAVHYLLSILCSGPEFGVLIPIPQY 185

Query: 256 PXXXXXXXXXXXXXXPYYLDESNGWSTDINEISKVAQDSLEAGIKPTCLVVINPGNPTGS 315
           P              PYYL E   WST+  EI    ++S+  G+KP  +V+INPGNPTG+
Sbjct: 186 PLYTATLTLSNSTAIPYYLKEHTSWSTNTKEIEINIKESMANGVKPVAIVIINPGNPTGA 245

Query: 316 VLTVEAIKNVFDVAAKYGLVVIADEVYQDNIFPGSEFHSMKKILRILQKEVPNKYDNIQL 375
           +L+   + ++  ++AKYG+ +IADEVYQ+NIFPG EFHSM+K+L  LQ E P  YDN+QL
Sbjct: 246 ILSESDLADIIRISAKYGIAIIADEVYQENIFPGFEFHSMRKVLLNLQSEFPGTYDNVQL 305

Query: 376 ASLHSCSKGLLGECGHRGGYCEFIGFTPEVKQVITKLSSISLCSSVIGQALVDLMCCPPK 435
           ASLHS SKG +GECG RGGY E IGF  EV  ++ KL+SIS+CS V GQAL+DL+ CPP+
Sbjct: 306 ASLHSTSKGFIGECGQRGGYMELIGFKDEVIAIVLKLASISICSVVTGQALMDLVTCPPQ 365

Query: 436 KGEPSYELDQHERQTIRTNHKKRSNKLYEMFNSLEGVTCQKPQGAMYMFPNIQLPFNAIK 495
            G+ SY+LDQ ER  I+ +   R+++LY +F SLEGV CQ+PQGAMY+FP + LP  AI+
Sbjct: 366 PGDASYKLDQEERNKIKQDLMFRADRLYGLFTSLEGVECQRPQGAMYLFPKLILPDKAIE 425

Query: 496 MAQNLDITPDEFYCRELLKATGICTVPGSGFGQQPGTYHVRTTFLAPGVEWMKRWEKFHI 555
            A  L+I PDE+YCRELL ATGICTVPGSGFGQ PGTYH+RTTFL PG EW++RW +FH 
Sbjct: 426 KALQLEIPPDEYYCRELLDATGICTVPGSGFGQDPGTYHLRTTFLVPGTEWIERWREFHQ 485

Query: 556 EFFEKY 561
           +F+E++
Sbjct: 486 QFYERF 491

>Ecym_4307 Chr4 (652209..653813) [1605 bp, 534 aa] {ON} similar to
           Ashbya gossypii AGR085W
          Length = 534

 Score =  586 bits (1511), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/495 (56%), Positives = 371/495 (74%), Gaps = 3/495 (0%)

Query: 69  LSYSTSREKSYFAERLEPEDLNPNVVKAKYAVRGAIPSYADKLKIQLLKHPGTLPFESVI 128
           +S  TSR +    + L+ EDLN NV++AKYAVRG IP+ A +L+ QL + P +LPF+ +I
Sbjct: 41  ISSGTSRIRFEPGDPLKLEDLNSNVLEAKYAVRGKIPARAMELERQLSRDPDSLPFKKII 100

Query: 129 NSNIGNPQQLGQKPLSFGRQVLSILEYPALLDHERTLVDSMGYAPDSIERAKTLLTDI-G 187
            +NIGNPQQLGQKPLSF R+VLS+LE P LL     +++ + Y PD++ RAK ++ D+  
Sbjct: 101 YANIGNPQQLGQKPLSFSREVLSLLESPNLLQMPMEVLNLI-YKPDAVRRAKRMMRDLQT 159

Query: 188 SIGAYSNSQGVHGIRQTVADFITNRDDGEVAYPDDIFLTAGASSAVSTILSILCKGQQTG 247
           SIGAYS+SQGV G R+TVA+++++RD GE A  +DIFLT GAS+  S ++ +LCKGQ++G
Sbjct: 160 SIGAYSHSQGVLGFRKTVAEYLSSRD-GEPASAEDIFLTTGASNGASLMIELLCKGQESG 218

Query: 248 VLIPIPQYPXXXXXXXXXXXXXXPYYLDESNGWSTDINEISKVAQDSLEAGIKPTCLVVI 307
           VLIPIPQYP              PYYLDE +GWS +I+++ ++  +S+E G+KP CLVVI
Sbjct: 219 VLIPIPQYPLYTATITLNNTVALPYYLDEESGWSLNIDDLERIIIESIEKGVKPACLVVI 278

Query: 308 NPGNPTGSVLTVEAIKNVFDVAAKYGLVVIADEVYQDNIFPGSEFHSMKKILRILQKEVP 367
           NPGNPTG++L VE+++ +F +AAKY +VVIADEVYQ+N+F G +F+SMKK+LR LQ+   
Sbjct: 279 NPGNPTGAILPVESMERIFVIAAKYSIVVIADEVYQENVFEGLKFYSMKKVLRSLQRRYK 338

Query: 368 NKYDNIQLASLHSCSKGLLGECGHRGGYCEFIGFTPEVKQVITKLSSISLCSSVIGQALV 427
             + N+QL SLHS SKGL GECG RGGY E +GF+ ++++VI K++SI LCS V GQALV
Sbjct: 339 ELFSNVQLVSLHSTSKGLSGECGQRGGYMELVGFSDDIREVILKMASIQLCSPVGGQALV 398

Query: 428 DLMCCPPKKGEPSYELDQHERQTIRTNHKKRSNKLYEMFNSLEGVTCQKPQGAMYMFPNI 487
           DLM   PK G+ SYE D  ER +IR   ++RS  L+E FN+LEGV C+KPQG+MY+FP +
Sbjct: 399 DLMLSRPKPGDESYERDLSERSSIRNALQERSKSLWETFNNLEGVECRKPQGSMYLFPRL 458

Query: 488 QLPFNAIKMAQNLDITPDEFYCRELLKATGICTVPGSGFGQQPGTYHVRTTFLAPGVEWM 547
            LP  AIK A++LD+ PDEFYC ELL +TGICTVPGSGFGQ P T H+RTTFL PG EW+
Sbjct: 459 VLPQKAIKAAESLDMQPDEFYCTELLNSTGICTVPGSGFGQAPDTCHLRTTFLCPGTEWI 518

Query: 548 KRWEKFHIEFFEKYR 562
           + WE FH  F++KYR
Sbjct: 519 ESWELFHKSFYDKYR 533

>TPHA0A01800 Chr1 (364262..365758) [1497 bp, 498 aa] {ON} Anc_8.263
           YDR111C
          Length = 498

 Score =  582 bits (1500), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/480 (57%), Positives = 354/480 (73%), Gaps = 4/480 (0%)

Query: 87  EDLNPNVVKAKYAVRGAIPSYADKLKIQLLKHPGTLPFESVINSNIGNPQQLGQKPLSFG 146
           +DLN  ++K +YAVRG IP+ A++LK+QL K P +LPF  +IN+NIGNPQQLGQKPLSF 
Sbjct: 18  KDLNSKIIKTQYAVRGPIPARAEELKLQLEKDPKSLPFNKIINANIGNPQQLGQKPLSFI 77

Query: 147 RQVLSILEYPALLDHE---RTLVDSMGYAPDSIERAKTLLTDIG-SIGAYSNSQGVHGIR 202
           R+VLSIL+YP +L+ E   +TL++   Y  D + RA+ LL +IG S+GAYS SQGV GI+
Sbjct: 78  RKVLSILQYPDILEDESKLQTLIELRVYQKDVVRRARKLLGEIGGSVGAYSLSQGVPGIQ 137

Query: 203 QTVADFITNRDDGEVAYPDDIFLTAGASSAVSTILSILCKGQQTGVLIPIPQYPXXXXXX 262
           QTVAD+IT RD GEVAYP+DIFLT GASSAVS IL + C G  TGVLIPIPQYP      
Sbjct: 138 QTVADYITKRDSGEVAYPEDIFLTTGASSAVSFILPMFCNGPTTGVLIPIPQYPLYTATI 197

Query: 263 XXXXXXXXPYYLDESNGWSTDINEISKVAQDSLEAGIKPTCLVVINPGNPTGSVLTVEAI 322
                    YYL+E + WS +  E+    Q+S+++GIKPT +V+INPGNPTGS+LT + I
Sbjct: 198 TLVGATAISYYLNEEDNWSVNTVEMENTIQESIKSGIKPTTIVIINPGNPTGSILTEKDI 257

Query: 323 KNVFDVAAKYGLVVIADEVYQDNIFPGSEFHSMKKILRILQKEVPNKYDNIQLASLHSCS 382
            N+  ++AKYGL++IADEVYQ+N+F G+EFHS+KK+LR LQ++    Y+ +QLASLHS S
Sbjct: 258 ANIIRISAKYGLLIIADEVYQENVFSGNEFHSVKKVLRKLQRKYLGFYETVQLASLHSTS 317

Query: 383 KGLLGECGHRGGYCEFIGFTPEVKQVITKLSSISLCSSVIGQALVDLMCCPPKKGEPSYE 442
           KGL+GECG RGGY E IG T +V+  + KL SIS+CS V GQAL+D++  PP+ G+ SYE
Sbjct: 318 KGLIGECGQRGGYMELIGLTDDVRLEVVKLMSISICSVVTGQALIDMVVSPPRPGDESYE 377

Query: 443 LDQHERQTIRTNHKKRSNKLYEMFNSLEGVTCQKPQGAMYMFPNIQLPFNAIKMAQNLDI 502
           +DQ ER  I+ +   RS KL+++F SLEGV C +PQGAMY+FP    P   I +AQ L  
Sbjct: 378 MDQLERNNIKNDLISRSQKLHQLFISLEGVECLRPQGAMYLFPKFIFPQKFIDIAQKLHT 437

Query: 503 TPDEFYCRELLKATGICTVPGSGFGQQPGTYHVRTTFLAPGVEWMKRWEKFHIEFFEKYR 562
             D  YC+ELL+ TGICTVPGSGFGQ+P TYH+RTTFL PG  W+  W KFH EF E+YR
Sbjct: 438 EADTLYCKELLEHTGICTVPGSGFGQKPNTYHLRTTFLVPGDSWIDLWRKFHTEFCERYR 497

>NDAI0J01360 Chr10 (313791..315296) [1506 bp, 501 aa] {ON} Anc_8.263
          Length = 501

 Score =  581 bits (1498), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 272/485 (56%), Positives = 361/485 (74%), Gaps = 4/485 (0%)

Query: 81  AERLEPEDLNPNVVKAKYAVRGAIPSYADKLKIQLLKHPGTLPFESVINSNIGNPQQLGQ 140
           A +L  +DLNPNV+KA++AVRG IP  A +L+ QL K+P +LPF  +  +NIGNPQ+L Q
Sbjct: 16  APKLSIKDLNPNVIKAEFAVRGTIPMKAQELQTQLNKNPHSLPFNEITVANIGNPQELHQ 75

Query: 141 KPLSFGRQVLSILEYPALLDHERTLVDSMG--YAPDSIERAKTLLTDIG-SIGAYSNSQG 197
           KPL+F RQV+SIL+YP LL+    L  +    Y  DS +RA+ LL +IG S+GAYS SQG
Sbjct: 76  KPLTFARQVVSILQYPELLNRRNELTSTTPPIYNNDSFDRAEKLLNEIGGSVGAYSASQG 135

Query: 198 VHGIRQTVADFITNRDDGEVAYPDDIFLTAGASSAVSTILSILCKGQQTGVLIPIPQYPX 257
           V+GIR+T+A++IT RD GE A P+DIF+T GA++A S +LSIL  G QTGVL+PIPQYP 
Sbjct: 136 VYGIRKTIANYITQRDLGESASPNDIFMTTGATAASSYLLSILSNGPQTGVLLPIPQYPL 195

Query: 258 XXXXXXXXXXXXXPYYLDESNGWSTDINEISK-VAQDSLEAGIKPTCLVVINPGNPTGSV 316
                        PYYL+E +GWS D NEI K + ++++  GI+P  +V+INPGNPTGS+
Sbjct: 196 YTALLALHNATMLPYYLEEESGWSIDTNEIEKTIKKNAMTKGIQPKVMVIINPGNPTGSI 255

Query: 317 LTVEAIKNVFDVAAKYGLVVIADEVYQDNIFPGSEFHSMKKILRILQKEVPNKYDNIQLA 376
           L+ +++  +F++AAKYG+V+IADEVYQ+N+F G++FHS KK+LR LQK+ P +Y+N+QLA
Sbjct: 256 LSEDSLIKIFNIAAKYGIVIIADEVYQENLFNGNKFHSCKKVLRSLQKQFPTQYNNVQLA 315

Query: 377 SLHSCSKGLLGECGHRGGYCEFIGFTPEVKQVITKLSSISLCSSVIGQALVDLMCCPPKK 436
           SLHS SKGL GECG RGGY E IGF  +V+ +I KL+ I +C  V GQA++DLM  PPK+
Sbjct: 316 SLHSTSKGLFGECGQRGGYMEIIGFNNDVRNLILKLACIDVCPVVTGQAMMDLMILPPKQ 375

Query: 437 GEPSYELDQHERQTIRTNHKKRSNKLYEMFNSLEGVTCQKPQGAMYMFPNIQLPFNAIKM 496
           G+ SY+LD  ERQ I  +   R+ KLY+MF+ +EG+ CQKPQGAMY+FP + L    I  
Sbjct: 376 GDQSYQLDCIERQQIHNDMLNRAKKLYDMFSHMEGIQCQKPQGAMYLFPRLLLSTKVIDE 435

Query: 497 AQNLDITPDEFYCRELLKATGICTVPGSGFGQQPGTYHVRTTFLAPGVEWMKRWEKFHIE 556
           A+  ++ PDEFYC ELL  TGICTVPGSGFGQ+P TYH+RTTFLAPG +W+ +WEKFH  
Sbjct: 436 AKKFEMEPDEFYCHELLNETGICTVPGSGFGQKPNTYHLRTTFLAPGDQWINKWEKFHKA 495

Query: 557 FFEKY 561
           F ++Y
Sbjct: 496 FLKRY 500

>KAFR0B05520 Chr2 (1130297..1131829) [1533 bp, 510 aa] {ON}
           Anc_8.263 YDR111C
          Length = 510

 Score =  580 bits (1495), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/485 (57%), Positives = 359/485 (74%), Gaps = 4/485 (0%)

Query: 81  AERLEPEDLNPNVVKAKYAVRGAIPSYADKLKIQLLK--HPGTLPFESVINSNIGNPQQL 138
           A ++   DLN  ++ A+YAVRG+I   A++L+ +L     P + PFE +I +NIGNPQQL
Sbjct: 27  APKISVADLNQKIINAEYAVRGSIAMRAEELEFELYHKTQPHSFPFERIIYANIGNPQQL 86

Query: 139 GQKPLSFGRQVLSILEYPALLDHERTLVDSMGYAPDSIERAKTLLTDIG-SIGAYSNSQG 197
            QKPL+F RQV+SILEYP LL  +  L+    Y  D++ERA+ L + IG S+GAYS +QG
Sbjct: 87  DQKPLTFSRQVMSILEYPGLLKFKDVLLSQGIYKKDALERAELLQSQIGASVGAYSLAQG 146

Query: 198 VHGIRQTVADFITNRDDGEVAYPDDIFLTAGASSAVSTILSILCKGQQTGVLIPIPQYPX 257
           V+GIR+T A FI+ RD+ E A  DDIFLT GAS AV+ ++  LC+ + TG+LIPIPQYP 
Sbjct: 147 VYGIRETTARFISKRDNCEAASADDIFLTDGASKAVTYLMMALCQNEHTGILIPIPQYPL 206

Query: 258 XXXXXXXXXXXXXPYYLDESNGWSTDINEISKVAQDSLEAGIKPTCLVVINPGNPTGSVL 317
                        PYYLDE +GWST + EI     +++E GIKP+ +VVINPGNPTG+VL
Sbjct: 207 YTASICIHNAKMLPYYLDEESGWSTKVEEIENSVINAIENGIKPSAMVVINPGNPTGAVL 266

Query: 318 TVEAIKNVFDVAAKYGLVVIADEVYQDNIFPGSEFHSMKKILRILQKEVPNKYDNIQLAS 377
           +V+ I+ +  VAAKYG+V+IADEVYQDNIF G EFHSMKKILR LQK+ P KYDN+QLAS
Sbjct: 267 SVDVIQRIITVAAKYGIVLIADEVYQDNIFNG-EFHSMKKILRQLQKKYPGKYDNVQLAS 325

Query: 378 LHSCSKGLLGECGHRGGYCEFIGFTPEVKQVITKLSSISLCSSVIGQALVDLMCCPPKKG 437
           LHS SKG+ GECG RGGY E +GF+ EV+ ++ KL+SI++CS V GQALVDLM  PP  G
Sbjct: 326 LHSTSKGVSGECGQRGGYMEIVGFSDEVRHLLLKLASINICSVVTGQALVDLMVDPPHVG 385

Query: 438 EPSYELDQHERQTIRTNHKKRSNKLYEMFNSLEGVTCQKPQGAMYMFPNIQLPFNAIKMA 497
           + SYE DQ ER  I +  KKR++KLY+ F++LEG+ CQKPQGAMY+FP + LP  AI+ A
Sbjct: 386 DESYEKDQEERNEIHSTLKKRADKLYDTFSNLEGIECQKPQGAMYLFPRLILPDRAIEEA 445

Query: 498 QNLDITPDEFYCRELLKATGICTVPGSGFGQQPGTYHVRTTFLAPGVEWMKRWEKFHIEF 557
           + L +  DEFYC +LL+ TGICTVPGSGFGQ+ GTYHVRTTFL+PG EW+  W+KFH +F
Sbjct: 446 KKLQMEADEFYCHKLLENTGICTVPGSGFGQREGTYHVRTTFLSPGTEWIDDWKKFHEKF 505

