Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0E044308.262ON48145223950.0
SAKL0H17028g8.262ON5503876104e-72
KAFR0B055408.262ON5194205893e-69
Kpol_392.68.262ON4573865732e-67
TDEL0F038908.262ON4763785672e-66
Kwal_56.237998.262ON4883785515e-64
ZYRO0C01650g8.262ON5863685365e-61
YDR110W (FOB1)8.262ON5664005331e-60
Skud_4.3718.262ON5804125322e-60
Suva_2.2708.262ON6324135333e-60
Smik_4.3568.262ON5763765217e-59
KLTH0G13684g8.262ON5083775151e-58
CAGL0B01771g8.262ON5364015092e-57
NCAS0B038508.262ON5883844981e-55
KLLA0F19140g8.262ON5274304793e-53
Ecym_43088.262ON5293674653e-51
Kpol_543.388.262ON4424154463e-49
NDAI0J013808.262ON6243794432e-47
AGR086C8.262ON5343654286e-46
TPHA0J007408.262ON4083844199e-46
KNAG0H032408.262ON5193943776e-39
TPHA0A018108.262ON4573693262e-32
TBLA0F030708.262ON4453702911e-27
NDAI0D03010na 1ON778266960.005
NDAI0G00600singletonON48856810.23
NDAI0G00550singletonON41262810.25
NDAI0B06160singletonON140357810.29
KAFR0B06620singletonON1185166780.63
TDEL0H04520singletonON61264751.2
TDEL0E00260singletonON124864761.3
Smik_12.5104.294ON364136713.1
NDAI0J026104.294ON367119696.7
YLR420W (URA4)4.294ON364134696.8
TBLA0I013602.447ON66066697.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0E04430
         (481 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0E04430 Chr5 (1136737..1138182) [1446 bp, 481 aa] {ON} Anc_8...   927   0.0  
SAKL0H17028g Chr8 complement(1495187..1496839) [1653 bp, 550 aa]...   239   4e-72
KAFR0B05540 Chr2 complement(1134547..1136106) [1560 bp, 519 aa] ...   231   3e-69
Kpol_392.6 s392 complement(8453..9826) [1374 bp, 457 aa] {ON} co...   225   2e-67
TDEL0F03890 Chr6 (724664..726094) [1431 bp, 476 aa] {ON} Anc_8.2...   223   2e-66
Kwal_56.23799 s56 complement(708590..710056) [1467 bp, 488 aa] {...   216   5e-64
ZYRO0C01650g Chr3 complement(117323..119083) [1761 bp, 586 aa] {...   211   5e-61
YDR110W Chr4 (676102..677802) [1701 bp, 566 aa] {ON}  FOB1Nucleo...   209   1e-60
Skud_4.371 Chr4 (647726..649468) [1743 bp, 580 aa] {ON} YDR110W ...   209   2e-60
Suva_2.270 Chr2 (470408..472306) [1899 bp, 632 aa] {ON} YDR110W ...   209   3e-60
Smik_4.356 Chr4 (637418..639148) [1731 bp, 576 aa] {ON} YDR110W ...   205   7e-59
KLTH0G13684g Chr7 complement(1171645..1173171) [1527 bp, 508 aa]...   202   1e-58
CAGL0B01771g Chr2 (163063..164673) [1611 bp, 536 aa] {ON} weakly...   200   2e-57
NCAS0B03850 Chr2 complement(685424..687190) [1767 bp, 588 aa] {O...   196   1e-55
KLLA0F19140g Chr6 (1773327..1774910) [1584 bp, 527 aa] {ON} some...   189   3e-53
Ecym_4308 Chr4 complement(654030..655619) [1590 bp, 529 aa] {ON}...   183   3e-51
Kpol_543.38 s543 (84712..86040) [1329 bp, 442 aa] {ON} (84712..8...   176   3e-49
NDAI0J01380 Chr10 complement(317185..319059) [1875 bp, 624 aa] {...   175   2e-47
AGR086C Chr7 complement(888758..890362) [1605 bp, 534 aa] {ON} S...   169   6e-46
TPHA0J00740 Chr10 (175036..176262) [1227 bp, 408 aa] {ON} Anc_8....   166   9e-46
KNAG0H03240 Chr8 complement(603920..605479) [1560 bp, 519 aa] {O...   149   6e-39
TPHA0A01810 Chr1 complement(365982..367355) [1374 bp, 457 aa] {O...   130   2e-32
TBLA0F03070 Chr6 complement(745795..747132) [1338 bp, 445 aa] {O...   116   1e-27
NDAI0D03010 Chr4 complement(712188..714524) [2337 bp, 778 aa] {O...    42   0.005
NDAI0G00600 Chr7 complement(130877..132343) [1467 bp, 488 aa] {O...    36   0.23 
NDAI0G00550 Chr7 complement(116985..118223) [1239 bp, 412 aa] {O...    36   0.25 
NDAI0B06160 Chr2 (1494425..1498636) [4212 bp, 1403 aa] {ON}            36   0.29 
KAFR0B06620 Chr2 complement(1376088..1379645) [3558 bp, 1185 aa]...    35   0.63 
TDEL0H04520 Chr8 complement(817439..819277) [1839 bp, 612 aa] {O...    33   1.2  
TDEL0E00260 Chr5 complement(46841..49489,49491..50588) [3747 bp,...    34   1.3  
Smik_12.510 Chr12 (896477..897571) [1095 bp, 364 aa] {ON} YLR420...    32   3.1  
NDAI0J02610 Chr10 complement(646697..647800) [1104 bp, 367 aa] {...    31   6.7  
YLR420W Chr12 (963785..964879) [1095 bp, 364 aa] {ON}  URA4Dihyd...    31   6.8  
TBLA0I01360 Chr9 complement(290912..292627,292882..293148) [1983...    31   7.3  