Query: 558 FEKYR 562
            ++Y+
Sbjct: 506 MKEYQ 510

>AGR085W Chr7 (887023..888588) [1566 bp, 521 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR089C (ALT1) and
           YDR111C (ALT2)
          Length = 521

 Score =  557 bits (1435), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/494 (56%), Positives = 357/494 (72%), Gaps = 5/494 (1%)

Query: 72  STSREKSYF--AERLEPEDLNPNVVKAKYAVRGAIPSYADKLKIQLLKHPGTLPFESVIN 129
           S+ ++ S F  AE +   D+N NVVKAKYAVRG IP+ A++L+ +L +HPG+LPF  +I 
Sbjct: 29  SSVKDGSRFVPAEPMTLADVNENVVKAKYAVRGKIPTRAEELERRLEEHPGSLPFSKIIQ 88

Query: 130 SNIGNPQQLGQKPLSFGRQVLSILEYPALLDHERTLVDSMGYAPDSIERAKTLLTDIG-S 188
           +NIGNPQQLGQKPL+F RQV+S+++ P LL+     +    +  D + RA+ +L D G S
Sbjct: 89  ANIGNPQQLGQKPLTFYRQVISLMQNPQLLEMPAEWLQQ-AFKADVVVRARRMLQDAGGS 147

Query: 189 IGAYSNSQGVHGIRQTVADFITNRDDGEVAYPDDIFLTAGASSAVSTILSILCKGQQTGV 248
           +GAYS SQGV G R+TVA FI  RD G  A PD+++LTAGASSAVS +LS  CKG +TGV
Sbjct: 148 VGAYSASQGVKGYRRTVAQFIERRD-GIPANPDNVYLTAGASSAVSCLLSTFCKGPETGV 206

Query: 249 LIPIPQYPXXXXXXXXXXXXXXPYYLDESNGWSTDINEISKVAQDSLEAGIKPTCLVVIN 308
           LIPIPQYP              PYYL+E++GWST+ +E+ +V  DS +  I P CLVVIN
Sbjct: 207 LIPIPQYPLYTATITQNNAVALPYYLNEADGWSTNPDEMERVILDSKKRNIAPKCLVVIN 266

Query: 309 PGNPTGSVLTVEAIKNVFDVAAKYGLVVIADEVYQDNIFPGSEFHSMKKILRILQKEVPN 368
           PGNPTGSVL+V+ ++ +  +AAKYG+VVIADEVYQDN+F  ++FHSM+K+L+ LQ   P 
Sbjct: 267 PGNPTGSVLSVKDMEAILTLAAKYGIVVIADEVYQDNVFGDAKFHSMRKVLKNLQLREPT 326

Query: 369 KYDNIQLASLHSCSKGLLGECGHRGGYCEFIGFTPEVKQVITKLSSISLCSSVIGQALVD 428
            Y N+QLASLHS SKGL GECG RGGY E IGF  E+++V  KL+SISLC  V GQALVD
Sbjct: 327 LYKNVQLASLHSISKGLSGECGQRGGYMELIGFREELRKVFVKLASISLCPVVTGQALVD 386

Query: 429 LMCCPPKKGEPSYELDQHERQTIRTNHKKRSNKLYEMFNSLEGVTCQKPQGAMYMFPNIQ 488
           LM  PP +G+PSYE    E ++I    ++RS  L++ F SLEG+ C  PQGA+Y+FP + 
Sbjct: 387 LMVGPPSQGDPSYEQYTQETRSIYHELEERSQLLWKTFCSLEGIECNMPQGALYLFPKLH 446

Query: 489 LPFNAIKMAQNLDITPDEFYCRELLKATGICTVPGSGFGQQPGTYHVRTTFLAPGVEWMK 548
           LP  AI+ AQ L I  DE YC ELL  TGICTVPG+GFGQ PGTYHVRTTFL PG +W++
Sbjct: 447 LPQKAIEAAQKLGIPADELYCSELLDETGICTVPGTGFGQIPGTYHVRTTFLPPGTKWIE 506

Query: 549 RWEKFHIEFFEKYR 562
            W+ FH +F++KYR
Sbjct: 507 SWKDFHKKFYDKYR 520

>TBLA0G01630 Chr7 (428016..429518) [1503 bp, 500 aa] {ON} 
          Length = 500

 Score =  554 bits (1428), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 264/492 (53%), Positives = 356/492 (72%), Gaps = 10/492 (2%)

Query: 81  AERLEPEDLNPNVVKAKYAVRGAIPSYADKLKIQLLKHPGTLPFESVINSNIGNPQQLGQ 140
           A +    D++ +++  +YA+RG IP+ AD+L+ QL   P  LPF+ +I +NIGNPQQL Q
Sbjct: 9   APKFSLNDISQSILDTEYAIRGTIPTRADELQEQLNISPNQLPFKKIIYANIGNPQQLEQ 68

Query: 141 KPLSFGRQVLSILEYPALLDHERTLVDSMGYAPDSIERAKTLLTDIG-SIGAYSNSQGVH 199
           +PL+F RQVLS++EYP L++ +  LV++  YAPD+I+RA+T+L  IG S+GAYS+SQG+ 
Sbjct: 69  EPLTFQRQVLSLVEYPNLVNSKNILVENKIYAPDAIKRAETILNSIGGSVGAYSSSQGIL 128

Query: 200 GIRQTVADFITNRDDGEVAYPDD---------IFLTAGASSAVSTILSILCKGQQTGVLI 250
            IR+ VA  I  RD+ E+   D+         IFLT GA++AVS IL +  K +  GVL+
Sbjct: 129 SIRKNVAKCILQRDNDELCCNDEELINETASNIFLTDGATTAVSYILPLFAKDENCGVLL 188

Query: 251 PIPQYPXXXXXXXXXXXXXXPYYLDESNGWSTDINEISKVAQDSLEAGIKPTCLVVINPG 310
           PIPQYP              PYYL+E   WSTD  EI  + +D++   IKPT LV+INPG
Sbjct: 189 PIPQYPLYTAAVTLQNSKLLPYYLNEDENWSTDPEEIETIIKDAISRNIKPTTLVIINPG 248

Query: 311 NPTGSVLTVEAIKNVFDVAAKYGLVVIADEVYQDNIFPGSEFHSMKKILRILQKEVPNKY 370
           NPTG++L+VE+I  + ++AAKYG+V+IADEVYQ+NI+   +FHS KKIL  L+ + P KY
Sbjct: 249 NPTGAILSVESITQIINIAAKYGIVIIADEVYQNNIYQDFKFHSFKKILNSLKLQYPKKY 308

Query: 371 DNIQLASLHSCSKGLLGECGHRGGYCEFIGFTPEVKQVITKLSSISLCSSVIGQALVDLM 430
           DN+QLASLHS SKG+ GECG RGGY E +GF+ E+K++I KL+SI +CS V GQ LVDLM
Sbjct: 309 DNVQLASLHSISKGVNGECGQRGGYFELLGFSDEIKKIILKLASIDICSVVTGQILVDLM 368

Query: 431 CCPPKKGEPSYELDQHERQTIRTNHKKRSNKLYEMFNSLEGVTCQKPQGAMYMFPNIQLP 490
             PP+KG+ SY+LDQ ER  I++N   +SN LY++F+ L G++CQKPQGAMY+FP + L 
Sbjct: 369 SKPPEKGDYSYKLDQRERNNIQSNLILKSNTLYDLFSRLPGISCQKPQGAMYLFPRLHLT 428

Query: 491 FNAIKMAQNLDITPDEFYCRELLKATGICTVPGSGFGQQPGTYHVRTTFLAPGVEWMKRW 550
            N I  A+  ++ PDEFYC +LL+ TGICTVPGSGFGQ+ GTYHVRTTFL  G+EW+K W
Sbjct: 429 SNMINEAKLNNLEPDEFYCLKLLENTGICTVPGSGFGQKEGTYHVRTTFLPSGIEWIKLW 488

Query: 551 EKFHIEFFEKYR 562
           EKFH+EF  +Y+
Sbjct: 489 EKFHLEFMNQYK 500

>TBLA0F03060 Chr6 (743646..745148) [1503 bp, 500 aa] {ON} Anc_8.263
           YDR111C
          Length = 500

 Score =  552 bits (1423), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 271/499 (54%), Positives = 360/499 (72%), Gaps = 9/499 (1%)

Query: 73  TSREKSYF-AERLEPEDLNPNVVKAKYAVRGAIPSYADKLKIQLLKHPGTLPFESVINSN 131
           T  +K++  A +    D+N +++KA+YA+RG IP+ A++L IQLL++  +LPF  ++ +N
Sbjct: 2   TMNQKTFLPAPKFSLNDINESILKAEYAIRGTIPNRAEELDIQLLENSKSLPFAKIVYAN 61

Query: 132 IGNPQQLGQKPLSFGRQVLSILEYPALLDHERTLVDSMGYAPDSIERAKTLLTDIG-SIG 190
           IGNPQQL Q+PL+F RQV+S++++P LL  +  L+    Y+ DSIERA  LL  IG S+G
Sbjct: 62  IGNPQQLDQQPLTFQRQVMSLVQFPDLLKSKDILLAQKIYSKDSIERATKLLNSIGGSVG 121

Query: 191 AYSNSQGVHGIRQTVADFITNRDDGEVAYPD-------DIFLTAGASSAVSTILSILCKG 243
           AYS+SQGV  IR+ VA FI  RD       D       ++FLTAGAS+AV  IL +  K 
Sbjct: 122 AYSSSQGVLDIRKNVARFILKRDLHHDPTQDLIDETASNVFLTAGASTAVDHILPLFAKD 181

Query: 244 QQTGVLIPIPQYPXXXXXXXXXXXXXXPYYLDESNGWSTDINEISKVAQDSLEAGIKPTC 303
           +  GVL+PIPQYP              PYYL+ESN WSTD  +I ++  D+++  IKPT 
Sbjct: 182 ESCGVLLPIPQYPLYTAAVTLQKSKLLPYYLNESNNWSTDPKQIEQIVIDAIKQNIKPTT 241

Query: 304 LVVINPGNPTGSVLTVEAIKNVFDVAAKYGLVVIADEVYQDNIFPGSEFHSMKKILRILQ 363
           LVVINPGNPTG++LT ++I ++ D+AA+YG+V+IADEVYQ+N++   EFHS KK+L  L+
Sbjct: 242 LVVINPGNPTGAILTKDSIIDIIDIAAEYGIVIIADEVYQENVYEAFEFHSFKKVLSELR 301

Query: 364 KEVPNKYDNIQLASLHSCSKGLLGECGHRGGYCEFIGFTPEVKQVITKLSSISLCSSVIG 423
           K  P+KYDN+QLASLHS SKG+ GECG RGGY E  GF+ +VK+V+ K++SIS+CS V G
Sbjct: 302 KNYPSKYDNVQLASLHSISKGVNGECGQRGGYMEITGFSNDVKKVLLKVASISICSVVTG 361

Query: 424 QALVDLMCCPPKKGEPSYELDQHERQTIRTNHKKRSNKLYEMFNSLEGVTCQKPQGAMYM 483
           Q LVDLM  PP+ G+ SYELDQ ER  I +N   +SN LY++F  L G++CQKPQGAMY+
Sbjct: 362 QILVDLMVNPPQPGDESYELDQLERSVIHSNLILKSNTLYDVFTRLPGISCQKPQGAMYL 421

Query: 484 FPNIQLPFNAIKMAQNLDITPDEFYCRELLKATGICTVPGSGFGQQPGTYHVRTTFLAPG 543
           FP + L  NAI  A  L++ PDEFYC +LL+ TGICTVPGSGFGQ PGTYH+RTTFL PG
Sbjct: 422 FPRLHLSENAINAATELNLKPDEFYCLKLLENTGICTVPGSGFGQYPGTYHLRTTFLPPG 481

Query: 544 VEWMKRWEKFHIEFFEKYR 562
           +EW+  WEKFH+EF EKY+
Sbjct: 482 IEWINSWEKFHLEFMEKYK 500

>Kwal_34.16018 s34 (159210..160349) [1140 bp, 379 aa] {ON} YJL060W
           (BNA3) - YJL060W [contig 272] FULL
          Length = 379

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 45/168 (26%), Positives = 73/168 (43%), Gaps = 19/168 (11%)

Query: 192 YSNSQGVHGIRQTVADFITNRDDGEVAYPDDIFLTAGASSAVSTILSILCKGQQTGVLIP 251
           Y   QG H +R+ +A+  +N D       +++ LT GA +A + +      G+    +  
Sbjct: 55  YGAIQGSHALRKLIAEMYSNED--VTLSEENVILTNGAIAA-NFLTHYTLAGKGDHFICI 111

Query: 252 IPQYPXXXXXXXXXXXXXXPYYLDESNGWSTDINEISKVAQDSLEAGIKPT--CLVVINP 309
            P Y                 +L +   +  +I E        LE  IKP   C+V+  P
Sbjct: 112 SPTYQQLSSIPQMFGAEVELLHLRKETNYQPNIVE--------LERMIKPNTKCIVLNTP 163

Query: 310 GNPTGSVLTVEAIKNVFDVAAKYGLVVIADEVYQDNIFPGSEFHSMKK 357
            NP  SV+  E ++ + ++A K+G+VV  DEVY         FHS +K
Sbjct: 164 NNPLSSVIPTETLREIAELADKHGIVVFCDEVY------SPLFHSCEK 205

>TPHA0O01450 Chr15 complement(291591..292922) [1332 bp, 443 aa] {ON}
           Anc_1.321 YJL060W
          Length = 443

 Score = 47.4 bits (111), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 40/73 (54%), Gaps = 7/73 (9%)

Query: 280 WSTDINEISKVAQDSLEAGIKPTCLVVINPGNPTGSVLTVEAIKNVFDVAAKYGLVVIAD 339
           W+ D  +   V  +  +A      +++  P NP G V T E +K + D+  K+ +++I+D
Sbjct: 183 WTLDFEQFENVITNKTKA------IIINTPHNPIGKVFTREELKRIGDICVKHNVIIISD 236

Query: 340 EVYQDNIFPGSEF 352
           EVY DN++   EF
Sbjct: 237 EVY-DNLYFVDEF 248

>Suva_6.136 Chr6 complement(227366..228700) [1335 bp, 444 aa] {ON}
           YJL060W (REAL)
          Length = 444

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 48/194 (24%), Positives = 86/194 (44%), Gaps = 21/194 (10%)

Query: 169 MGYAPD--SIERAKTLLTDIGSIGAYSNSQGVHGIRQTVADFITNRDDGEVAYPDDIFLT 226
             Y+P   +I+ A+  L +I  +  YS ++G   +  ++ D  T   + E+   +++ +T
Sbjct: 64  FSYSPPQFAIKEAQKAL-EIPLVNQYSPTRGRPSLINSLIDLYTPIYNKELK-AENVVVT 121

Query: 227 AGASSAV-STILSILCKGQQTGVLIPI-PQYPXXXXX---XXXXXXXXXPYYLDESNG-- 279
            GA+  + S ++ +L  G +  V  P   QY                  P  LD+ N   
Sbjct: 122 TGANEGILSCLMGLLNSGDEVIVFEPFFDQYIPNIELCGGKVVYVPINPPKELDQRNTRG 181

Query: 280 --WSTDINEISKVAQDSLEAGIKPTCLVVIN-PGNPTGSVLTVEAIKNVFDVAAKYGLVV 336
             W+ D  +  K      +A       V+IN P NP G V T + +  + ++  K+ +V+
Sbjct: 182 EEWTIDFEQFEKAITSKTKA-------VIINTPNNPIGKVFTHDELTTLGNICVKHNVVI 234

Query: 337 IADEVYQDNIFPGS 350
           I+DEVY+   F  S
Sbjct: 235 ISDEVYEHLYFTDS 248

>Kwal_14.2574 s14 complement(818144..819475) [1332 bp, 443 aa] {ON}
           YJL060W (BNA3) - 1:1 [contig 224] FULL
          Length = 443

 Score = 44.7 bits (104), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 34/60 (56%), Gaps = 2/60 (3%)

Query: 290 VAQDSLEAGIKPT--CLVVINPGNPTGSVLTVEAIKNVFDVAAKYGLVVIADEVYQDNIF 347
           V  D LEA I P    L++  P NP G V T E +  + ++  K+ +V+I+DEVY+   F
Sbjct: 185 VNYDELEAAITPKTKALILNTPHNPVGKVFTREELLRIGEICVKHNVVIISDEVYEHLYF 244

>KLLA0F01617g Chr6 complement(154025..155359) [1335 bp, 444 aa] {ON}
           highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase
          Length = 444

 Score = 44.3 bits (103), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 22/79 (27%), Positives = 41/79 (51%), Gaps = 7/79 (8%)

Query: 280 WSTDINEISKVAQDSLEAGIKPTCLVVINPGNPTGSVLTVEAIKNVFDVAAKYGLVVIAD 339
           W  D + ++K   +      +  C+++  P NP G V T E +  + D+  K  + +I+D
Sbjct: 184 WKIDFDILNKTINE------RTKCIILNTPHNPIGKVFTREELTQLGDICVKNNIYIISD 237

Query: 340 EVYQDNIFPGSEFHSMKKI 358
           EVY+ +++ G EF  +  I
Sbjct: 238 EVYE-HLYFGDEFTRIATI 255

>YJL060W Chr10 (323386..324720) [1335 bp, 444 aa] {ON}
           BNA3Kynurenine aminotransferase, catalyzes formation of
           kynurenic acid from kynurenine; potential Cdc28p
           substrate
          Length = 444

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 48/194 (24%), Positives = 85/194 (43%), Gaps = 21/194 (10%)

Query: 169 MGYAPD--SIERAKTLLTDIGSIGAYSNSQGVHGIRQTVADFITNRDDGEVAYPDDIFLT 226
             Y+P   +I+ A+  L DI  +  YS ++G   +  ++    +   + E+   +++ +T
Sbjct: 64  FSYSPPQFAIKEAQKAL-DIPMVNQYSPTRGRPSLINSLIKLYSPIYNTELK-AENVTVT 121

Query: 227 AGASSAV-STILSILCKGQQTGVLIPI-PQYPXXXXX---XXXXXXXXXPYYLDESNG-- 279
            GA+  + S ++ +L  G +  V  P   QY                  P  LD+ N   
Sbjct: 122 TGANEGILSCLMGLLNAGDEVIVFEPFFDQYIPNIELCGGKVVYVPINPPKELDQRNTRG 181

Query: 280 --WSTDINEISKVAQDSLEAGIKPTCLVVIN-PGNPTGSVLTVEAIKNVFDVAAKYGLVV 336
             W+ D  +  K      +A       V+IN P NP G V T E +  + ++  K+ +V+
Sbjct: 182 EEWTIDFEQFEKAITSKTKA-------VIINTPHNPIGKVFTREELTTLGNICVKHNVVI 234

Query: 337 IADEVYQDNIFPGS 350
           I+DEVY+   F  S
Sbjct: 235 ISDEVYEHLYFTDS 248

>ZYRO0G20636g Chr7 complement(1700506..1701867) [1362 bp, 453 aa]
           {ON} highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase involved in
           biosynthesis of nicotinic acid from tryptophan via
           kynurenine pathway potential Cdc28p substrate
          Length = 453

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 54/260 (20%), Positives = 101/260 (38%), Gaps = 42/260 (16%)

Query: 276 ESNGWSTDINEISKVAQDSLEAGIKPTCLVVINPGNPTGSVLTVEAIKNVFDVAAKYGLV 335
           E   W+ D  E++K      +A      L++  P NP G V T E +  + ++  +  +V
Sbjct: 187 EGKDWTIDYEELAKAFTSKTKA------LILNTPHNPIGKVFTKEELTKIGNLCVENNVV 240

Query: 336 VIADEVYQDNIFPGSEFHSMKKILRILQKEVPNKYDNIQLASLHSCSKGLLGECGHRGGY 395
           +I+DEVY+   F  S        +  L  E+       QL      +       G R G+
Sbjct: 241 IISDEVYEFLYFTDSYTR-----IATLSPEIG------QLTLTVGSAGKTFAATGWRIGW 289

Query: 396 CEFIGFTPEVKQVITK------LSSISLCSSVIGQALVDLMCCPPKKGEPSYELDQHERQ 449
              I   PE+   ++K       SS S     +  ++ D +     KG+          +
Sbjct: 290 V--ISLNPELLSYVSKGHTRICFSSPSPIQEAVANSIEDAL-----KGD--------YFE 334

Query: 450 TIRTNHKKRSNKLYEMFNSLEGVTCQKPQGAMYM---FPNIQLPFNAIKMAQNLDITPDE 506
            +RT++ ++      +F  + G+    P+G  ++   F  + +P +     + LD   D 
Sbjct: 335 AMRTDYIRKFEIFTSVFKEM-GLPYTIPEGTYFILVDFSKVNVPEDYPYPEELLDKGKDF 393

Query: 507 FYCRELLKATGICTVPGSGF 526
                L+   G+  +P + F
Sbjct: 394 RISYWLINELGVVAIPPTEF 413

>SAKL0D11528g Chr4 complement(960867..962018) [1152 bp, 383 aa] {ON}
           weakly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase, involved in
           biosynthesis of nicotinic acid from tryptophan via
           kynurenine pathway; potential Cdc28p substrate
          Length = 383

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 39/154 (25%), Positives = 66/154 (42%), Gaps = 11/154 (7%)

Query: 191 AYSNSQGVHGIRQTVADFITNRDDGEVAY-PDDIFLTAGASSAVSTILSILCKGQQTGVL 249
            Y   +G   +R  VA   +   D EV    D++ +T GA  A + ++S    G    V+
Sbjct: 54  TYGAIKGSDELRSLVASLYS---DKEVKLDKDNVLITNGAIGA-NFLVSYTLAGPGDHVI 109

Query: 250 IPIPQYPXXXXXXXXXXXXXXPYYLDESNGWSTDINEISKVAQDSLEAGIKPTCLVVINP 309
              P Y                  L+  N +  DI ++  + + + +      C+V+ NP
Sbjct: 110 CVDPTYQQLSSVPKMFGAEVELLELNRENDFIPDIGKLKSMIKGNTK------CIVLNNP 163

Query: 310 GNPTGSVLTVEAIKNVFDVAAKYGLVVIADEVYQ 343
            NP GSV+    ++ +  +A K  + VI DEVY+
Sbjct: 164 NNPLGSVIPTATLEEIAALARKNEIRVICDEVYR 197

>KNAG0B05320 Chr2 (1028845..1030146) [1302 bp, 433 aa] {ON}
           Anc_1.321 YJL060W
          Length = 433

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 44/168 (26%), Positives = 76/168 (45%), Gaps = 13/168 (7%)

Query: 192 YSNSQGVHGIRQTVADFITNRDDGEVAYPDDIFLTAGASSAV-STILSILCKGQQTGVLI 250
           YS ++G   + + +AD  T    G+    D+I +  GA+ A+ S ++ +L KG +  V  
Sbjct: 77  YSPTRGRPNLIKALADLYTPLY-GQQLSADNITVHTGANEAIFSCLMGLLNKGDEVIVFE 135

Query: 251 PI-PQYPXXXXXX---XXXXXXXXPYYLDESNGWSTDINEISKVAQDSLEAGI--KPTCL 304
           P   QY                  P  LD+     T+     ++  D LE  I  +  C+
Sbjct: 136 PFFDQYISNIELAGGVVRYVPINPPRELDDRVTRGTEW----EIDWDILEKTINSRTKCV 191

Query: 305 VVINPGNPTGSVLTVEAIKNVFDVAAKYGLVVIADEVYQDNIFPGSEF 352
           ++  P NP G V T E +  +  +     +V+I+DEVY+ +++   EF
Sbjct: 192 IINTPHNPIGKVFTREELLRLGKICVDNNIVIISDEVYE-HLYFSDEF 238

>TDEL0A01600 Chr1 (289263..290690) [1428 bp, 475 aa] {ON} Anc_8.204
           YER152C
          Length = 475

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 73/362 (20%), Positives = 130/362 (35%), Gaps = 79/362 (21%)

Query: 192 YSNSQGVHGIRQTVADFITN------RDDGEVAYPDDIFLTAGASSAVSTIL---SILCK 242
           Y + +G   +R+ +  F  +      RDD   + P+ + L++GAS  V +IL   ++   
Sbjct: 51  YGSDEGALWVREAITRFNNDETFRFARDDKARSRPEFLNLSSGASYGVLSILLQATLAHT 110

Query: 243 GQQTGVLIPIPQYPXXXXXXXXXXXXXXPYYLDESNGWSTDINEISKVAQD--------- 293
           G      I  P Y                  +DE    S D+  + +  Q+         
Sbjct: 111 GYTRQAFIVSPTYFLINDCFIDAGFGSKITAIDEDGQGSIDLALLERKLQEFEDKFTEEE 170

Query: 294 ---SLEAGIKPTCLV-----------VINPGNPTGSVLTVEAIKNVFDVAAKYGLVVIAD 339
               L+A   P   V           +    NPTG+  + E    + ++A KY +++IAD
Sbjct: 171 DQEKLQAITDPAKAVPKKIYKYVIYCIPTYSNPTGTTYSTETKLKLIEIARKYDMLIIAD 230

Query: 340 EVYQDNIF--PGSEFHSMKKILRILQKEV---PNKYDN--------------IQLASLHS 380
           +VY    F  P       KK    L +E    P  Y N              ++     +
Sbjct: 231 DVYDMLDFSPPFDNLPQPKKRFVHLDRETNNDPESYGNTISNATFSKLIAPGLRFGYHET 290

Query: 381 CSKGLLGECGHRGGYCEFIGFTPEVKQVITKLSSISLCSSVIGQALVDLMCCPPKKGEPS 440
            +  L G+  H G      G TP             L S ++G  L        K G  +
Sbjct: 291 VTDKLAGQLSHGGANTS--GGTPS-----------QLNSMIVGTML--------KNGSTA 329

Query: 441 YELDQHERQTIRTNHKKRSNKLYEMFNSL--EGVTCQKPQGAMYMFPNIQLPFNAIKMAQ 498
             L+Q     +R+ + +R+  +Y        +    +KP+G  + +  +   ++A ++ +
Sbjct: 330 TLLNQ-----LRSTYAERAETMYAAVKGYMPKNTKFEKPEGGYFSWLTLPQGYDAHEIGK 384

Query: 499 NL 500
            L
Sbjct: 385 RL 386

>Kpol_1035.23 s1035 complement(56123..57457) [1335 bp, 444 aa] {ON}
           complement(56123..57457) [1335 nt, 445 aa]
          Length = 444

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 79/378 (20%), Positives = 155/378 (41%), Gaps = 62/378 (16%)

Query: 170 GYAPDSIERAKTLLTDIGSIGAYSNSQGVHGIRQTVADFITNRDDGEVAYPDDIFLTAGA 229
            +A   I++A     +I  +  YS ++G   +  ++ D  +     ++  P+++ +T GA
Sbjct: 70  AFAIKEIQKA----VEIPLVNQYSPTRGRPRLINSLIDLYSPFYKKQLT-PENVLVTTGA 124

Query: 230 SSAV-STILSILCKGQQTGVLIPI-PQYPXXXXX---XXXXXXXXXPYYLD----ESNGW 280
           +  + S ++ I+  G +  V  P   QY                  P  LD    +   W
Sbjct: 125 NEGILSCLMGIINPGDEVIVFEPFFDQYIPNIELCGGKVVYVPINPPKELDNRVTKGTEW 184

Query: 281 STDINEISKVAQDSLEAGIKPTCLVVIN-PGNPTGSVLTVEAIKNVFDVAAKYGLVVIAD 339
           + D +E ++      +A       V+IN P NP G V T E +  + ++  +  +++IAD
Sbjct: 185 TVDFDEFTRAITPKTKA-------VIINTPHNPIGKVFTREELTKLGNICVENNVIIIAD 237

Query: 340 EVYQDNIFPGSEFHSMKKILRILQKEVPNKYDNIQLA-SLHSCSKGLLGECGHRGGYCEF 398
           EVY+ +++   EF  +      L +E+       QL  S+ S  K      G R G+   
Sbjct: 238 EVYE-HLYFVDEFPRIAT----LSEEIG------QLTLSVGSAGKS-FAATGWRIGWV-- 283

Query: 399 IGFTPEVKQVITKLSSISLCSSVIGQALVDLMCCPPKKGEPSYELDQHERQTIRTNHKKR 458
           +   P++ Q  +K +   +C               P +   SY +D   +     N ++ 
Sbjct: 284 VSQNPDLLQYASK-AHTRIC----------FASPSPIQEACSYSIDHALKIDYFENMRQE 332

Query: 459 SNKLYEMFNSL---EGVTCQKPQGAMYM---FPNIQLP----FNAIKMAQNLDITPDEFY 508
             K +++F S+    G+    P+G+ ++   F  +++P    F    M++  D     + 
Sbjct: 333 YVKKFKIFTSVFDELGLPYTIPEGSYFVLADFSKVKIPDSYQFPEEIMSKGKDFRISNWL 392

Query: 509 CRELLKATGICTVPGSGF 526
             EL    G+  +P + F
Sbjct: 393 INEL----GVVAIPPTEF 406

>TDEL0D01900 Chr4 (369434..370765) [1332 bp, 443 aa] {ON} Anc_1.321
           YJL060W
          Length = 443

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 85/416 (20%), Positives = 161/416 (38%), Gaps = 78/416 (18%)

Query: 133 GNPQQLGQKPLSFGRQVLSILEYPALLDHERTLVDSMGYAPD--SIERAKTLLTDIGSIG 190
           GN Q  G++ ++ G+   S                   Y+P   +I  AK  + DI  + 
Sbjct: 46  GNAQNKGRELINLGQGFFS-------------------YSPPKFAITEAKKAV-DIPLVN 85

Query: 191 AYSNSQGVHGIRQTVADFITNRDDGEVAYPDDIFLTAGASSAV-STILSILCKGQQTGVL 249
            YS ++G   + +++    +   + E+   +++ +T GA+  + S ++ IL  G +  V 
Sbjct: 86  QYSPTRGRVSLLESLIKLYSPLYNAELK-AENVTVTTGANEGILSCLMGILNPGDEVIVF 144

Query: 250 IPI-PQYPXXXXX---XXXXXXXXXPYYLDE----SNGWSTDINEISKVAQDSLEAGIKP 301
            P   QY                  P  +D+       W+ D  + +    D  +A    
Sbjct: 145 EPFFDQYIPNIELLGGKVVYVPINPPKDMDQRVVKGTEWTVDYEQFANAITDKTKA---- 200

Query: 302 TCLVVIN-PGNPTGSVLTVEAIKNVFDVAAKYGLVVIADEVYQDNIFPGSEFHSMKKILR 360
              V+IN P NP G V T E +  + ++  K  +V+I+DEVY+   F  S        + 
Sbjct: 201 ---VIINTPHNPIGKVFTREELTRIGEICVKKNVVIISDEVYEHLYFTDSFTR-----IA 252

Query: 361 ILQKEVPNKYDNIQLA-SLHSCSKGLLGECGHRGGYCEFIGFTPEVKQVITK------LS 413
            L  E+       QL  S+ S  K      G R G+   +   PE+   ++K       +
Sbjct: 253 TLSPEIG------QLTLSVGSAGKS-FAATGWRVGWV--VSLNPELLSYVSKAHTRICFA 303

Query: 414 SISLCSSVIGQALVDLMCCPPKKGEPSYELDQHERQTIRTNHKKRSNKLYEMFNSLEGVT 473
           S S     +  ++ D +           E++  E   +R  +K + +    +F  L G+ 
Sbjct: 304 SPSPLQEAVANSINDAL-----------EINYFE--NMRQEYKHKYDIFTSVFKEL-GLP 349

Query: 474 CQKPQGAMYM---FPNIQLPFNAIKMAQNLDITPDEFYCRELLKATGICTVPGSGF 526
             +P+G  ++   F  +++P       +  +   D      L+   G+  +P + F
Sbjct: 350 YTEPEGTYFILVDFSKVKIPEGYSYPEEIANKAKDFRIAYWLINELGVVAIPPTEF 405

>KAFR0A01710 Chr1 complement(348198..349505) [1308 bp, 435 aa] {ON}
           Anc_1.321 YJL060W
          Length = 435

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 36/64 (56%), Gaps = 2/64 (3%)

Query: 289 KVAQDSLEAGI--KPTCLVVINPGNPTGSVLTVEAIKNVFDVAAKYGLVVIADEVYQDNI 346
           ++  DSL+A +  K   +++  P NP G V T   ++ + D+  K  +V+I+DEVY+   
Sbjct: 176 QIDWDSLQAAMNSKTKAIIINTPHNPIGKVFTEPELRRLGDICVKNNVVIISDEVYEHLY 235

Query: 347 FPGS 350
           F  S
Sbjct: 236 FKDS 239

>CAGL0J05126g Chr10 complement(487452..488753) [1302 bp, 433 aa]
           {ON} highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060w
          Length = 433

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 77/376 (20%), Positives = 141/376 (37%), Gaps = 65/376 (17%)

Query: 175 SIERAKTLLTDIGSIGAYSNSQG--------VHGIRQTVADFITNRDDGEVAYPDDIFLT 226
           +I  AK+ L D+  +  YS ++G        V   +    DFI N++         + +T
Sbjct: 61  AINAAKSAL-DVPLVNQYSPTRGRPSLIKSLVELYKPVFGDFIDNQN---------VLVT 110

Query: 227 AGASSAV-STILSILCKGQQTGVLIPIPQYPXXXXXXXXXXXXXXPYYLDESNGWSTDIN 285
            GA+  + S ++ IL  G +  V  P                   P +  +         
Sbjct: 111 TGANEGILSCLMGILNAGDEVIVFEPFFDQYIPNIELCGGVVRYVPIHPPKEMKTRNTTG 170

Query: 286 EISKVAQDSLEAGI--KPTCLVVINPGNPTGSVLTVEAIKNVFDVAAKYGLVVIADEVYQ 343
           +  ++  D+LE     K   +++  P NP G V T + +  +  +  ++  VVI+DEVY+
Sbjct: 171 DEWQIDWDALEKTFNNKTKAVIINTPHNPIGKVFTEQELTKLAQLCVEHNTVVISDEVYE 230

Query: 344 DNIFPGSEFHSMKKILRILQKEVPNKYDNIQLASLHSCSKGL-LGECGHRGGYC-----E 397
              F  S               + N  ++I   +L   S G      G R G+      +
Sbjct: 231 HLYFTES------------FPRIANINEDIANLTLTVGSAGKSFAATGWRIGWIISKNDQ 278

Query: 398 FIGFTPEVKQVITKLSSISL---CSSVIGQAL-VDLMCCPPKKGEPSYELDQHERQTIRT 453
            + +  +    I   S   L   C+  I  AL +D     PK               +R 
Sbjct: 279 LLNYVSKAHTRICFASPSPLQEACAGSIEHALKIDYF---PK---------------MRE 320

Query: 454 NHKKRSNKLYEMFNSLEGVTCQKPQGAMYM---FPNIQLPFNAIKMAQNLDITPDEFYCR 510
            ++K+   L   F+ L G+   +P+G  ++   F  +++P + +   + L+   D     
Sbjct: 321 EYRKKFEILTTAFDKL-GLNYTQPEGTYFILVDFSKVKIPEDYVYPEELLEKAKDFRISY 379