>TBLA0E04430 Chr5 (1136737..1138182) [1446 bp, 481 aa] {ON}
           Anc_8.262 YDR110W
          Length = 481

 Score =  927 bits (2395), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 452/452 (100%), Positives = 452/452 (100%)

Query: 1   MTNDSHQQNSNIQDLKSLTPDEKLEMLKIYNPKDLGISYTDYLDEKNSNVNIELLEKGYK 60
           MTNDSHQQNSNIQDLKSLTPDEKLEMLKIYNPKDLGISYTDYLDEKNSNVNIELLEKGYK
Sbjct: 1   MTNDSHQQNSNIQDLKSLTPDEKLEMLKIYNPKDLGISYTDYLDEKNSNVNIELLEKGYK 60

Query: 61  DMQRYHSIKAAVLTQEYCDMLNTGTLSPENIIKYDTKLTNHSKALEKYNFTSRRYYLNED 120
           DMQRYHSIKAAVLTQEYCDMLNTGTLSPENIIKYDTKLTNHSKALEKYNFTSRRYYLNED
Sbjct: 61  DMQRYHSIKAAVLTQEYCDMLNTGTLSPENIIKYDTKLTNHSKALEKYNFTSRRYYLNED 120

Query: 121 NNIIDKRKPGRIICEPKYMYDIVIAYHLKLHSSYAVSERLKKFFSNVGRQYIDYCAKYCS 180
           NNIIDKRKPGRIICEPKYMYDIVIAYHLKLHSSYAVSERLKKFFSNVGRQYIDYCAKYCS
Sbjct: 121 NNIIDKRKPGRIICEPKYMYDIVIAYHLKLHSSYAVSERLKKFFSNVGRQYIDYCAKYCS 180

Query: 181 KCFPDETEHMKLFTDDITFKNIRNNIIDRPLFPMERIHIEIFNPFDDLKIENKYQRILYI 240
           KCFPDETEHMKLFTDDITFKNIRNNIIDRPLFPMERIHIEIFNPFDDLKIENKYQRILYI
Sbjct: 181 KCFPDETEHMKLFTDDITFKNIRNNIIDRPLFPMERIHIEIFNPFDDLKIENKYQRILYI 240

Query: 241 RDYSTRYIWTFTLKKLKLKHITNILTEFFLSIATNVPIFLQSSTIDNTDLFDICEKISRE 300
           RDYSTRYIWTFTLKKLKLKHITNILTEFFLSIATNVPIFLQSSTIDNTDLFDICEKISRE
Sbjct: 241 RDYSTRYIWTFTLKKLKLKHITNILTEFFLSIATNVPIFLQSSTIDNTDLFDICEKISRE 300

Query: 301 YHISLGLGTNNKHDHFHLSGIEMFKQLVNLNKSKCLKSWSNFLVFGSVLHNNKFNSRILS 360
           YHISLGLGTNNKHDHFHLSGIEMFKQLVNLNKSKCLKSWSNFLVFGSVLHNNKFNSRILS
Sbjct: 301 YHISLGLGTNNKHDHFHLSGIEMFKQLVNLNKSKCLKSWSNFLVFGSVLHNNKFNSRILS 360

Query: 361 KPIDIINCNNLAQGKKKFRDRRLRIIKQTITDNYVKLGNVASIIFIEDEATSIAEGLTLE 420
           KPIDIINCNNLAQGKKKFRDRRLRIIKQTITDNYVKLGNVASIIFIEDEATSIAEGLTLE
Sbjct: 361 KPIDIINCNNLAQGKKKFRDRRLRIIKQTITDNYVKLGNVASIIFIEDEATSIAEGLTLE 420

Query: 421 GNDKYEQFSDEYRSDIDVIEDDSYDIPLSDTE 452
           GNDKYEQFSDEYRSDIDVIEDDSYDIPLSDTE
Sbjct: 421 GNDKYEQFSDEYRSDIDVIEDDSYDIPLSDTE 452

>SAKL0H17028g Chr8 complement(1495187..1496839) [1653 bp, 550 aa]
           {ON} similar to uniprot|O13329 Saccharomyces cerevisiae
           YDR110W FOB1 Nucleolar protein required for DNA
           replication fork blocking and recombinational hotspot
           activities binds to the replication fork barrier site in
           the rDNA region related to retroviral integrases
          Length = 550

 Score =  239 bits (610), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 145/387 (37%), Positives = 223/387 (57%), Gaps = 32/387 (8%)

Query: 32  PKDLGISYTDYLDEKNSNVNIELLEKGYKDMQRYHSIKAAVLTQEYCDMLNTGTLSPENI 91
           PK LG S   Y    ++++N+ELLE+G +D  +Y       LTQ   +++ T TL+ E +
Sbjct: 29  PK-LGESQVTY----STDLNVELLERGGRDFIKYLESVKGQLTQAQYELIKTDTLTLETL 83

Query: 92  IKYDTKLTNHSKALEKYNFTSRRYYLNEDNNIIDKRKPGRIICEPKYMYDIVIAYHL--- 148
           +     L   S A  KY F  RRYY++ D  + D ++   I+CEP+ MY+++++ HL   
Sbjct: 84  LAVTDGLIP-SNAEAKYLFLKRRYYVDSDQIVRDHKRDDTIVCEPELMYELIVSGHLLNN 142

Query: 149 -----KLHSSYAVSERLKKFFSNVGRQYIDYCAKYCSKCFPDETEHMKLFTDDITFKNIR 203
                KLH        LK  +SN+ R ++  CA+YCS+C P E   +K FT    FK+  
Sbjct: 143 HLHWRKLH------RFLKSQYSNITRDFVQMCARYCSECNPQE--EVKPFTK---FKHTN 191

Query: 204 NNIIDRPLFPMERIHIEIFNPFD-DLKIENKYQRILYIRDYSTRYIWTFTLKKLKLKHIT 262
                + L P+ERIH+EIF PF  D  IE KY  +LY RDY +R++W   L  +  + + 
Sbjct: 192 AY---QGLLPLERIHVEIFKPFGTDELIEEKYSHVLYCRDYHSRFVWLSPLTGITFQELV 248

Query: 263 NILTEFFLSIATNVPIFLQSSTIDNTDLFDICEKISREYHISLGLGTNNKHDHFHLSGIE 322
             LTEF LS+   +PIFL+++T+D  D+FD+CE I+R+Y +++GLG NN   HF+ +GIE
Sbjct: 249 PQLTEFLLSLP-RLPIFLETTTLDRQDMFDMCEYIARKYQLAIGLGLNNS-SHFYKNGIE 306

Query: 323 MFKQLVNLNKSKCLKSWSNFLVFGSVLHNNKFNSRILSKPIDIINCNNLAQGKKKFRDRR 382
             K L+  NK KC K W   L +GS  +N  +N RI+    D++ CN ++   KKF+ +R
Sbjct: 307 RMKYLLQTNKKKCAKDWGMCLKYGSYHNNTAYNPRIMGFSNDLL-CNEVSSCGKKFKLKR 365

Query: 383 LRIIKQTITDNYVKLGNVASIIFIEDE 409
            +II +    N V L +   ++++E+E
Sbjct: 366 EKIIHELFAHNVVTLKDTGGMVYVENE 392

>KAFR0B05540 Chr2 complement(1134547..1136106) [1560 bp, 519 aa]
           {ON} Anc_8.262 YDR110W
          Length = 519

 Score =  231 bits (589), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 141/420 (33%), Positives = 237/420 (56%), Gaps = 26/420 (6%)

Query: 35  LGISYTDYLDEKNSNVNIELLEKGYKDMQRYHSIKAAVLTQEYCDMLNTGTLSPENIIKY 94
           +G SYT Y D   S +N+ELL++G +++ ++       LT+E  D++ T +L+PE +   
Sbjct: 52  MGESYTSYTD---SFMNLELLKRGEREVFKFQQSINGHLTEETYDLIRTDSLTPETLAST 108