Query: 511 ELLKATGICTVPGSGF 526
            L+   GI  +P + F
Sbjct: 380 WLINEIGIVAIPPTEF 395

>NDAI0B04550 Chr2 (1132653..1134350) [1698 bp, 565 aa] {ON}
           Anc_2.102
          Length = 565

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 41/170 (24%), Positives = 73/170 (42%), Gaps = 18/170 (10%)

Query: 192 YSNSQGVHGIRQTVADFITNRDD----GEVAYPDDIFLTAGASSAVSTILSILCKGQQTG 247
           YS +QG+  +   +  FIT  ++     E  Y  DI L  G+S ++  +   LC  + T 
Sbjct: 137 YSETQGMKPLLDFIKTFITKLNNTPPYNETLY--DIMLANGSSDSMFKVFETLC-DESTT 193

Query: 248 VLIPIPQYPXXXXXXXXXXXXXXPYYLD---ESNGWSTDINEISKV-----AQDSLEAGI 299
           VL+    +               P  L+   E  G   DI  +  +      + + +   
Sbjct: 194 VLMEEFTFVPVISNVMATGAKCIPLKLNLNYEDQG--IDIEYLENLLDNWGGKSNTKHLS 251

Query: 300 KPTCLVVINPG-NPTGSVLTVEAIKNVFDVAAKYGLVVIADEVYQDNIFP 348
           KP  L  I+ G NP G  L++E  + ++ +A ++ L+++ D+ Y    FP
Sbjct: 252 KPKILYTISTGQNPIGVTLSMEKRRKIYTIAQRHDLIILEDDPYCYLTFP 301

>KLLA0F10021g Chr6 (926569..928062) [1494 bp, 497 aa] {ON} similar
           to uniprot|P53090 Saccharomyces cerevisiae YGL202W ARO8
           Aromatic aminotransferase expression is regulated by
           general control of amino acid biosynthesis
          Length = 497

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 30/122 (24%), Positives = 51/122 (41%), Gaps = 5/122 (4%)

Query: 222 DIFLTAGASSAVSTILSILCKGQQTGVLIPIPQYPXXXXXXXXXXXXXXPYYLDESNGWS 281
           D+  T G + A  ++L I C    T +L     +               P  LDE     
Sbjct: 134 DVLATIGNTGAWESVLRIFCNRGDT-ILAEQFAFSSSISAAEAQGVNVFPIPLDEHG--- 189

Query: 282 TDINEISKVAQDSLEAGIKPTCLVVINPG-NPTGSVLTVEAIKNVFDVAAKYGLVVIADE 340
              +++  +  +  E   KP  L  +  G NPTGS L+ +  + ++ +A K+  ++I DE
Sbjct: 190 IIPSKLETILDNWTEGAAKPKLLYTVPTGQNPTGSSLSFDRKEEIYRIAQKHDFIIIEDE 249

Query: 341 VY 342
            Y
Sbjct: 250 PY 251

>Skud_10.156 Chr10 complement(294149..295531) [1383 bp, 460 aa] {ON}
           YJL060W (REAL)
          Length = 460

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 40/85 (47%), Gaps = 12/85 (14%)

Query: 271 PYYLDESNG----WSTDINEISKVAQDSLEAGIKPTCLVVIN-PGNPTGSVLTVEAIKNV 325
           P  LD+ N     W+ D  +         +A       V+IN P NP G V T E +  +
Sbjct: 187 PKELDQRNTKGEEWTIDFEQFENAITSKTKA-------VIINTPHNPIGKVFTREELTTL 239

Query: 326 FDVAAKYGLVVIADEVYQDNIFPGS 350
            ++  K+ +V+I+DEVY+   F  S
Sbjct: 240 GNICVKHNVVIISDEVYEHLFFTDS 264

>KAFR0B02380 Chr2 complement(463678..465009) [1332 bp, 443 aa] {ON}
           Anc_8.204 YER152C
          Length = 443

 Score = 40.8 bits (94), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 73/353 (20%), Positives = 139/353 (39%), Gaps = 61/353 (17%)

Query: 191 AYSNSQGVHGIRQTVADFITNR------DDGEVAYPDDIFLTAGASSAVSTILSILCKGQ 244
            Y +++G H +R T+  F          + G  + P+ + LT+GAS  V  IL + C   
Sbjct: 52  TYGSNEGAHWVRSTICKFNNEEIFKFGENYGARSAPECLNLTSGASYGVLNIL-LQCT-- 108

Query: 245 QTGVLIPIPQYPXXXXXXXXXXXXXXPYYLDES-NGWSTDINEI-----------SKVAQ 292
                +P   Y                 ++D   +G  T INE+           S +A+
Sbjct: 109 -----LPHNNYTRQAFIISPTYFLINDCFIDAGFHGKLTAINEMGTDSIDFDTLESNLAE 163

Query: 293 -DSLEAGIKPTCLV-----------------VINPGNPTGSVLTVEAIKNVFDVAAKYGL 334
            DS++A +   C+                  V    NP+G   ++     + ++A KY +
Sbjct: 164 LDSIKADVGTQCITKNENSKGKKIYRYVLYCVPTYSNPSGHTYSLTTKLRLLELARKYDI 223

Query: 335 VVIADEVYQ--DNIFPGSEFHS-MKKILRILQKEVPNKYDNIQLASLHSCSKGLLGECGH 391
           ++I D+VY   + + P     +  ++ + + ++ V + Y N    ++ +CS   L   G 
Sbjct: 224 LIITDDVYDILNYVDPLDALPTPPRRFVHLDRETVMDPYGN----TISNCSFSKLIAPGL 279

Query: 392 RGGYCEFIGFTPEVKQVITKLSSISLCSSVIGQALVDLMCCPPKKGEPSYELDQHERQTI 451
           R GY E +      +      +S     S +   +V  M    +KG     L     Q  
Sbjct: 280 RFGYQETVSSMLSQQLSNGGANSSGGTPSQLNSMIVGTMI---EKG-----LLTKSIQEF 331

Query: 452 RTNHKKRSNKLYEMFNSL--EGVTCQKPQGAMYMFPNIQLPFNAIKMAQNLDI 502
           R+ +K R++ LY        E    +K +G  + +  + + ++A ++ + L I
Sbjct: 332 RSVYKNRADTLYSSIKKFLPENTIVEKQKGGYFSWITLPMGYDAKEVGKRLKI 384

>SAKL0D06886g Chr4 complement(571478..572821) [1344 bp, 447 aa] {ON}
           highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase involved in
           biosynthesis of nicotinic acid from tryptophan via
           kynurenine pathway potential Cdc28p substrate
          Length = 447

 Score = 40.8 bits (94), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 35/144 (24%), Positives = 62/144 (43%), Gaps = 20/144 (13%)

Query: 220 PDDIFLTAGASSAV-STILSILCKGQQTGVLIPIPQYPXXXXXXXXXXXXXXPYY----- 273
           P ++ +T GA+ A+ S ++ +L +G +  V  P                   P +     
Sbjct: 118 PSNVQVTTGANEAILSCLVGLLNQGDEVIVFEPFFDQYISNIEIPGGKVTYVPLHPPKEL 177

Query: 274 ---LDESNGWSTDINEISKVAQDSLEAGIKPT--CLVVINPGNPTGSVLTVEAIKNVFDV 328
              +     W+ D         D L A I P    L++  P NP G V T E +  + ++
Sbjct: 178 ENRVTHGTEWTVDY--------DELRAAITPKTKALILNTPHNPIGKVFTREELLEIGNI 229

Query: 329 AAKYGLVVIADEVYQDNIFPGSEF 352
             +  +V+I+DEVY+ +++  SEF
Sbjct: 230 CVENNVVIISDEVYE-HLYFTSEF 252

>KLTH0G19646g Chr7 complement(1699421..1700560) [1140 bp, 379 aa]
           {ON} conserved hypothetical protein
          Length = 379

 Score = 40.8 bits (94), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 39/162 (24%), Positives = 74/162 (45%), Gaps = 12/162 (7%)

Query: 191 AYSNSQGVHGIRQTVADFITNRDDGEVAYPDDIFLTAGASSAVSTILSILCKGQQTGVLI 250
            Y +  G   +R  VA  I + D+ ++   D++ +T GA  A + ++     G    ++ 
Sbjct: 54  TYGSIWGTPVLRDLVAK-IHSSDEIQLT-ADNVLITNGAIGA-NFLVHYTAAGPGDHIIC 110

Query: 251 PIPQYPXXXXXXXXXXXXXXPYYLDESNGWSTDINEI-SKVAQDSLEAGIKPTCLVVINP 309
             P Y                 +L+  +G++ +I ++ SKV  ++         +V+ NP
Sbjct: 111 VDPTYQQLSSVPSMFGADVELLHLEAEDGYTPNIQKLKSKVRANT-------KYIVLNNP 163

Query: 310 GNPTGSVLTVEAIKNVFDVAAKYGLVVIADEVYQDNIFPGSE 351
            NP GSV++ E +  + D A +  + ++ DEVY   +F  SE
Sbjct: 164 NNPLGSVISTEKMTEIIDYAERNEIFIVCDEVYSP-LFHSSE 204

>Smik_10.180 Chr10 (315030..316364) [1335 bp, 444 aa] {ON} YJL060W
           (REAL)
          Length = 444

 Score = 40.4 bits (93), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 37/73 (50%), Gaps = 10/73 (13%)

Query: 280 WSTDINEISKVAQDSLEAGIKP-TCLVVIN-PGNPTGSVLTVEAIKNVFDVAAKYGLVVI 337
           W+ D         +  E  I P T  V+IN P NP G V T E +  + ++  K+ +++I
Sbjct: 184 WTIDF--------EQFEKAITPKTKAVIINTPHNPIGKVFTREELTTLGNICVKHNVIII 235

Query: 338 ADEVYQDNIFPGS 350
           +DEVY+   F  S
Sbjct: 236 SDEVYEHLYFTDS 248

>KLLA0F03509g Chr6 (327598..328761) [1164 bp, 387 aa] {ON} similar
           to uniprot|P07172 Saccharomyces cerevisiae YIL116W HIS5
           Histidinol-phosphate aminotransferase catalyzes the
           seventh step in histidine biosynthesis responsive to
           general control of amino acid biosynthesis mutations
           cause histidine auxotrophy and sensitivity to Cu Co and
           Ni salts
          Length = 387

 Score = 40.0 bits (92), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 43/169 (25%), Positives = 72/169 (42%), Gaps = 17/169 (10%)

Query: 221 DDIFLTAGASSAVSTILSILCKGQQTGVLIPIPQYPXXX--XXXXXXXXXXXPYYLDESN 278
           D++ L  G+  ++  ++   C   +  +LI    Y                 P  L E +
Sbjct: 88  DNLCLGVGSDESIDALIRACCVPAKEKILIAPATYGMYTICSQVNDVEYVTVPLLLSEED 147

Query: 279 GWSTDINEISKVAQDSLEAGIKPTCLVVINPGNPTGSVLTVEAIKNVFDVAAKYGLVVIA 338
            +  D  +I +  Q+  +  IK   + + +PGNPTG+ + V  I+ +     + GLVV+ 
Sbjct: 148 KFQIDEEKILETLQN--DPSIK--LVFITSPGNPTGTFIDVNRIEKILS-QWQTGLVVV- 201

Query: 339 DEVYQDNIFPGSEFHSMKKILRILQKEVPNKYDNIQLASLHSCSKGLLG 387
           DE Y D    GS+  S+  +          KY+NI +    S S GL G
Sbjct: 202 DEAYID-FVEGSDKGSLAPL--------ATKYENIAVLQTLSKSFGLAG 241

>KLTH0H10648g Chr8 complement(919601..920932) [1332 bp, 443 aa] {ON}
           highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase involved in
           biosynthesis of nicotinic acid from tryptophan via
           kynurenine pathway potential Cdc28p substrate
          Length = 443

 Score = 39.7 bits (91), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 34/74 (45%), Gaps = 10/74 (13%)

Query: 276 ESNGWSTDINEISKVAQDSLEAGIKPT--CLVVINPGNPTGSVLTVEAIKNVFDVAAKYG 333
           E   W+ D         D L A I P    L++  P NP G V T E +  +  +  +  
Sbjct: 179 EGTEWTVDY--------DELRAAITPKTKALILNTPHNPVGKVFTREELLQIGQICVENN 230

Query: 334 LVVIADEVYQDNIF 347
           +V+I+DEVY+   F
Sbjct: 231 VVIISDEVYEHLYF 244

>Kwal_33.14582 s33 complement(728649..730226) [1578 bp, 525 aa] {ON}
           YHR137W (ARO9) - aromatic amino acid aminotransferase II
           [contig 102] FULL
          Length = 525

 Score = 38.9 bits (89), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 45/194 (23%), Positives = 81/194 (41%), Gaps = 17/194 (8%)

Query: 164 TLVDSMGYAPDSIERAKTLLTDIGSIGAYSNSQGVHGIRQTVADFITNRDDGEVAYPD-D 222
           ++VD   Y PD+       +  +     Y+ ++G+  +     DFI+  +    AY D D
Sbjct: 103 SMVDVWRYDPDAPS-----VIPLSRALQYTATRGMPPLIDFCKDFISYVNPP--AYADWD 155

Query: 223 IFLTAGASSAVSTILSILCKGQQTGVLIPIPQYPXXXXXXXXXXXXXXPYYLDESNG--- 279
           + L  G S ++  I   LC  Q   VL+    +               P  L+ S     
Sbjct: 156 LTLANGTSDSLFKIFETLCD-QGEAVLVEEFTFAPTLSNIRAAGGVPVPVKLNISADPQV 214

Query: 280 WSTDINEISKVAQDSLEAGI----KPTCLVVINPG-NPTGSVLTVEAIKNVFDVAAKYGL 334
              DI  ++++  + ++       +P  L  I  G NPTG  L+ E  + ++D+A K+  
Sbjct: 215 QGIDIGHLTELLDNWVQGPYAHLSRPKLLYTIPTGQNPTGMTLSREKRQQIYDLAEKHDF 274

Query: 335 VVIADEVYQDNIFP 348
           +++ D+ Y    FP
Sbjct: 275 IIVEDDPYGYLKFP 288

>AFR548C Chr6 complement(1422283..1423776) [1494 bp, 497 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL202W
           (ARO8)
          Length = 497

 Score = 38.1 bits (87), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 37/155 (23%), Positives = 65/155 (41%), Gaps = 9/155 (5%)

Query: 192 YSNSQGVHGIRQTVADFIT--NRDDGEVAYPD-DIFLTAGASSAVSTILSILCKGQQTGV 248
           Y  SQG    +  + DF+    R    + Y D D+  T G +SA  + L + C    T +
Sbjct: 103 YGFSQG----QPELMDFVREHTRRLHRMQYADWDVLATVGNTSAWESTLRVFCNRGDT-I 157

Query: 249 LIPIPQYPXXXXXXXXXXXXXXPYYLDESNGWSTDINEISKVAQDSLEAGIKPTCLVVIN 308
           L     +               P  LDE+      + E+    +   +   +P  L  + 
Sbjct: 158 LAEEYTFSSSLVAAEAQGVRAYPVPLDENGMVPERLGELLDNWERWHDGVPRPKLLYTVP 217

Query: 309 PG-NPTGSVLTVEAIKNVFDVAAKYGLVVIADEVY 342
            G NPTG+ L+ +  + V+ +A ++ L+++ DE Y
Sbjct: 218 TGQNPTGTCLSNDRRQAVYRLAQQHDLLIVEDEPY 252

>KLTH0G02002g Chr7 (155219..156709) [1491 bp, 496 aa] {ON} highly
           similar to uniprot|P53090 Saccharomyces cerevisiae
           YGL202W ARO8 Aromatic aminotransferase expression is
           regulated by general control of amino acid biosynthesis
          Length = 496

 Score = 38.1 bits (87), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 63/244 (25%), Positives = 102/244 (41%), Gaps = 27/244 (11%)

Query: 300 KPTCLVVINPG-NPTGSVLTVEAIKNVFDVAAKYGLVVIADEVY---QDNIFPGS----- 350
           KP  L  I  G NPTGS L+ +  K ++ +A K+  ++I DE Y   Q + +        
Sbjct: 209 KPKLLYTIPTGQNPTGSSLSDDRKKEIYRIAQKHDFIIIEDEPYYFLQMDAYEKDPSKRK 268

Query: 351 --EFHSMKKILRILQKEVPNKYDNIQLASLHSCSKGLLGECGHRGGYCEFIGFTPEVKQV 408
             EF S  + +  L K   +     ++  + S SK +LG  G R G+   +G +  + + 
Sbjct: 269 AIEFASHDEFVNSLAKSFISLDTEGRVIRMDSFSK-VLGP-GTRLGW--LVG-SKRILRA 323

Query: 409 ITKLSSISLCS-SVIGQALVDLMCCPPKKGEPSYELDQ--HERQTIRTNHKKRSNKLYEM 465
            T+L  +++ + S   QA+V       + G+  + LD     RQ          + LY+ 
Sbjct: 324 YTQLHEMTIQNPSGFSQAIVSGTLN--RWGQHGF-LDWLIGLRQEYNEKRDVAIDALYKY 380

Query: 466 FNSLEGVTCQKPQGAMYMFPNIQL---PFNAIKMAQNLDITPDEFYCRELLKATGICTVP 522
             S   +T   P   M+   NI     P  A K     ++     Y  E + A G+  VP
Sbjct: 381 VPSTPALTVTPPIAGMFFTVNIDASAHPEFATKYQSKPELVEQAIY--EKVIACGVLVVP 438

Query: 523 GSGF 526
           G  F
Sbjct: 439 GIWF 442

>CAGL0G01254g Chr7 (119281..120795) [1515 bp, 504 aa] {ON} highly
           similar to uniprot|P53090 Saccharomyces cerevisiae
           YGL202w ARO8
          Length = 504

 Score = 37.7 bits (86), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 26/48 (54%), Gaps = 1/48 (2%)