Query: 95  DTKLTNHSKALEKYNFTSRRYYLNEDNNIIDKRKPGRIICEPKYMYDIVIAYHLKLHSSY 154
           + K T  + A  +Y F  RRYY + +  I D  +  +I+CEP Y++D+++  HL  +  +
Sbjct: 109 NPKWTKIT-AEPRYLFLKRRYYRDNNGLIHDHLRKDKIVCEPVYVFDMIMGCHLMNNHGF 167

Query: 155 A--VSERLKKFFSNVGRQYIDYCAKYCSKCFPDETEHMKLFTDDITFKNIRNNIIDRPLF 212
              +   L  F+SN+ R       K+CS C P E +  KL  +    +NI N      L 
Sbjct: 168 VKKIHHSLSTFYSNITRDLCLKALKFCSVCNP-EQKIGKL--EKFKHRNIYNE-----LM 219

Query: 213 PMERIHIEIFNPFDDLKIENKYQRILYIRDYSTRYIWTFTLKKLKLKHITNILTEFFLSI 272
           P+ER+HIEIF PF + KIE KY  ILY RDY +RYIW   LK  K KH+   +   FLS 
Sbjct: 220 PLERVHIEIFEPFPNEKIEKKYSHILYCRDYHSRYIWMLPLKNTKFKHLVPTMASLFLSF 279

Query: 273 ATNVPIFLQSSTIDNTDLFDICEKISREYHISLGLGTNNKHDHFHLSGIEMFKQLVNLNK 332
               PIF++++++D  D+FDICEKI+ EY + +GLGT +K + FH +GI   K  +  ++
Sbjct: 280 IRQ-PIFIETASLDWQDMFDICEKIAFEYDLQIGLGT-SKPNTFHAAGIRQMKAKLEAHR 337

Query: 333 SKCLKSWSNFLVFGSVLHNNKFNSRILSKPIDIINCNNLAQGKKKFRDRRLRIIKQTITD 392
            +CL SW+  L +GS  HN + N R    P D+++ + + +   KF+++ ++I++  +++
Sbjct: 338 EECLLSWNLCLKYGSYDHNIRHNDRAGGVPGDLLS-SQIQECSLKFKEKIIQILENAVSE 396

Query: 393 NYVKLGNVASIIFIEDEATSIAEGLTLEGNDKYEQFSDEYRSDIDVIEDDSYDIPLSDTE 452
           + +++ N   +IF+E     + E      ++ Y++F  ++  D  + E+D   +    TE
Sbjct: 397 SVLRVDN--GLIFLE-----VDEPHDEPHDEPYDEF--QFEGDQSIDEEDMGAVMPPATE 447

>Kpol_392.6 s392 complement(8453..9826) [1374 bp, 457 aa] {ON}
           complement(8453..9826) [1374 nt, 458 aa]
          Length = 457

 Score =  225 bits (573), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 135/386 (34%), Positives = 216/386 (55%), Gaps = 18/386 (4%)

Query: 33  KDLGISYTDYLDE--KNSNVNIELLEKGYKDMQRYHSIKAAVLTQEYCDMLNTGTLSPEN 90
           K+L +     LDE    S +N EL  +G++D+ ++ S     L+Q   D++ T  L+P+ 
Sbjct: 58  KELVLPEIKNLDELISESGLNKELFNRGHQDLAKFQSTINGYLSQRIYDLILTDKLTPKK 117

Query: 91  IIKYDTKLTNHSKALEKYNFTSRRYYLNEDNNII-DKRKPGRIICEPKYMYDIVIAYHL- 148
           + +   K  N S   EKY F   RYY+++    + D+R   +I+C P  + ++V+  HL 
Sbjct: 118 VSREKVKWANKSN--EKYYFLKNRYYVSDKGTTVRDRRNDDKILCPPNKVLEVVLCTHLI 175

Query: 149 KLHSSY-AVSERLKKFFSNVGRQYIDYCAKYCSKCFPDETEHMKLFTDDITFKNIRNNII 207
             H+++ +V   L K ++N+ R        YCS C P  +EH+K        K  + N +
Sbjct: 176 NEHAAHKSVHRNLHKRYANISRTITRISLLYCSFCNP--SEHVK------PLKKSKKNEV 227

Query: 208 DRPLFPMERIHIEIFNPFDDLK-IENKYQRILYIRDYSTRYIWTFTLKKLKLKHITNILT 266
              L P ERIHIEIF PF D K IE  Y  ILYIRDY +RY+W + LKK   K +T  L 
Sbjct: 228 YEGLLPFERIHIEIFKPFGDEKLIEGTYSHILYIRDYYSRYVWLYPLKKTAFKELTQTLV 287

Query: 267 EFFLSIATNVPIFLQSSTIDNTDLFDICEKISREYHISLGLGTNNKHDHFHLSGIEMFKQ 326
            +F +I T  PI+++SSTI+  DL  + +KI+ +Y + +G+G  N   +FH +G+E  KQ
Sbjct: 288 TYFFTI-TKTPIYIESSTINRNDLIAMVQKIALKYDLRIGIGIGNS-SYFHYNGLETMKQ 345

Query: 327 LVNLNKSKCLKSWSNFLVFGSVLHNNKFNSRILSKPIDIINCNNLAQGKKKFRDRRLRII 386
           L+ L++ +CL  W   L +G  LHNN  N ++L  PI+++  + +++   K++ ++  +I
Sbjct: 346 LLLLHEDECLGDWGMCLKYGKNLHNNLKNRKVLGMPINLLLNSGISECSIKYKSKKNTVI 405

Query: 387 KQTITDNYVKLGNVASIIFIEDEATS 412
            +T   N + L N  S I++ED  TS
Sbjct: 406 DETFPHNMIVLDNGKSEIYLEDNLTS 431

>TDEL0F03890 Chr6 (724664..726094) [1431 bp, 476 aa] {ON} Anc_8.262
           YDR110W
          Length = 476

 Score =  223 bits (567), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 136/378 (35%), Positives = 214/378 (56%), Gaps = 22/378 (5%)

Query: 35  LGISYTDYLDEKNSNVNIELLEKGYKDMQRYH-SIKAAVLTQEYCDMLNTGTLSPENIIK 93
           +G SY +Y    NS +N+ELLE+G +D+ +Y  SI   VL   Y +++ T +L+PE +  
Sbjct: 44  MGESYKEY---ANSYMNMELLERGEQDLLKYQESINGQVLHPIY-ELIRTNSLTPETLAS 99

Query: 94  YDTKLTNHSKALEKYNFTSRRYYLNEDNNIIDKRKPGRIICEPKYMYDIVIAYHL-KLHS 152
              K    S A  KY F  RRYY  E+  + D+RK  +I+CEP  ++D+++  HL   H 
Sbjct: 100 NSDKWDKDS-AESKYMFLMRRYYA-ENGIVRDRRKGDKIVCEPLCIFDLIMCAHLMNDHM 157

Query: 153 SY-AVSERLKKFFSNVGRQYIDYCAKYCSKCFPDETEHMKLFTDDITFKNIRNNIIDRPL 211
           +Y  +   L K +SN+ R ++    +YCS C PD   H +        +  R+  I + L
Sbjct: 158 TYRPIYTCLNKIYSNITRDFVQMAVRYCSSCNPDG--HFR------PLEKYRHKNIFKGL 209

Query: 212 FPMERIHIEIFNPFDDLKIENKYQRILYIRDYSTRYIWTFTLKKLKLKHITNILTEFFLS 271
            P+ER+HIEIF  FD+  I NK+  +LY RDY TR++W   LK  K KH+ + +    L 
Sbjct: 210 LPLERVHIEIFEVFDNESISNKFTNVLYCRDYHTRFVWLAPLKNTKFKHLVSAVGTLLLG 269

Query: 272 IATNVPIFLQSSTIDNTDLFDICEKISREYHISLGLGTNNKHDHFHLSGIEMFKQLVNLN 331
           + T VPIF++SST+D  DLFDICE++  +Y++ LGLG N+    FH++GI+  K+L+N  
Sbjct: 270 M-TYVPIFMESSTLDKQDLFDICEQLCGKYNMKLGLGANSS-SQFHINGIKRMKKLLNTR 327

Query: 332 KSKCLKSWSNFLVFGSVLHNNKFNSRILSKPIDIINCNNLAQGKKKFRDRRLRIIKQTIT 391
           K  C+  W+  L +G    N + N+     P D++  ++    +K FR ++  II +   
Sbjct: 328 KVDCISDWNMCLRYGPYHLNRRHNTLAGGIPNDLLYHSD-HTNRKHFRPKQEMIIDELPA 386

Query: 392 DNYVKLGNVASIIFIEDE 409
            N V +     ++++EDE
Sbjct: 387 QNVVHVNK--GLLYLEDE 402

>Kwal_56.23799 s56 complement(708590..710056) [1467 bp, 488 aa] {ON}
           YDR110W (FOB1) - DNA replication fork blocking protein
           [contig 173] FULL
          Length = 488