Query: 296 EAGIKPTCLVVINPG-NPTGSVLTVEAIKNVFDVAAKYGLVVIADEVY 342
           E   KP  L  I  G NPTGS L  E  K ++ +A K+  ++I DE Y
Sbjct: 202 EGAPKPKLLYTIPTGQNPTGSSLNAERKKEIYRIAQKHDFLIIEDEPY 249

>SAKL0F02156g Chr6 (185574..187070) [1497 bp, 498 aa] {ON} highly
           similar to uniprot|P53090 Saccharomyces cerevisiae
           YGL202W ARO8 Aromatic aminotransferase expression is
           regulated by general control of amino acid biosynthesis
          Length = 498

 Score = 37.7 bits (86), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 32/129 (24%), Positives = 54/129 (41%), Gaps = 6/129 (4%)

Query: 216 EVAYPD-DIFLTAGASSAVSTILSILCKGQQTGVLIPIPQYPXXXXXXXXXXXXXXPYYL 274
           ++ Y D D+  TAG ++A  + L + C    T +L     +               P  L
Sbjct: 128 DIKYADWDVLATAGNTNAWESTLRVFCNRGDT-ILAEAYSFSSSLYAAEAQGVNVFPVPL 186

Query: 275 DESNGWSTDINEISKVAQDSLEAGIKPTCLVVINPG-NPTGSVLTVEAIKNVFDVAAKYG 333
           DE   +     ++  +  +      KP  L  I  G NPTGS L+ +    ++ +A K+ 
Sbjct: 187 DE---FGIIPEKLESIMDNWNPETPKPKLLYTIPTGQNPTGSSLSDDRKAKIYRIAQKHN 243

Query: 334 LVVIADEVY 342
            ++I DE Y
Sbjct: 244 FIIIEDEPY 252

>YGL202W Chr7 (116059..117561) [1503 bp, 500 aa] {ON}  ARO8Aromatic
           aminotransferase I, expression is regulated by general
           control of amino acid biosynthesis
          Length = 500

 Score = 37.7 bits (86), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 30/129 (23%), Positives = 58/129 (44%), Gaps = 6/129 (4%)

Query: 216 EVAYPD-DIFLTAGASSAVSTILSILCKGQQTGVLIPIPQYPXXXXXXXXXXXXXXPYYL 274
           ++ Y D D+  TAG ++A  + L + C      +L+    +               P  +
Sbjct: 127 DLKYKDWDVLATAGNTNAWESTLRVFCNRGDV-ILVEAHSFSSSLASAEAQGVITFPVPI 185

Query: 275 DESNGWSTDINEISKVAQDSLEAGIKPTCLVVINPG-NPTGSVLTVEAIKNVFDVAAKYG 333
           D ++G   +  +++KV ++      KP  L  I  G NPTG+ +     + ++ +A KY 
Sbjct: 186 D-ADGIIPE--KLAKVMENWTPGAPKPKLLYTIPTGQNPTGTSIADHRKEAIYKIAQKYD 242

Query: 334 LVVIADEVY 342
            +++ DE Y
Sbjct: 243 FLIVEDEPY 251

>Smik_5.319 Chr5 complement(477840..479171) [1332 bp, 443 aa] {ON}
           YER152C (REAL)
          Length = 443

 Score = 37.4 bits (85), Expect = 0.090,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 29/47 (61%), Gaps = 2/47 (4%)

Query: 310 GNPTGSVLTVEAIKNVFDVAAKYGLVVIADEVYQ--DNIFPGSEFHS 354
            NP+G+  ++E  + + D+A KY ++VI+D+VY   D   P +E  S
Sbjct: 195 ANPSGNTYSLETRRRLIDIARKYDMLVISDDVYDILDYTTPSNELAS 241

>KAFR0D01420 Chr4 (284515..285993) [1479 bp, 492 aa] {ON} Anc_3.511
           YGL202W
          Length = 492

 Score = 37.4 bits (85), Expect = 0.096,   Method: Compositional matrix adjust.
 Identities = 41/160 (25%), Positives = 66/160 (41%), Gaps = 16/160 (10%)

Query: 222 DIFLTAGASSAVSTILSILCKGQQTGVLIPIPQYPXXXXXXXXXXXXXXPYYLDESNGWS 281
           ++ +TAG +SA  + L I C    T +L     +               P  +D+     
Sbjct: 132 ELLVTAGNTSAWESTLRIFCNRGDT-ILAEAHSFSSSLSAAQAQGIITFPVPIDDKG--- 187

Query: 282 TDINEISKVAQDSLEAGIKPTCLVVINPG-NPTGSVLTVEAIKNVFDVAAKYGLVVIADE 340
               +++ +  +      KP  L  I  G NPTGS L  E    V+ +A K+  +++ DE
Sbjct: 188 IIPEKLAAIMDNWNPETPKPKLLYTIPTGQNPTGSSLDAERKSQVYKIAQKHDFLIVEDE 247

Query: 341 VYQDNIFPGSEFHSMKKILR--ILQKEVPNKYDNIQLASL 378
            Y         F  M+  ++   L+KEV   +D   LASL
Sbjct: 248 PYY--------FLQMEDYVKDPSLRKEVKLSHDEF-LASL 278

>ZYRO0B11088g Chr2 complement(872804..874156) [1353 bp, 450 aa] {ON}
           similar to uniprot|P10356 Saccharomyces cerevisiae
           YER152C Hypothetical ORF
          Length = 450

 Score = 37.4 bits (85), Expect = 0.096,   Method: Compositional matrix adjust.
 Identities = 43/199 (21%), Positives = 88/199 (44%), Gaps = 21/199 (10%)

Query: 310 GNPTGSVLTVEAIKNVFDVAAKYGLVVIADEVYQDNIFPGSEFHSMKKILRILQ-----K 364
            NP+G   T+E  + + ++A KY ++++AD+VY    +  +   S + I R +       
Sbjct: 204 ANPSGQTYTLETRRRLIEIARKYDMLILADDVYDMLDYEQNVDKSPQPIKRFVHLDRETN 263

Query: 365 EVPNKYDNIQLASLHSCSKGLLGECGHRGGYCEFIGFTPEVKQVITKLSSISL-CSSVIG 423
           E PN + N    ++ + +   L   G R GY E I      ++++ +LS      S    
Sbjct: 264 EDPNSFGN----TISNATFSKLIAPGLRFGYHESI-----TQKLVFQLSQGGANTSGGTP 314

Query: 424 QALVDLMCCPPKKGEPSYELDQHERQTIRTNHKKRSNKLYEMFNSL--EGVTCQKPQGAM 481
             L  ++     K   +Y +      T+R  +K+R+  L +   +   +G   +  +G  
Sbjct: 315 SQLNSMIVGTMLKNGSAYNV----LATLRAAYKQRAIALRQAVITYLPKGTQMEPVKGGY 370

Query: 482 YMFPNIQLPFNAIKMAQNL 500
           + +  + L ++A ++ Q L
Sbjct: 371 FGWVTLPLGYDAKEIGQRL 389

>AEL170C Chr5 complement(318032..319408) [1377 bp, 458 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL060W
           (BNA3)
          Length = 458

 Score = 37.4 bits (85), Expect = 0.099,   Method: Compositional matrix adjust.
 Identities = 55/263 (20%), Positives = 106/263 (40%), Gaps = 48/263 (18%)

Query: 276 ESNGWSTDINEISKVAQDSLEAGIKPTCLVVIN-PGNPTGSVLTVEAIKNVFDVAAKYGL 334
           E   W  D + + +   +  +A       V+IN P NP G V T E +  + ++  + G+
Sbjct: 194 EGTEWVIDYDMLRQTINEKTKA-------VIINSPHNPIGKVFTREELLKLGNICVEKGI 246

Query: 335 VVIADEVYQDNIFPGSEFHSMKKILRILQKEVPNKYDNIQLASLHSCSKGLLGECGHRGG 394
            +I+DEVY+ +++   EF  +      L +E+          S H+ + G  G+     G
Sbjct: 247 YIISDEVYE-HLYFTDEFTRIAT----LSEEI----------SQHTLTVGSAGKSFAATG 291

Query: 395 YCEFIGFTPEVKQVITKLSS---ISLCSSVIGQALVDLMCCPPKKGEPSYELDQHERQT- 450
           +   IG+     + +  L+S   + +C S            P    E      +H  +T 
Sbjct: 292 WR--IGWVISRNKELLALASKAHVRICFS-----------SPAPLQEACAVAIEHALKTT 338

Query: 451 ----IRTNHKKRSNKLYEMFNSLEGVTCQKPQGAMYM---FPNIQLPFNAIKMAQNLDIT 503
                R  ++K+  +  + F+ L G+   + +G+ ++   F  + LP +     +  D  
Sbjct: 339 YYADTRAAYQKKYERFQKPFDDL-GLPYTRAEGSYFLLVDFSRLPLPADYHFPEELADKG 397

Query: 504 PDEFYCRELLKATGICTVPGSGF 526
            D      L+   G+  +P S F
Sbjct: 398 RDFRVAYWLINELGLVAIPCSSF 420

>TPHA0F01260 Chr6 complement(290133..291311) [1179 bp, 392 aa] {ON}
           Anc_2.252 YIL116W
          Length = 392

 Score = 37.4 bits (85), Expect = 0.099,   Method: Compositional matrix adjust.
 Identities = 44/182 (24%), Positives = 71/182 (39%), Gaps = 13/182 (7%)

Query: 211 NRDDGEVAYPD----DIFLTAGASSAVSTILSILCKGQQTGVLIPIPQYPXXXXXXXXXX 266
           N  D     PD    ++ L  G+   +  ++   CK     +++  P Y           
Sbjct: 71  NSKDNTANVPDLSHKNLCLGVGSDECIDALIRACCKPAVQKIMVLPPTYSMYSVCANIND 130

Query: 267 XXXXPY-YLDESNGWSTDINEISKVAQDSLEAGIKPTCLVVINPGNPTGSVLTVEAIKNV 325
                   + E N +  D+    K   ++L+       L + +PGNPTG ++ ++ I  V
Sbjct: 131 VDVVNCPLIVEDNSFQMDV----KRTLETLKKDDLIRLLFITSPGNPTGKIIAIKDIIYV 186

Query: 326 FDVAAKYGLVVIADEVYQDNIFPGSEFHSMKKILRILQKEVPNKYDNIQLASLHSCSKGL 385
            +   K GLVV+ DE Y D  F        KK       ++  KY N+ +    S S GL
Sbjct: 187 LE-HWKNGLVVV-DEAYVD--FSTYFNEETKKTEYFSVAKLVTKYPNLTVLQTLSKSFGL 242

Query: 386 LG 387
            G
Sbjct: 243 AG 244

>TBLA0B09330 Chr2 (2216165..2217391) [1227 bp, 408 aa] {ON}
           Anc_2.420 YLR027C
          Length = 408

 Score = 37.0 bits (84), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 53/200 (26%), Positives = 86/200 (43%), Gaps = 27/200 (13%)

Query: 271 PYYLDESNGWSTDINEISKVAQDSLEAGIKPTCLVV-INPGNPTGSVLTVEAIKNVFDVA 329
           PY+ +++   + DI+   K    ++EA  K +  V+     NPTG   T E  + V D  
Sbjct: 151 PYWKEDTK--TLDIDGWLK----TIEAAKKGSVFVLHACAHNPTGMDPTPEEWEQVLDAM 204

Query: 330 AKYGLVVIADEVYQDNIFPGSEFHSMKKILRILQKEVPNKYDNIQLASLHSCSKGLLGEC 389
           AKY  + + D  YQ   F   +     K +R+   ++ +K   I +    S + GL GE 
Sbjct: 205 AKYHHIALFDSAYQG--FASGDLDRDAKAIRLGHAKL-SKQSPIIICQSFSKNLGLYGE- 260

Query: 390 GHRGGYCEFIGFTPEVK-QVITKLSSISLCSSVIGQALVDLMCCPPKKGE--PSYELDQH 446
             R G    +  T   K  +I++LS+++                PP  G    S  L QH
Sbjct: 261 --RIGCLHIVNPTSASKANIISQLSTLTRSE----------YSNPPAYGADIASRILSQH 308

Query: 447 E-RQTIRTNHKKRSNKLYEM 465
           E R     + K  S+++Y+M
Sbjct: 309 ELRDQWYIDMKTMSSRIYKM 328

>Ecym_6292 Chr6 (547563..548855) [1293 bp, 430 aa] {ON} similar to
           Ashbya gossypii AEL170C
          Length = 430

 Score = 37.0 bits (84), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 52/222 (23%), Positives = 91/222 (40%), Gaps = 37/222 (16%)

Query: 276 ESNGWSTDINEISKVAQDSLEAGIKPTCLVVINPGNPTGSVLTVEAIKNVFDVAAKYGLV 335
           E+N W  D   +     D      K   +++ NP NP G V   + +  +  +    G  
Sbjct: 163 EANDWILDRETLRAAFTD------KTKLMIINNPNNPLGKVFNRDELLEMATLCVNNGAY 216

Query: 336 VIADEVYQDNIF---PGSEFHSMKKILRILQKEVPNKYDNIQLASLHSCSKGLLGECGHR 392
           +IADEVY+   F   P S   ++ +   I QK +          ++ S  K +    G R
Sbjct: 217 IIADEVYEFLQFTPNPLSRISNLSE--AIAQKTI----------TIGSAGK-IFRVTGWR 263

Query: 393 GGYCEFIGFTPEVKQVITKLS-SISLCSSVIGQALVDLMCCPPKKGEPSYELDQHERQTI 451
            G+   I    E+ + +T +   +  CS  I Q    L     +  E  Y L      ++
Sbjct: 264 VGW--MISKNRELVEKVTAVHVRMGFCSPSISQVASGLGI--QRALECGYFL------SM 313

Query: 452 RTNHKKRSNKLYEMFNSLEGVTCQKPQGAMYM---FPNIQLP 490
                ++ + +Y+  + L GV+  KPQGA ++   F  +++P
Sbjct: 314 PNEFDRKFSIIYKALDYL-GVSYTKPQGAHFIITDFSKVKIP 354

>KNAG0B00660 Chr2 (115417..116907) [1491 bp, 496 aa] {ON} Anc_3.511
           YGL202W
          Length = 496

 Score = 37.0 bits (84), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 29/122 (23%), Positives = 50/122 (40%), Gaps = 5/122 (4%)

Query: 222 DIFLTAGASSAVSTILSILCKGQQTGVLIPIPQYPXXXXXXXXXXXXXXPYYLDESNGWS 281
           D+  T G ++A  + L + C      +L     +               P  +DE     
Sbjct: 132 DVVATTGNTNAWESTLRVFCDKGDV-ILAEAHSFSSCLAAAQAQGIITFPIPIDEH---G 187

Query: 282 TDINEISKVAQDSLEAGIKPTCLVVINPG-NPTGSVLTVEAIKNVFDVAAKYGLVVIADE 340
               ++ ++  +  E   KP  L  I  G NPTGS L+ +  + ++ VA K+  ++I DE
Sbjct: 188 IIPEKLEQILDNWTEGAPKPKLLYTIPTGQNPTGSSLSDDRKEKIYKVAQKHDFIIIEDE 247

Query: 341 VY 342
            Y
Sbjct: 248 PY 249

>Ecym_6319 Chr6 complement(607599..608663) [1065 bp, 354 aa] {ON}
           similar to Ashbya gossypii AEL170C
          Length = 354

 Score = 37.0 bits (84), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 36/69 (52%), Gaps = 8/69 (11%)

Query: 280 WSTDINEISKVAQDSLEAGIKPTCLVVIN-PGNPTGSVLTVEAIKNVFDVAAKYGLVVIA 338
           W+ D ++      +  +A       V+IN P NPTG V T E +  + ++  +  + +I+
Sbjct: 168 WTLDFDQFRSAISEKTKA-------VIINSPHNPTGKVFTREELLTLGNICVEKNVYIIS 220

Query: 339 DEVYQDNIF 347
           DEVY++  F
Sbjct: 221 DEVYENLYF 229

>Kpol_1039.22 s1039 (68736..69896) [1161 bp, 386 aa] {ON}
           (68736..69896) [1161 nt, 387 aa]
          Length = 386

 Score = 37.0 bits (84), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 39/168 (23%), Positives = 70/168 (41%), Gaps = 15/168 (8%)

Query: 221 DDIFLTAGASSAVSTILSILCKGQQTGVLIPIPQYPXXXXXXXXXXXXXXPY-YLDESNG 279
           D++ L  G+   + +++   C+ +   +L   P Y                   + E N 
Sbjct: 85  DNLCLGVGSDECIDSLIRACCRPEVDKILTLPPTYSMYSVCANINDVEIVECPLITEDNS 144

Query: 280 WSTDINEISKVAQDSLEAGIKPTCLVVINPGNPTGSVLTVEAIKNVFDVAAKYGLVVIAD 339
           +  ++ E+      +L+   K   L + +PGNPTG ++  + I+ + +     GLVV+ D
Sbjct: 145 FQMNVPEV----LSTLKNDPKIKLLFITSPGNPTGKLVNKKDIEFILENWTN-GLVVV-D 198

Query: 340 EVYQDNIFPGSEFHSMKKILRILQKEVPNKYDNIQLASLHSCSKGLLG 387
           E Y D        +SM K++         KY N+ +    S S GL G
Sbjct: 199 EAYIDFADAEGTTYSMAKLV--------TKYPNLTVLQTLSKSFGLAG 238

>NCAS0A09200 Chr1 complement(1819134..1820471) [1338 bp, 445 aa]
           {ON} Anc_1.321 YJL060W
          Length = 445

 Score = 37.0 bits (84), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 20/75 (26%), Positives = 36/75 (48%), Gaps = 8/75 (10%)

Query: 274 LDESNGWSTDINEISKVAQDSLEAGIKPTCLVVIN-PGNPTGSVLTVEAIKNVFDVAAKY 332
           + E   W+ D+ +         +A       V+IN P NP G V T E +  + ++  + 
Sbjct: 179 VTEGTEWTVDMEQFKNAITSKTKA-------VIINTPHNPIGKVFTREELLQIGNICVEK 231

Query: 333 GLVVIADEVYQDNIF 347
            +++I+DEVY+   F
Sbjct: 232 NVIIISDEVYEHLYF 246

>YER152C Chr5 complement(472657..473988) [1332 bp, 443 aa] {ON}
           Protein with 2-aminoadipate transaminase activity;
           shares amino acid similarity with the aminotransferases
           Aro8p and Aro9p; YER152C is not an essential gene
          Length = 443

 Score = 36.6 bits (83), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 26/93 (27%), Positives = 46/93 (49%), Gaps = 4/93 (4%)

Query: 310 GNPTGSVLTVEAIKNVFDVAAKYGLVVIADEVYQ--DNIFPGSEFHSMK-KILRILQKEV 366
            NP+G+  ++E  + + D+A KY +++I D+VY   D   P  E  S   +++ I +   
Sbjct: 195 ANPSGNTYSLETRRRLIDIARKYDMLIITDDVYDILDYTTPSDELPSPPLRMVHIDRSTA 254

Query: 367 PNKYDNIQLASLHSCSKGLLGECGHRGGYCEFI 399
           P+  D+      ++    L+   G R GY E I
Sbjct: 255 PSGEDSFGNTVSNATFSKLIAP-GLRFGYHESI 286

>KNAG0G01680 Chr7 complement(369892..371250) [1359 bp, 452 aa] {ON}
           Anc_8.204 YER152C
          Length = 452

 Score = 36.6 bits (83), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 23/34 (67%)

Query: 310 GNPTGSVLTVEAIKNVFDVAAKYGLVVIADEVYQ 343
            NP+G   ++E  K + D+A KY +++IAD+VY 
Sbjct: 205 ANPSGMSFSLETKKKLLDLARKYDMLIIADDVYD 238

>ADL249W Chr4 (261227..262390) [1164 bp, 387 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL116W (HIS5)
          Length = 387

 Score = 36.2 bits (82), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 54/208 (25%), Positives = 88/208 (42%), Gaps = 31/208 (14%)

Query: 222 DIFLTAGASSAVSTILSILCKGQQTGVLIPIPQYPXXXXXXXXXXXXXXPYYLDESNGWS 281
           +I L  G+  ++  I+   C  ++  V++  P Y                  L  S+  S
Sbjct: 89  NICLGVGSDESIDAIIRATCSPREQKVMLLPPTYGMYKVCADINDVGYVEVPLISSDN-S 147

Query: 282 TDINEISKVAQDSLEAGIKPTCLVVINPGNPTGSVLTVEAIKNVFDVAAKYGLVVIADEV 341
             I+E   + Q +L+  IK   + + +PGNPTG+ + V  ++ +       G+VV+ DE 
Sbjct: 148 FQIDEDRILEQLNLDKSIK--VVFITSPGNPTGACIEVGRVEKLLR-NWTAGIVVV-DEA 203

Query: 342 YQDNIFPGSEFHSMKKILRILQKEVPNKYDNIQLASLHSCSKGLLGECGHRGGYCEFIGF 401
           Y D       F + K  L  L  + PN      L  L + SK   G  G R      +GF
Sbjct: 204 YID-------FSADKPSLSPLVNKHPN------LVVLQTLSKA-SGLAGIR------LGF 243

Query: 402 TPEVKQVITKLSS------ISLCSSVIG 423
           T    Q+ T L++      IS  +++IG
Sbjct: 244 TFASTQIATALNAMKAPYNISQITAIIG 271

>Kwal_47.18982 s47 complement(1051414..1052904) [1491 bp, 496 aa]
           {ON} YGL202W (ARO8) - 1:1 [contig 188] FULL
          Length = 496

 Score = 36.2 bits (82), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 63/244 (25%), Positives = 102/244 (41%), Gaps = 27/244 (11%)

Query: 300 KPTCLVVINPG-NPTGSVLTVEAIKNVFDVAAKYGLVVIADE--------VYQDNIFPGS 350
           KP  L  I  G NPTGS L+ +    ++ +A K+ L++I DE         YQ ++    
Sbjct: 209 KPKLLYTIPTGQNPTGSSLSDDRKVEIYRIAKKHDLLIIEDEPYYFLQMDAYQKDVSQRK 268

Query: 351 EFH--SMKKILRILQKEVPNKYDNIQLASLHSCSKGLLGECGHRGGYCEFIGFTPEVKQV 408
           E H  S +  +  L K   +     ++  L S SK +LG  G R G+   +G + ++ Q 
Sbjct: 269 ETHFASQEDFVNSLAKSFISLDTEGRVLRLDSFSK-VLGP-GTRLGWI--VG-SKKILQK 323

Query: 409 ITKLSSISLCS-SVIGQALVDLMCCPPKKGEPSYELDQHERQTIRTNHKKRS--NKLYEM 465
            T+L  +++ + S   QA+V       + G+  + LD         N K+    + LY+ 
Sbjct: 324 YTQLHEMTIQNPSGFSQAIV--AGTLNRWGQDGF-LDWLVGLRREYNEKRDVAIDALYKY 380

Query: 466 FNSLEGVTCQKPQGAMYMFPNIQL---PFNAIKMAQNLDITPDEFYCRELLKATGICTVP 522
                  T   P   M+   N      P  A K     ++     Y  E + A+G+  VP
Sbjct: 381 LPETPAFTINPPIAGMFFTVNTDASAHPEFATKYQSKPELVEQAIY--EKVIASGVLVVP 438

Query: 523 GSGF 526
           G  F
Sbjct: 439 GVWF 442

>NDAI0G05760 Chr7 (1427844..1429190) [1347 bp, 448 aa] {ON}
           Anc_1.321
          Length = 448

 Score = 36.2 bits (82), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 54/260 (20%), Positives = 103/260 (39%), Gaps = 38/260 (14%)

Query: 274 LDESNGWSTDINEISKVAQDSLEAGIKPTCLVVINPGNPTGSVLTVEAIKNVFDVAAKYG 333
           + E   W+ D  +         +A      ++V +P NP G V T E +  + ++  +  
Sbjct: 182 ITEGTEWTIDFEQFRNAITPKTKA------VIVNSPHNPIGKVFTKEELTKLGEICVENN 235

Query: 334 LVVIADEVYQDNIFPGSEFHSMKKILRI--LQKEVPNKYDNIQLASLHSCSKGLLGECGH 391
           +++I+DEVY+   F  S         RI  L  E+       QL      +       G 
Sbjct: 236 VIIISDEVYEFLYFNDS-------FTRIATLSPEIG------QLTLTVGSAGKTFAATGW 282

Query: 392 RGGYCEFIGFTPEVKQVITKL-SSISLCS-SVIGQALVDLMCCPPKKGEPSYELDQHERQ 449
           R G+   I   PE+ Q ++K  + I   S S + +A  + +         +  L+    +
Sbjct: 283 RIGWV--ISQNPELLQYVSKAHTRICFASPSPLQEACANSI---------NDALESGYFE 331

Query: 450 TIRTNHKKRSNKLYEMFNSLEGVTCQKPQGAMYM---FPNIQLPFNAIKMAQNLDITPDE 506
            +R  + ++      +F  L G+   KP+G  ++   F  +++P +     + LD   D 
Sbjct: 332 KMRKEYVQKFKIFNAVFEEL-GLPYTKPEGTYFVLADFSKVKIPEDYPWPEEILDKGKDF 390

Query: 507 FYCRELLKATGICTVPGSGF 526
                L+   G+  +P + F
Sbjct: 391 RISHWLINELGVVAIPPTEF 410

>NDAI0I02830 Chr9 complement(669885..671387) [1503 bp, 500 aa] {ON}
           Anc_3.511
          Length = 500

 Score = 36.2 bits (82), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 30/129 (23%), Positives = 55/129 (42%), Gaps = 6/129 (4%)

Query: 216 EVAYPD-DIFLTAGASSAVSTILSILCKGQQTGVLIPIPQYPXXXXXXXXXXXXXXPYYL 274
           ++ Y D DI  TAG ++A  + L + C      +L     +               P  +
Sbjct: 126 DIKYQDWDIIATAGNTNAWESTLRVFCNRGDV-ILAEAHSFSSCLAAAQAQGITTFPIPI 184

Query: 275 DESNGWSTDINEISKVAQDSLEAGIKPTCLVVINPG-NPTGSVLTVEAIKNVFDVAAKYG 333
           D+ NG   +  ++ K+  +      KP  L  I  G NPTG+ L    ++ ++ +A K+ 
Sbjct: 185 DD-NGIIPE--KLEKILDNWTPGAPKPKLLYTIPTGQNPTGTSLPAHRMEEIYRIAQKHD 241

Query: 334 LVVIADEVY 342
            +++ D  Y
Sbjct: 242 FLIVEDAPY 250

>TPHA0O01520 Chr15 (304547..306058) [1512 bp, 503 aa] {ON} Anc_2.102
           YHR137W
          Length = 503

 Score = 36.2 bits (82), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 30/50 (60%), Gaps = 1/50 (2%)

Query: 300 KPTCLVVINPG-NPTGSVLTVEAIKNVFDVAAKYGLVVIADEVYQDNIFP 348
           KP  L  I  G NPTG  L++E  + ++++  K+ ++++ D+ Y   +FP
Sbjct: 208 KPKMLYTIATGQNPTGMTLSMEKRRKIYEICQKHDIIILEDDPYGYLLFP 257

>Kpol_278.2 s278 (2488..3984) [1497 bp, 498 aa] {ON} (2488..3984)
           [1497 nt, 499 aa]
          Length = 498

 Score = 36.2 bits (82), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 32/123 (26%), Positives = 48/123 (39%), Gaps = 7/123 (5%)

Query: 222 DIFLTAGASSAVSTILSILCKGQQTGVLIPIPQYPXXXXXXXXXXXXXXPYYLDESNGWS 281
           DI LT G ++   + L + C      +L     +               P  +DE     
Sbjct: 132 DIILTTGNTNGWESTLRVFCNKGDV-ILAEAHSFSSSLASAEAQGITTFPIPIDEHGIIP 190

Query: 282 TDINEISKVAQDSLEAGI-KPTCLVVINPG-NPTGSVLTVEAIKNVFDVAAKYGLVVIAD 339
             + EI     D+   G  KP  L  I  G NPTG+ L  E    ++ +A K+  ++I D
Sbjct: 191 EKLEEI----LDNWTPGAPKPKLLYTIPTGQNPTGTSLADERKVEIYRIACKHDFLIIED 246

Query: 340 EVY 342
           E Y
Sbjct: 247 EPY 249

>TPHA0D03370 Chr4 complement(704980..706473) [1494 bp, 497 aa] {ON}
           Anc_3.511 YGL202W
          Length = 497

 Score = 35.8 bits (81), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 33/129 (25%), Positives = 53/129 (41%), Gaps = 6/129 (4%)

Query: 216 EVAYPD-DIFLTAGASSAVSTILSILCKGQQTGVLIPIPQYPXXXXXXXXXXXXXXPYYL 274
           E  Y D D  LT G ++   + L I C      +L     +               P  +
Sbjct: 125 EFNYSDWDSILTTGNTNGWESTLRIFCNKGDV-ILAEAHSFSSSLASAEAQGVITFPVPI 183

Query: 275 DESNGWSTDINEISKVAQDSLEAGIKPTCLVVINPG-NPTGSVLTVEAIKNVFDVAAKYG 333
           D S+G   +  ++  +  +      KP  L  I  G NPTGS L+ E  + ++ +A K+ 
Sbjct: 184 D-SDGIIPE--KLESILDNWTPGSPKPKLLYTIPTGQNPTGSSLSDERKEAIYKIACKHD 240

Query: 334 LVVIADEVY 342
            ++I DE Y
Sbjct: 241 FIIIEDEPY 249

>Kpol_480.1 s480 (215..1357) [1143 bp, 380 aa] {ON} (215..1357)
           [1143 nt, 381 aa]
          Length = 380

 Score = 35.4 bits (80), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 77/331 (23%), Positives = 122/331 (36%), Gaps = 72/331 (21%)

Query: 221 DDIFLTAGASSAVSTILSILCKGQQTGVLIPIPQYPXXXXXXXXXXXXXXPYYLDESNGW 280
           DDI LT GA  A       L  G    V+   P Y                Y + E  G 
Sbjct: 79  DDILLTNGAIGANFLAFYTLV-GAGDHVICVEPTYSQL-------------YSVPEMFGA 124

Query: 281 STDINEISKVAQ-----DSLEAGIKP-TCLVVIN-PGNPTGSVLTVEAIKNVFDVAAKYG 333
             D+  + K         +L++ IK  T L++IN P NP GSV+  + +K +  +  +  
Sbjct: 125 EVDLLTLKKEDDFLPNLQTLKSMIKNNTKLIIINNPNNPLGSVIKKDLLKQICKLCEEND 184

Query: 334 LVVIADEVY-------QDNIFPGSEFHSMKKILRILQKEVPNKYD--NIQLASLHSCSKG 384
           + + +DEVY       +D + P S      K   I+   +   Y    I+L  L S  K 
Sbjct: 185 IYLHSDEVYRPIFHSLEDEMVPPSACELYSK--AIVSGSMSKAYSVAGIRLGWLVSKDKQ 242

Query: 385 LLGECGHRGGYCEFIGFTPEVKQVITKLSSISLCSSVIGQALVDLMCCPPKKGEPSYELD 444
            L +   R  Y                + S+S+    I Q ++D      K+   +YEL 
Sbjct: 243 FLRDAASRRDY---------------NMISVSMIDDQIAQYVLDNREYVIKR---NYELC 284

Query: 445 QHERQTIRTNHKKRSNKLYEMFNSLEGVTCQKPQGAMYMFPNIQLPFNAIKMAQNLDITP 504
            +  + +     + S+K +E +         KP  A      ++   + +K A       
Sbjct: 285 LNNFRLLNDFMDEHSDK-FEFY--------HKPTAATVCLAKVKGVNDTMKFATF----- 330

Query: 505 DEFYCRELLKATGICTVPGSGFGQQPGTYHV 535
                  L +  G+  VPG  FG  PGT  +
Sbjct: 331 -------LAEKYGVLAVPGEAFG-VPGTIRI 353

>Skud_5.290 Chr5 complement(463643..464974) [1332 bp, 443 aa] {ON}
           YER152C (REAL)
          Length = 443

 Score = 35.0 bits (79), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 27/47 (57%), Gaps = 2/47 (4%)

Query: 310 GNPTGSVLTVEAIKNVFDVAAKYGLVVIADEVYQ--DNIFPGSEFHS 354
            NP+G+  ++E  + + D+A +Y ++VI D+VY   D   P  E  S
Sbjct: 195 ANPSGNTYSLETRRRLIDIARQYDMLVITDDVYDILDYTTPADELPS 241

>NCAS0G04050 Chr7 complement(753216..754370) [1155 bp, 384 aa] {ON}
           Anc_1.472
          Length = 384

 Score = 35.0 bits (79), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 38/166 (22%), Positives = 67/166 (40%), Gaps = 20/166 (12%)

Query: 191 AYSNSQGVHGIRQTVADFITNRDDGEVAYPDDIFLTAGASSAVSTILSILCKGQQTGVLI 250
            Y + +G   +R  +A        G     D++ +T GA +A   I   L  G    V+ 
Sbjct: 54  TYGSIKGSDKLRSLIASMY-----GPEFNKDNVLVTNGAIAANFLIYYTLV-GPGDHVIC 107

Query: 251 PIPQYPXXXXXXXXXXXXXXPYYLDESNGWSTDINEISKVAQDSLEAGIKPTCLVVIN-P 309
             P Y                  L + +G+  +I  + K+ + +       T L++IN P
Sbjct: 108 VDPTYAQLYSVPKMFGAEVSLLKLQKEDGFIPNIETLKKMIKSN-------TKLIIINNP 160

Query: 310 GNPTGSVLTVEAIKNVFDVAAKYGLVVIADEVYQDNIFPGSEFHSM 355
            NP GS ++ E + ++  +  +  + +  DEVY+        FHSM
Sbjct: 161 NNPLGSAISTETLNDICQLCEENNIYLHCDEVYK------PIFHSM 200

>Smik_7.69 Chr7 (111132..112634) [1503 bp, 500 aa] {ON} YGL202W
           (REAL)
          Length = 500

 Score = 35.0 bits (79), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 29/129 (22%), Positives = 57/129 (44%), Gaps = 6/129 (4%)

Query: 216 EVAYPD-DIFLTAGASSAVSTILSILCKGQQTGVLIPIPQYPXXXXXXXXXXXXXXPYYL 274
           ++ Y D D+F TAG ++A  + L + C      +L     +               P  +
Sbjct: 127 DLKYKDWDVFATAGNTNAWESTLRLFCNRGDV-ILAEAHSFSSSLASAEAQGVITFPVPI 185

Query: 275 DESNGWSTDINEISKVAQDSLEAGIKPTCLVVINPG-NPTGSVLTVEAIKNVFDVAAKYG 333
           D ++G   +  +++K+  +      KP  L  I  G NPTG+ +     + ++ +A K+ 
Sbjct: 186 D-ADGIIPE--KLAKIMDNWTPNAPKPKLLYTIPTGQNPTGTSIANHRKEAIYKIAQKHD 242

Query: 334 LVVIADEVY 342
            +++ DE Y
Sbjct: 243 FLIVEDEPY 251

>NCAS0A03830 Chr1 (778327..779667) [1341 bp, 446 aa] {ON} Anc_8.204
          Length = 446

 Score = 35.0 bits (79), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 43/208 (20%), Positives = 89/208 (42%), Gaps = 38/208 (18%)