 Score =  216 bits (551), Expect = 5e-64,   Method: Compositional matrix adjust.
 Identities = 120/378 (31%), Positives = 211/378 (55%), Gaps = 22/378 (5%)

Query: 43  LDEKNSNVNIELLEKGYKDMQRYHSIKAAVLTQEYCDMLNTGTLSPENIIKYDTKLTNHS 102
           L++  + +N ELL +G  D  +Y       LTQE  D++ +  L+ EN++    KL  HS
Sbjct: 28  LEKYGNGLNDELLARGRLDFIKYQESVKGQLTQEQFDLVRSSALTAENLMSTSDKL--HS 85

Query: 103 KALE-KYNFTSRRYYLNEDNNIIDKRKPGRIICEPKYMYDIVIAYHLK---LHSSYAVSE 158
             +E K+    RR+Y++ D  + D +    ++CEP+ ++D+++  HLK   +H    +  
Sbjct: 86  GNIETKFLLLKRRFYVDADGTVRDFKCDDTVVCEPESLFDLIMCGHLKNGHIHWR-RLHH 144

Query: 159 RLKKFFSNVGRQYIDYCAKYCSKCFPDETEHMKLFTDDITFKNIRNNIIDRPLFPMERIH 218
            L++ ++N  R +   C +YCS+C P+E            ++  R+  I   L P+ER+H
Sbjct: 145 YLRRKYANTTRAFAQICVRYCSECNPEEVLR--------PYRKFRHTNIYSGLLPLERVH 196

Query: 219 IEIFNPFDDLKIENKYQRILYIRDYSTRYIWTFTLKKLKLKHITNILTEFFLSIATNVPI 278
           +EI  PF  L IE  Y  +LY+RDY +R++W   L   ++  IT     F LS+   VPI
Sbjct: 197 VEIIAPFPKL-IEGLYSHVLYLRDYYSRFVWMQPLASERVSEITKAFLTFLLSLP-RVPI 254

Query: 279 FLQSSTIDNTDLFDICEKISREYHISLGLGTNNKHDHFHLSGIEMFKQLVNLNKSKCLKS 338
           F+++ST+   DLF++CE I+ +Y +S+GLG  ++   F  +G+E  + L+  N+  CLKS
Sbjct: 255 FVETSTLKRQDLFEVCENIASQYGLSIGLGM-SRSTTFQRNGVERLRYLLQQNEEPCLKS 313

Query: 339 WSNFLVFGSVLHNNKFNSRILSKPIDIINCNNLAQGKKKFRDRRLRIIKQTITDNYVKL- 397
           W   L FG   HN  +N+R+L  P ++++ + ++   ++F  +R  +I++    N V+L 
Sbjct: 314 WHMCLKFGVTNHNMTYNARVLGLPGNLLH-STVSDYGRQFELKREELIEKLFASNVVELR 372

Query: 398 --GNVASIIFIEDEATSI 413
             G    +I++EDE+++ 
Sbjct: 373 NEGRRRGMIYLEDESSAF 390

>ZYRO0C01650g Chr3 complement(117323..119083) [1761 bp, 586 aa] {ON}
           some similarities with uniprot|O13329 Saccharomyces
           cerevisiae YDR110W FOB1 Nucleolar protein required for
           DNA replication fork blocking and recombinational
           hotspot activities binds to the replication fork barrier
           site in the rDNA region related to retroviral integrases
          Length = 586

 Score =  211 bits (536), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 123/368 (33%), Positives = 203/368 (55%), Gaps = 28/368 (7%)

Query: 49  NVNIELLEKGYKDMQRYHSIKAAVLTQEYCDMLNTGTLSPENIIKYDTKLTNHSKALEKY 108
            +N+ LLE+G ++  ++    A  LTQ+  +++ + TLS  N+ +   K    S  +E Y
Sbjct: 54  GMNLNLLEQGAEESLQFQGTVAGQLTQQIYELIRSDTLSIANLERC-HKWKGESSEIEYY 112

Query: 109 NFTSRRYYLNEDNNII-DKRKPGRIICEPKYMYDIVIAYHLKLH--SSYAVSERLKKFFS 165
              SR Y+++E+N ++ D+++  RI+CEP  M+ +V+  HL+ +  +SY +   L K ++
Sbjct: 113 YLRSR-YFVSEENGMVCDRKRDDRIVCEPASMFHLVMCSHLQNNHVTSYNIHRNLVKTYA 171