Query: 311 NPTGSVLTVEAIKNVFDVAAKYGLVVIADEVYQDNIFPGSEF-----HSMKKILRILQKE 365
           NP+G+  +++    + ++A +Y +++I+D+VY  ++    +F     H  K+ +  L +E
Sbjct: 199 NPSGNTYSLKTKLKLIELARRYDMLIISDDVY--DLLDYEQFLDVLPHVPKRFVH-LDRE 255

Query: 366 VPNKYDNIQLASLHSCSKGLLGECGHRGGYCEFIGFTPEVKQVITKLSS----------I 415
                +N    +L + +   +   G R GY E I       +++ +LS            
Sbjct: 256 TSTHPENSFGNTLSNATFSKIIAPGLRFGYTESIS-----NKLVLQLSRGGANTSGGTPS 310

Query: 416 SLCSSVIGQALVDLMCCPPKKGEPSYELDQHERQTIRTNHKKRSNKLYEMFNSL--EGVT 473
            L S ++G  L        K G     L       +R  +K+RS  +YE           
Sbjct: 311 QLNSMIVGTML--------KNG-----LVDKVLHNLRQTYKERSVVMYESIKRWLPRKTQ 357

Query: 474 CQKPQGAMYMFPNIQLPFNAIKMAQNLD 501
           CQ  +G  + +  + L ++A+++ + L+
Sbjct: 358 CQLQKGGYFTWITLPLGYDAVEIGKMLN 385

>NCAS0B07220 Chr2 (1366278..1367810) [1533 bp, 510 aa] {ON}
           Anc_2.102
          Length = 510

 Score = 34.7 bits (78), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 29/50 (58%), Gaps = 1/50 (2%)

Query: 300 KPTCLVVINPG-NPTGSVLTVEAIKNVFDVAAKYGLVVIADEVYQDNIFP 348
           KP  L  I+ G NP G  L++E  + ++ +A ++ L+++ D+ Y    FP
Sbjct: 223 KPKILYTISTGQNPMGMTLSMEKREKIYQIAQQHDLIILEDDPYTYLTFP 272

>NCAS0E00670 Chr5 (117006..118499) [1494 bp, 497 aa] {ON} Anc_3.511
          Length = 497

 Score = 34.7 bits (78), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 39/154 (25%), Positives = 58/154 (37%), Gaps = 16/154 (10%)

Query: 216 EVAYPD-DIFLTAGASSAVSTILSILCKGQQTGVLIPIPQYPXXXXXXXXXXXXXXPYYL 274
           ++ Y D D+  TAG ++A  + L + C      +L     +               P  +
Sbjct: 126 DMQYEDWDVVATAGNTNAWESTLRVFCNRGDV-ILAEAHSFSSCLAAAQAQGITTFPVPI 184

Query: 275 DESNGWSTDINEISKVAQDSLEAGI-KPTCLVVINPG-NPTGSVLTVEAIKNVFDVAAKY 332
           D+       +  I     D+   G  KP  L  I  G NPTG+ L  E    +F +A K+
Sbjct: 185 DDKGIIPAKLEAI----LDNWTPGAPKPKLLYTIPTGQNPTGTSLADERKPEIFRIAQKH 240

Query: 333 GLVVIADEVYQDNIFPGSEFHSMKKILRILQKEV 366
             ++I D  Y         F  M K  R LQK  
Sbjct: 241 DFLIIEDAPYY--------FLQMDKYERDLQKRA 266

>KLLA0A04906g Chr1 (437523..438965) [1443 bp, 480 aa] {ON} similar
           to uniprot|P53090 Saccharomyces cerevisiae YGL202W ARO8
           Aromatic aminotransferase expression is regulated by
           general control of amino acid biosynthesis
          Length = 480

 Score = 34.3 bits (77), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 31/124 (25%), Positives = 53/124 (42%), Gaps = 7/124 (5%)

Query: 222 DIFLTAGASSAVSTILSILCKGQQTGVLIPIPQYPXXXXXXXXXXXXXXPYYLDESNGWS 281
           D+  TAG++ A    L + C   +T VL+    Y                  +D+     
Sbjct: 128 DLITTAGSTQAWDACLRLFCNRGET-VLMEEYTYSSSLEAAVAQGLNCVAMKMDKD---G 183

Query: 282 TDINEISKVAQDSLEA--GIKPTCLVVI-NPGNPTGSVLTVEAIKNVFDVAAKYGLVVIA 338
             ++++S++ +D   A  G  P  L  I N  NPTG  L  E    +  +A++Y  ++I 
Sbjct: 184 IKVDKLSEMLRDWDVAVQGPFPKLLYTIPNGHNPTGCTLHEERKPELVRLASQYDFIIIE 243

Query: 339 DEVY 342
           D+ Y
Sbjct: 244 DDPY 247

>KNAG0E01850 Chr5 (381827..382981) [1155 bp, 384 aa] {ON} Anc_2.252
           YIL116W
          Length = 384

 Score = 34.3 bits (77), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 29/124 (23%), Positives = 52/124 (41%), Gaps = 7/124 (5%)

Query: 222 DIFLTAGASSAVSTILSILCKGQQTGVLIPIPQYPXXXXXXXXXXXXXXPY-YLDESNGW 280
           +I L  G+  ++  I+   C   +  +L+  P Y                   + E N +
Sbjct: 89  NICLGVGSDESIDAIIRATCVPAREKILVLPPTYSMYSVCAKINDVEVVTCPLITEDNSF 148

Query: 281 STDINEISKVAQDSLEAGIKPTCLVVINPGNPTGSVLTVEAIKNVFDVAAKYGLVVIADE 340
             D +++  +  +  E  +    L + +PGNPTG+ +    I+ V     + GLVV+ DE
Sbjct: 149 QMDSDKVLDILNNDQEIKL----LFITSPGNPTGAQIETARIEKVLQNWDR-GLVVV-DE 202

Query: 341 VYQD 344
            Y D
Sbjct: 203 AYVD 206

>KLTH0D05478g Chr4 (488881..490146) [1266 bp, 421 aa] {ON} similar
           to uniprot|Q01802 Saccharomyces cerevisiae YKL106W AAT1
           Mitochondrial aspartate aminotransferase catalyzes the
           conversion of oxaloacetate to aspartate in aspartate and
           asparagine biosynthesis
          Length = 421

 Score = 34.3 bits (77), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 38/164 (23%), Positives = 63/164 (38%), Gaps = 7/164 (4%)

Query: 227 AGASSAVSTILSILCKGQQTGVLIPIPQYPXXXXXXXXXXXXXXPYYLDESNGWSTDINE 286
            GA +  S +LS+        V IP P +P               YY    +G     + 
Sbjct: 122 TGALAVASKLLSLF---MSKAVWIPNPSWPNHANVFQNNGFKRINYYTYYRDGGLDVDSW 178

Query: 287 ISKVAQDSLEAGIKPTCLVV-INPGNPTGSVLTVEAIKNVFDVAAKYGLVVIADEVYQDN 345
           +  + Q   +    P C+V+     NPTG   ++E  + + D   +  L+ I D  YQ  
Sbjct: 179 LQDLEQAVRDGDGSPQCIVLHACCHNPTGVDPSLEQWRTILDKINELNLIPIIDMAYQG- 237

Query: 346 IFPGSEFHSMKKILRILQKEVPNKYDN-IQLASLHSCSKGLLGE 388
                + H    +LR+   E   ++ N + L    + + GL GE
Sbjct: 238 -LDTGDLHKDAYLLRMSLDEERYQWPNGLFLCQSFAKNMGLYGE 280

>Kpol_1032.39 s1032 complement(90576..91937) [1362 bp, 453 aa] {ON}
           complement(90576..91937) [1362 nt, 454 aa]
          Length = 453

 Score = 34.3 bits (77), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 41/188 (21%), Positives = 69/188 (36%), Gaps = 35/188 (18%)

Query: 191 AYSNSQGVHGIRQTVADFIT------NRDDGEVAYPDDIFLTAGASSAVSTIL---SILC 241
            Y +++G   +R  + +F+       +RDD   + P+ + LT+GAS  V  IL   ++  
Sbjct: 50  TYGSNEGALWVRTAITEFVNEKAFKFDRDDKARSKPEYLNLTSGASYGVLNILLQATLPH 109

Query: 242 KGQQTGVLIPIPQYPXXXXXXXXXXXXXXPYYLDESNGWSTD------------------ 283
            G      I  P Y                  +DE    S D                  
Sbjct: 110 TGVTKQAFIVSPTYFLINDCFIDAGFGGKLTAIDEKGEESIDLELLEAKLKHFESIDPNP 169

Query: 284 INEISK--------VAQDSLEAGIKPTCLVVINPGNPTGSVLTVEAIKNVFDVAAKYGLV 335
           +NE  K        +    L+   K    V+    NP+G    +E    + ++A KY ++
Sbjct: 170 VNENGKELSIIKNPIDISHLKKVYKYVIYVIPTYSNPSGKTYNLETRCKLIELARKYDML 229

Query: 336 VIADEVYQ 343
           +I D+VY 
Sbjct: 230 IITDDVYD 237

>TBLA0B00990 Chr2 complement(221196..222836) [1641 bp, 546 aa] {ON}
           Anc_2.102 YHR137W
          Length = 546

 Score = 34.3 bits (77), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 29/50 (58%), Gaps = 1/50 (2%)

Query: 300 KPTCLVVINPG-NPTGSVLTVEAIKNVFDVAAKYGLVVIADEVYQDNIFP 348
           +P+ L  I+ G NPTG  +++E    ++ +A KY  +++ D+ Y    +P
Sbjct: 225 RPSILYTISTGQNPTGLTISMENRARIYKLAQKYNFLIVEDDPYSYMSYP 274

>Ecym_3290 Chr3 (546773..547933) [1161 bp, 386 aa] {ON} similar to
           Ashbya gossypii ADL249W
          Length = 386

 Score = 33.9 bits (76), Expect = 1.00,   Method: Compositional matrix adjust.
 Identities = 40/167 (23%), Positives = 71/167 (42%), Gaps = 19/167 (11%)

Query: 222 DIFLTAGASSAVSTILSILCKGQQTGVLIPIPQYPXXXXXXXXXXXXXXPY-YLDESNGW 280
           +I L  G+   V +++   C  +   VL+  P Y                   + E N +
Sbjct: 89  NICLGVGSDEGVDSLIRATCVPKTDKVLVLPPTYSMYSVFAMINDTEVVECPLITEDNSF 148

Query: 281 STDINEISKVAQDSLEAGIKPTCLVVINPGNPTGSVLTVEAIKNVFDVAAKYGLVVIADE 340
             D++ + +   +  +  IK   L +  PGNPTG+ ++ + I+ + +  +  G+VV+ DE
Sbjct: 149 DMDLDNVLETLSN--DDSIK--LLFITTPGNPTGASISTQKIEMLLNNWSA-GIVVV-DE 202

Query: 341 VYQDNIFPGSEFHSMKKILRILQKEVPNKYDNIQLASLHSCSKGLLG 387
            Y D  F  S+  +           + NKY N+ +    S S GL G
Sbjct: 203 AYID--FSSSDSAA----------PLVNKYPNLVVIQTLSKSFGLAG 237

>Suva_5.281 Chr5 complement(444090..445442) [1353 bp, 450 aa] {ON}
           YER152C (REAL)
          Length = 450

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 12/33 (36%), Positives = 23/33 (69%)

Query: 310 GNPTGSVLTVEAIKNVFDVAAKYGLVVIADEVY 342
            NP+G+  ++E  + + ++A KY ++VI D+VY
Sbjct: 202 ANPSGNTYSLETRRRLIEIARKYDMLVITDDVY 234

>SAKL0E08492g Chr5 complement(692049..693203) [1155 bp, 384 aa] {ON}
           similar to uniprot|P07172 Saccharomyces cerevisiae
           YIL116W HIS5 Histidinol-phosphate aminotransferase
           catalyzes the seventh step in histidine biosynthesis
           responsive to general control of amino acid biosynthesis
           mutations cause histidine auxotrophy and sensitivity to
           Cu Co and Ni salts
          Length = 384

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 40/171 (23%), Positives = 69/171 (40%), Gaps = 26/171 (15%)

Query: 221 DDIFLTAGASSAVSTILSILCKGQQTGVLIPIPQYPXXXXXXXXXXXXXXPYYL-DESNG 279
           ++I L  G+  ++  ++ + C   +  ++I  P Y                  L  E N 
Sbjct: 88  ENICLGVGSDESIDALIRVCCVPSKDKIMIMPPTYGMYSICADINDVGCVKVPLVAEDNS 147

Query: 280 WSTDINEI-SKVAQDSLEAGIKPT--CLVVINPGNPTGSVLTVEAIKNVFDVAAKYGLVV 336
           +  D +++   +AQD       PT   + + +PGNPT +++    I+ V +     G +V
Sbjct: 148 FQMDTSKVLETLAQD-------PTIKLIFITSPGNPTAALIDTAEIEKVLNNWT--GGLV 198

Query: 337 IADEVYQDNIFPGSEFHSMKKILRILQKEVPNKYDNIQLASLHSCSKGLLG 387
           + DE Y D  F G     +            NKY N+ +    S S GL G
Sbjct: 199 VVDEAYID--FCGGSTTPLV-----------NKYPNLAVIQTMSKSFGLAG 236

>ZYRO0A01672g Chr1 (136284..137444) [1161 bp, 386 aa] {ON} highly
           similar to uniprot|P07172 Saccharomyces cerevisiae
           YIL116W HIS5 Histidinol-phosphate aminotransferase
           catalyzes the seventh step in histidine biosynthesis
           responsive to general control of amino acid biosynthesis
           mutations cause histidine auxotrophy and sensitivity to
           Cu Co and Ni salts
          Length = 386

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 30/125 (24%), Positives = 56/125 (44%), Gaps = 7/125 (5%)

Query: 221 DDIFLTAGASSAVSTILSILCKGQQTGVLIPIPQYPXXXXXXXXXXXXXXPYYLDES-NG 279
           +++ L  G+  ++  I+   C   +  +L+  P Y                  L  S N 
Sbjct: 87  ENLCLGVGSDESIDAIIRACCVPAKEKILVLPPTYSMYSVCAHINDVEIVKCPLITSDNS 146

Query: 280 WSTDINEISKVAQDSLEAGIKPTCLVVINPGNPTGSVLTVEAIKNVFDVAAKYGLVVIAD 339
           +  + +E+ K AQ+  +  IK   + + +PGNPTG+ +    I+ +     + G+VV+ D
Sbjct: 147 FQANTDEVIKTAQN--DPSIK--LIFITSPGNPTGAKVETSRIEKILQNWDR-GMVVV-D 200

Query: 340 EVYQD 344
           E Y D
Sbjct: 201 EAYID 205

>Kwal_47.17462 s47 (413555..415033) [1479 bp, 492 aa] {ON} YGL202W
           (ARO8) - aromatic amino acid aminotransferase [contig
           207] FULL
          Length = 492

 Score = 33.5 bits (75), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 34/128 (26%), Positives = 47/128 (36%), Gaps = 3/128 (2%)

Query: 217 VAYPD-DIFLTAGASSAVSTILSILCKGQQTGVLIPIPQYPXXXXXXXXXXXXXXPYYLD 275
           + Y D DI  T G++      L I C    T VL+    Y               P  LD
Sbjct: 126 IPYQDWDIITTTGSTQGWDASLRIFCNKGDT-VLLEEYTYSSSVEAADAQGLNCIPMPLD 184

Query: 276 ESNGWSTDINEISKVAQDSLEAGIKPTCLVVINPG-NPTGSVLTVEAIKNVFDVAAKYGL 334
                   + E+     D       P  L  I  G NPTG  L+      ++ +A KY +
Sbjct: 185 GEGIIPEKLEEMLINWSDLYPDIPMPKLLYTIPTGQNPTGCTLSDSRKPYIYHLAQKYDM 244

Query: 335 VVIADEVY 342
           ++I DE Y
Sbjct: 245 IIIEDEPY 252

>KLTH0G09614g Chr7 (804939..806108) [1170 bp, 389 aa] {ON} similar
           to uniprot|P07172 Saccharomyces cerevisiae YIL116W HIS5
           Histidinol-phosphate aminotransferase catalyzes the
           seventh step in histidine biosynthesis responsive to
           general control of amino acid biosynthesis mutations
           cause histidine auxotrophy and sensitivity to Cu Co and
           Ni salts
          Length = 389

 Score = 33.5 bits (75), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 38/168 (22%), Positives = 69/168 (41%), Gaps = 18/168 (10%)

Query: 221 DDIFLTAGASSAVSTILSILCKGQQTGVLIPIPQYPXXXXXXXXXXXXXXPY-YLDESNG 279
           D++ L  G+  ++  ++   C   +  +LI  P Y                   + E N 
Sbjct: 88  DNLCLGVGSDESIDALIRACCVPGKDKILIMTPTYGMYSICADINDVEIIKVPLIVEDNS 147

Query: 280 WSTDINEISKVAQDSLEAGIKPTCLVVINPGNPTGSVLTVEAIKNVFDVAAKYGLVVIAD 339
           +  + +++ +  Q   ++ IK     V +PGNPTG+++ + +I+ +     + G+V I D
Sbjct: 148 FQMNTDKVIETLQG--DSNIK--IAFVTSPGNPTGALIDIASIEKILS-QWQSGIVAI-D 201

Query: 340 EVYQDNIFPGSEFHSMKKILRILQKEVPNKYDNIQLASLHSCSKGLLG 387
           E Y D    G     +            NKY N+ +    S S GL G
Sbjct: 202 EAYIDFCSTGGSAAPL-----------VNKYPNLAVLQTLSKSFGLAG 238

>SAKL0H21824g Chr8 (1903887..1905386) [1500 bp, 499 aa] {ON} similar
           to uniprot|P53090 Saccharomyces cerevisiae YGL202W ARO8
           Aromatic aminotransferase expression is regulated by
           general control of amino acid biosynthesis
          Length = 499

 Score = 33.5 bits (75), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 37/155 (23%), Positives = 58/155 (37%), Gaps = 9/155 (5%)