Query: 166 NVGRQYIDYCAKYCSKCFPDETEHMKLFTDDITFKNIRNNIIDRPLFPMERIHIEIFNPF 225
           N+ R YI     YCSKC PD             F+  R+  +   L P+ER+HIE+F PF
Sbjct: 172 NITRDYIVTAISYCSKCNPDLKAK--------PFQKKRHKNVYWELLPLERVHIEVFEPF 223

Query: 226 DDLKIENKYQRILYIRDYSTRYIWTFTLKKLKLKHITNILTEFFLSIATNVPIFLQSSTI 285
           D  KI+ ++  +LY RDY +RY+W   L+  K KH+   ++ F L +   +PIFL+S+TI
Sbjct: 224 DGEKIQGRFSHLLYFRDYFSRYVWILPLQNDKRKHMIRAMSSFLLGLP-RIPIFLESTTI 282

Query: 286 DNTDLFDICEKISREYHISLGLGTNNKHDHFHLSGIEMFKQLVNLNKSKCLKSWSNFLVF 345
           D   LFD+C +I+  Y + LGLG  N    FH +GI+  K+L+  +K +CL+ W+  L +
Sbjct: 283 DREHLFDLCGQIAEHYSLKLGLGVKNSQ-RFHNNGIKDMKELLGSHKEECLQDWNLCLKY 341

Query: 346 GSVLHNNKFNSRILSKPIDII-----NCNNLAQGKKKFRDRRLRIIKQTITDNYVKLGNV 400
           G    N   N     +P D++     +CN      +KF  +R  +I  T +   V LG  
Sbjct: 342 GPFHINQNINVSSDGRPGDLLFTSVPDCN------RKFVKKRNDVILDTPSQQVVHLG-- 393

Query: 401 ASIIFIED 408
             ++F+E+
Sbjct: 394 EGVLFLEN 401

>YDR110W Chr4 (676102..677802) [1701 bp, 566 aa] {ON}  FOB1Nucleolar
           protein that binds the rDNA replication fork barrier
           (RFB) site; required for replication fork blocking,
           recombinational hotspot activity, condensin recruitment
           to RFB and rDNA repeat segregation; related to
           retroviral integrases
          Length = 566

 Score =  209 bits (533), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 134/400 (33%), Positives = 219/400 (54%), Gaps = 19/400 (4%)

Query: 13  QDLKSLTPDEKLEMLK--IYNPKDLGISYTDYLDEKNSNVNIELLEKGYKDMQRYHSIKA 70
           Q  K+ +P E  E  K  +     +G SYT+Y+D   S +N+ELLE+G ++   +     
Sbjct: 27  QRRKATSPGESRESSKDRLLILPSMGESYTEYVD---SYLNLELLERGERETPIFLESLT 83

Query: 71  AVLTQEYCDMLNTGTLSPENIIKYDTKLTNHSKALEKYNFTSRRYYLNEDNNIIDKRKPG 130
             LTQ+  +++ T +L+ + + +   K  +   A  K  F  R+YY++++ N+ D R   
Sbjct: 84  RQLTQKIYELIKTKSLTADTLQQISDKY-DGVVAENKLLFLQRQYYVDDEGNVRDGRNND 142

Query: 131 RIICEPKYMYDIVIAYHL--KLHSSYAVSERLKKFFSNVGRQYIDYCAKYCSKCFPDETE 188
           +I CEPK++YD+V+A HL  K      +   L   F+N+    ID+  ++CSKC  ++  
Sbjct: 143 KIYCEPKHVYDMVMATHLMNKHLRGKTLHSFLFSHFANISHAIIDWVQQFCSKC--NKKG 200

Query: 189 HMKLFTDDITFKNIRNNIIDRPLFPMERIHIEIFNPFDDLKIENKYQRILYIRDYSTRYI 248
            +K   +   +K  R ++ D+ L PMERIHIE+F PF+   IE KY  +L  RDY + ++
Sbjct: 201 KIKPLKE---YK--RPDMYDK-LLPMERIHIEVFEPFNGEAIEGKYSYVLLCRDYRSSFM 254

Query: 249 WTFTLKKLKLKHITNILTEFFLSIATNVPIFLQSSTIDNTDLFDICEKISREYHISLGLG 308
           W   LK  K KH+  +++  FL+ A  VPIF+ SST+D  DL+DICE+I+ +Y + +GLG
Sbjct: 255 WLLPLKSTKFKHLIPVVSSLFLTFA-RVPIFVTSSTLDKDDLYDICEEIASKYGLRIGLG 313