Query: 192 YSNSQGVHGIRQTVADFITNRDD--GEVAYPD-DIFLTAGASSAVSTILSILCKGQQTGV 248
           Y NS+G    ++ +  F+         + Y D DI  T G++ A    L I C    T V
Sbjct: 104 YGNSRG----QKELVSFLKEHTSIFHSIPYNDWDIITTTGSTQAWDASLRIFCNKGDT-V 158

Query: 249 LIPIPQYPXXXXXXXXXXXXXXPYYLDESNGWSTDINEISKVAQDSLEAGIKPTCLVVIN 308
           L+    Y               P  +D        + E+     D       P  L  I 
Sbjct: 159 LLEEFTYSSSVEAADAQGLNCIPVPMDNQGIIPEKLEEMLSNWTDRYPGIPMPKLLYTIP 218

Query: 309 PG-NPTGSVLTVEAIKNVFDVAAKYGLVVIADEVY 342
            G NPTG  L+      ++ +A KY ++++ D+ Y
Sbjct: 219 TGQNPTGCTLSECRKPCIYRLAQKYDILIVEDDPY 253

>SAKL0E12188g Chr5 (1010503..1012095) [1593 bp, 530 aa] {ON} similar
           to uniprot|P38840 Saccharomyces cerevisiae YHR137W ARO9
           Aromatic aminotransferase catalyzes the first step of
           tryptophan phenylalanine and tyrosine catabolism
          Length = 530

 Score = 33.1 bits (74), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 27/51 (52%), Gaps = 1/51 (1%)

Query: 300 KPTCLVVINPG-NPTGSVLTVEAIKNVFDVAAKYGLVVIADEVYQDNIFPG 349
           KP  L  I  G NPTG  L+ E  K ++++A  +  +++ D+ Y    FP 
Sbjct: 245 KPRVLYTIATGQNPTGMTLSPEKRKAIYELAETHNFIIVEDDPYGYLKFPA 295

>Suva_7.61 Chr7 (112022..113524) [1503 bp, 500 aa] {ON} YGL202W
           (REAL)
          Length = 500

 Score = 33.1 bits (74), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 28/129 (21%), Positives = 56/129 (43%), Gaps = 6/129 (4%)

Query: 216 EVAYPD-DIFLTAGASSAVSTILSILCKGQQTGVLIPIPQYPXXXXXXXXXXXXXXPYYL 274
           ++ Y D D+  TAG ++A  + L + C      +L     +               P  +
Sbjct: 127 DIKYKDWDVVATAGNTNAWESTLRVFCNRGDV-ILAEAHSFSSSLAAAEAQGIIAFPVPI 185

Query: 275 DESNGWSTDINEISKVAQDSLEAGIKPTCLVVINPG-NPTGSVLTVEAIKNVFDVAAKYG 333
           D ++G   +  +++K+  +      KP  L  I  G NPTG+ +     + ++ +A K+ 
Sbjct: 186 D-ADGIIPE--KLAKIMDNWTPGAPKPKLLYTIPTGQNPTGTSIADHRKEAIYKIAQKHD 242

Query: 334 LVVIADEVY 342
            +++ DE Y
Sbjct: 243 FLIVEDEPY 251

>TDEL0D05790 Chr4 complement(1045218..1046711) [1494 bp, 497 aa]
           {ON} Anc_3.511 YGL202W
          Length = 497

 Score = 33.1 bits (74), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 30/58 (51%), Gaps = 1/58 (1%)

Query: 286 EISKVAQDSLEAGIKPTCLVVINPG-NPTGSVLTVEAIKNVFDVAAKYGLVVIADEVY 342
           ++ K+  +      +P  L  I  G NPTG+ L  +  K ++ +A K+  ++I DE Y
Sbjct: 191 KLEKILDEWTPGAPRPKLLYTIPTGQNPTGTSLADDRKKEIYRIAQKHDFLIIEDEPY 248

>CAGL0L09889g Chr12 (1057762..1059915) [2154 bp, 717 aa] {ON}
           similar to uniprot|P36102 Saccharomyces cerevisiae
           YKL025c PAN3 component of the PAB1P-dependent poly(A)
           ribonuclease
          Length = 717

 Score = 32.7 bits (73), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 11/29 (37%), Positives = 22/29 (75%)

Query: 443 LDQHERQTIRTNHKKRSNKLYEMFNSLEG 471
           LD H+R +++  +KK  N LY++F++++G
Sbjct: 344 LDFHQRSSVKDRYKKHKNSLYKVFSNVDG 372

>TBLA0I01180 Chr9 complement(252457..253788) [1332 bp, 443 aa] {ON}
           Anc_2.475 YKL106W
          Length = 443

 Score = 32.7 bits (73), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 67/292 (22%), Positives = 107/292 (36%), Gaps = 30/292 (10%)

Query: 167 DSMGYAP--DSIERAKTLLTDIGSIG---AYSNSQGVHGIRQTVADFITNRDDG------ 215
           D+ G  P   S++ A+ LL  + S+    +Y    G    R  V +F+ +  DG      
Sbjct: 59  DNAGNVPTFKSVQNAQHLLHTVPSLRKDLSYLPIIGHPNYRNKVLNFLFH--DGCPEIGP 116

Query: 216 EVAYPDDIFL--TAGASSAVSTILSILCKGQQTGVLIP---IPQYPXXXXXXXXXXXXXX 270
           E+ Y D +    T   + A+S     L       ++IP      +               
Sbjct: 117 EIIYQDRVSFVQTLSGTGALSVTARFLSNFISDSIIIPQLSWANHANVFKNNGFRNISYY 176

Query: 271 PYYLDES---NGWSTDINEISKVAQDSLEAGIKPTCLVV-INPGNPTGSVLTVEAIKNVF 326
           PYY +E      W   +  I K  ++ + +  KP+C+++     NPTG   T E    + 
Sbjct: 177 PYYSNEKIVLKDWLNHLINIQKTDRE-VTSNSKPSCILLHACCHNPTGLDPTKEQWDQIL 235

Query: 327 DVAAKYGLVVIADEVYQDNIFPGSEFHSMKKILRILQKEVPNKYDN-IQLASLHSCSKGL 385
           D      L+ I D  YQ  +  G        + ++L K+    + N I L    + + GL
Sbjct: 236 DTIYDLNLIPIIDMAYQ-GLESGDVLKDSYLLRKVLNKKRYKNWKNGIYLCQSFAKNMGL 294

Query: 386 LGECGHRGGYCEFIGFTPEVKQVITKLSSISLCSSVIGQALVDLMCCPPKKG 437
            GE   R G    I   PE        S      S + Q +  +   PP  G
Sbjct: 295 YGE---RVGSLSII--LPETNSGNKSTSIRENIDSQLKQIIRSMYSSPPGYG 341

>Kwal_26.7768 s26 (502609..503877) [1269 bp, 422 aa] {ON} YKL106W
           (AAT1) - aspartate aminotransferase, mitochondrial
           [contig 55] FULL
          Length = 422

 Score = 32.7 bits (73), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 32/119 (26%), Positives = 48/119 (40%), Gaps = 6/119 (5%)

Query: 227 AGASSAVSTILSILCKGQQTGVLIPIPQYPXXXXXXXXXXXXXXPYYLDESNGWSTDIN- 285
            GA +  S +LS+        V IP P +P               YY    +G S DI  
Sbjct: 122 TGALAVASKLLSLF---MSRSVWIPNPSWPNHANVFQNNGFKEINYYSYYKDG-SLDIEG 177

Query: 286 EISKVAQDSLEAGIKPTCLVV-INPGNPTGSVLTVEAIKNVFDVAAKYGLVVIADEVYQ 343
            I  + + + + G  P C+V+     NPTG   + E  + + D   +  L+ I D  YQ
Sbjct: 178 WIQDLEKHAQKEGEDPQCIVLHACCHNPTGIDPSKEQWQRILDKIHELNLIPIIDMAYQ 236

>NDAI0B03730 Chr2 complement(935131..936291) [1161 bp, 386 aa] {ON}
           Anc_2.252 YIL116W
          Length = 386

 Score = 32.3 bits (72), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 32/125 (25%), Positives = 54/125 (43%), Gaps = 7/125 (5%)

Query: 221 DDIFLTAGASSAVSTILSILCKGQQTGVLIPIPQYPXXXXXXXXXXXXXXPY-YLDESNG 279
           +++ L  G+  ++  I+   C   +  +L+  P Y                   L ++N 
Sbjct: 89  ENLCLGVGSDESIDAIIRATCVPGKEKILVLPPTYSMYSVCAEINDIEIVECPLLYKNNS 148

Query: 280 WSTDINEISKVAQDSLEAGIKPTCLVVINPGNPTGSVLTVEAIKNVFDVAAKYGLVVIAD 339
           +  D   +  V Q+  +  IK   L + +PGNPTG+ +  E I+ V       GLVV+ D
Sbjct: 149 FQMDTESVLTVLQN--DPLIK--LLFITSPGNPTGARIETERIETVLQNWTD-GLVVV-D 202

Query: 340 EVYQD 344
           E Y D
Sbjct: 203 EAYID 207

>ZYRO0G05346g Chr7 complement(430373..431887) [1515 bp, 504 aa] {ON}
           similar to uniprot|P38840 Saccharomyces cerevisiae
           YHR137W ARO9 Aromatic aminotransferase catalyzes the
           first step of tryptophan phenylalanine and tyrosine
           catabolism
          Length = 504

 Score = 32.7 bits (73), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 27/50 (54%), Gaps = 1/50 (2%)

Query: 300 KPTCLVVINPG-NPTGSVLTVEAIKNVFDVAAKYGLVVIADEVYQDNIFP 348
           KP  L  +  G NPTG  L+    + ++++A K+  +++ D+ Y    FP
Sbjct: 207 KPKALYTVATGQNPTGMTLSPTKRRRIYEIAQKHDFLIVEDDPYGYLFFP 256

>CAGL0G06028g Chr7 complement(579261..580874) [1614 bp, 537 aa] {ON}
           similar to uniprot|P38840 Saccharomyces cerevisiae
           YHR137w ARO9 aromatic amino acid aminotransferase II
          Length = 537

 Score = 32.3 bits (72), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 40/189 (21%), Positives = 78/189 (41%), Gaps = 20/189 (10%)

Query: 171 YAPDSIERAKTLLTDIGSIGAYSNSQGVHGIRQTVADFITNRDDGEVAYPD--DIFLTAG 228
           Y P S+  A++          Y+   G+  IR   A ++ N+ +      D  D+ L++G
Sbjct: 112 YEPKSLPIARSF--------QYNEVPGLPQIRN-FAKYLVNKINKPAYSADQWDVLLSSG 162

Query: 229 ASSAVSTILSILCKGQQTGVLIPIPQYPXXXXXXXXXXXXXXPYYLDESNGWSTDINEIS 288
           +  ++       C  + T VL+    +               P  ++ +   ST   ++ 
Sbjct: 163 SCDSMFKFFECFCDEKST-VLMEEFTFTPVISHVKATGAECIPLKMNLTKDPSTQGIDVD 221

Query: 289 KVAQ--DSLEAG-----IKPTCLVVINPG-NPTGSVLTVEAIKNVFDVAAKYGLVVIADE 340
            + Q  D+  +G      KP  L  I  G NPTG  + +E  + ++++A K+  +++ D+
Sbjct: 222 YLTQLLDNWSSGPYKHLNKPRILYTICTGQNPTGVTIPMENRRKIYELAHKHNFLILEDD 281

Query: 341 VYQDNIFPG 349
            Y    FP 
Sbjct: 282 PYGYLSFPS 290

>KNAG0G00550 Chr7 (96823..97986) [1164 bp, 387 aa] {ON} Anc_1.472
          Length = 387

 Score = 32.0 bits (71), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 33/53 (62%), Gaps = 2/53 (3%)

Query: 293 DSLEAGIKP-TCLVVIN-PGNPTGSVLTVEAIKNVFDVAAKYGLVVIADEVYQ 343
           D+L+  IK  T L++IN P NP G V++ E + ++ ++  +  + +  DEVY+
Sbjct: 143 DTLKKAIKSNTKLIIINNPNNPLGCVISDELLTSICELCKEKNVYLHCDEVYR 195

>Skud_7.69 Chr7 (120729..122231) [1503 bp, 500 aa] {ON} YGL202W
           (REAL)
          Length = 500

 Score = 32.3 bits (72), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 15/58 (25%), Positives = 30/58 (51%), Gaps = 1/58 (1%)

Query: 286 EISKVAQDSLEAGIKPTCLVVINPG-NPTGSVLTVEAIKNVFDVAAKYGLVVIADEVY 342
           +++K+  +      KP  L  I  G NPTG+ +     + ++ +A K+  +++ DE Y
Sbjct: 194 KLAKIMDNWTAGAPKPKLLYTIPTGQNPTGTSIADHRKEAIYKIAQKHDFIIVEDEPY 251

>Kwal_23.4888 s23 (907745..908914) [1170 bp, 389 aa] {ON} YIL116W
           (HIS5) - histidinol-phosphate aminotransferase [contig
           5] FULL
          Length = 389

 Score = 32.0 bits (71), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 50/112 (44%), Gaps = 17/112 (15%)

Query: 276 ESNGWSTDINEISKVAQDSLEAGIKPTCLVVINPGNPTGSVLTVEAIKNVFDVAAKYGLV 335
           E N +  D  ++ +  Q+  +  IK   + + +PGNPTG+++  E I+ +     + G V
Sbjct: 144 EDNSFQMDTEKVIETLQN--DPSIK--LVFITSPGNPTGALIKPENIEKLLS-QWQSGFV 198

Query: 336 VIADEVYQDNIFPGSEFHSMKKILRILQKEVPNKYDNIQLASLHSCSKGLLG 387
           V+ DE Y D    G     +            NKY N+ +    S S GL G
Sbjct: 199 VV-DEAYIDFCTTGGSVAPLV-----------NKYPNLAVLQTLSKSFGLAG 238

>KLTH0G19624g Chr7 complement(1697587..1698993) [1407 bp, 468 aa]
           {ON} similar to uniprot|P10356 Saccharomyces cerevisiae
           YER152C Hypothetical ORF
          Length = 468

 Score = 32.0 bits (71), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 15/52 (28%), Positives = 30/52 (57%)

Query: 291 AQDSLEAGIKPTCLVVINPGNPTGSVLTVEAIKNVFDVAAKYGLVVIADEVY 342
           AQD  +   +    +V    NPTG++ +  +   + ++A KY +++I+D+VY
Sbjct: 178 AQDGKKKIYRYVIYLVPTYSNPTGAIYSRSSRLKLLELARKYDILIISDDVY 229

>YIL116W Chr9 (142928..144085) [1158 bp, 385 aa] {ON}
           HIS5Histidinol-phosphate aminotransferase, catalyzes the
           seventh step in histidine biosynthesis; responsive to
           general control of amino acid biosynthesis; mutations
           cause histidine auxotrophy and sensitivity to Cu, Co,
           and Ni salts
          Length = 385

 Score = 31.2 bits (69), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 34/126 (26%), Positives = 54/126 (42%), Gaps = 9/126 (7%)

Query: 221 DDIFLTAGASSAVSTILSILCKGQQTGVLIPIPQYPXXXXXXXXXXXXXXPYYLDESNG- 279
           D++ L  G+  ++  I+   C   +  +L+  P Y                  L  S+G 
Sbjct: 88  DNLCLGVGSDESIDAIIRACCVPGKEKILVLPPTYSMYSVCANINDIEVVQCPLTVSDGS 147

Query: 280 WSTDINEISKVAQ-DSLEAGIKPTCLVVINPGNPTGSVLTVEAIKNVFDVAAKYGLVVIA 338
           +  D   +  + + DSL   IK   + V +PGNPTG+ +    I+ V       GLVV+ 
Sbjct: 148 FQMDTEAVLTILKNDSL---IK--LMFVTSPGNPTGAKIKTSLIEKVLQ-NWDNGLVVV- 200

Query: 339 DEVYQD 344
           DE Y D
Sbjct: 201 DEAYVD 206

>Skud_8.198 Chr8 (349159..350712) [1554 bp, 517 aa] {ON} YHR137W
           (REAL)
          Length = 517

 Score = 31.2 bits (69), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 35/170 (20%), Positives = 73/170 (42%), Gaps = 15/170 (8%)

Query: 192 YSNSQGVHGIRQTVADFIT--NRD--DGEVAYPDDIFLTAGASSAVSTILSILCKGQQTG 247
           Y+ S+G   + + V D ++  NR     E+    D+ L+ G++ ++  +   +C  + T 
Sbjct: 102 YAESKGTPPLLRFVKDMVSRINRPVFSDEMQSNWDVILSGGSNDSMFKVFETIC-DESTT 160

Query: 248 VLIPIPQYPXXXXXXXXXXXXXXPYYLD---ESNGWSTDINEISKVAQDSLEAG-----I 299
           VLI    +               P  ++   + +    D++ ++++  D+   G      
Sbjct: 161 VLIEEFTFTPAMSNVEATGAKVVPIKINLTLDRDSQGIDVDHLTQLL-DNWSTGPYKHLA 219

Query: 300 KPTCLVVINPG-NPTGSVLTVEAIKNVFDVAAKYGLVVIADEVYQDNIFP 348
           KP  L  I  G NPTG  +     + ++ +A K+  +++ D+ Y    FP
Sbjct: 220 KPRVLYTIATGQNPTGMSVPQWKREKIYRLAQKHDFLIVEDDPYGYLYFP 269

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.136    0.408 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 53,734,388
Number of extensions: 2210298
Number of successful extensions: 5611
Number of sequences better than 10.0: 125
Number of HSP's gapped: 5675
Number of HSP's successfully gapped: 126
Length of query: 562
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 447
Effective length of database: 40,294,809
Effective search space: 18011779623
Effective search space used: 18011779623
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)