Query: 309 TNNKHDHFHLSGIEMFKQLVNLNKSKCLKSWSNFLVFGSVLHNNKFNSRILSKPIDIINC 368
             +    FH  GI   +  +N  K +CL  W   L +G    N + N R   KP+ ++  
Sbjct: 314 LKSSA-RFHTGGILCIQYALNSYKKECLADWGKCLRYGPYRFNRRRNKRTKRKPVQVL-L 371

Query: 369 NNLAQGKKKFRDRRLRIIKQTITDNYVKLGNVASIIFIED 408
           + +     KF  +R R+I+ T + N  K+     +I++ED
Sbjct: 372 SEVPGHNAKFETKRERVIENTYSRNMFKMAGGKGLIYLED 411

>Skud_4.371 Chr4 (647726..649468) [1743 bp, 580 aa] {ON} YDR110W
           (REAL)
          Length = 580

 Score =  209 bits (532), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 138/412 (33%), Positives = 221/412 (53%), Gaps = 19/412 (4%)

Query: 1   MTNDSHQQNSNIQDLKSLTPDEKLEMLK--IYNPKDLGISYTDYLDEKNSNVNIELLEKG 58
           + + S  + S+ Q  K+ +P E  E LK  +     +G SYT Y+D   S +N+ELLE+G
Sbjct: 18  LPSGSVTRKSSPQMRKTTSPRESREPLKDRLLILPSMGESYTAYVD---SYLNLELLERG 74

Query: 59  YKDMQRYHSIKAAVLTQEYCDMLNTGTLSPENIIKYDTKLTNHSKALEKYNFTSRRYYLN 118
            ++   +       LTQ+  +++ T +L+ + + +   K  +   A  K  F  R+YY++
Sbjct: 75  ERETPIFLESLTRQLTQQIYELIKTKSLTADTLQQISDKY-DGVVAENKLLFLQRQYYVD 133

Query: 119 EDNNIIDKRKPGRIICEPKYMYDIVIAYHL--KLHSSYAVSERLKKFFSNVGRQYIDYCA 176
            + N+ D R   +I CEPK++YD+V+A HL  K      +   L   F+N     ID+  
Sbjct: 134 NEGNVRDGRNNDKIYCEPKHIYDMVMATHLMNKHLRGKTLHSFLFSHFANTSHAIIDWVQ 193

Query: 177 KYCSKCFPDETEHMKLFTDDITFKNIRNNIIDRPLFPMERIHIEIFNPFDDLKIENKYQR 236
           ++CSKC  ++   +K   +   +K  R ++ D+ L PMERIHIE+F PF    IE KY  
Sbjct: 194 QFCSKC--NKKGKIKPLKE---YK--RPDMYDK-LLPMERIHIEVFEPFTGGAIEGKYPY 245

Query: 237 ILYIRDYSTRYIWTFTLKKLKLKHITNILTEFFLSIATNVPIFLQSSTIDNTDLFDICEK 296
           +L  RDY + ++W   LK  K KH+  +++  FLS A  VPIF+ SST+D  DL+DICE+
Sbjct: 246 VLLCRDYRSSFMWLLPLKSTKFKHLIPVISSLFLSFA-RVPIFVTSSTLDKDDLYDICEE 304

Query: 297 ISREYHISLGLGTNNKHDHFHLSGIEMFKQLVNLNKSKCLKSWSNFLVFGSVLHNNKFNS 356
           I+ +Y + +GLG  +    FH  GI   +  +N  K +CL  W   L +G    N + N 
Sbjct: 305 IASKYGLCIGLGLKSSA-RFHTGGILCIQYALNSYKEECLADWGKCLRYGPYRFNRRRNK 363

Query: 357 RILSKPIDIINCNNLAQGKKKFRDRRLRIIKQTITDNYVKLGNVASIIFIED 408
           R   KP  ++  + +     KF  +R R+I+ T + N  K+     +I++ED
Sbjct: 364 RTKRKPAQVL-LSEVPGHNAKFETKRERVIENTYSRNMFKMAGGKGLIYLED 414

>Suva_2.270 Chr2 (470408..472306) [1899 bp, 632 aa] {ON} YDR110W
           (REAL)
          Length = 632

 Score =  209 bits (533), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 137/413 (33%), Positives = 223/413 (53%), Gaps = 21/413 (5%)

Query: 1   MTNDSHQQNSNIQDLKSLTPDEKLEMLK---IYNPKDLGISYTDYLDEKNSNVNIELLEK 57
           + ++S +  S+ Q  K+ +P E  E LK   +  P  +G SYT+Y+D   S +N+ELLE+
Sbjct: 68  LPSESAKSKSSPQRRKTTSPRESRESLKDRLLILPL-MGESYTEYVD---SYLNLELLER 123

Query: 58  GYKDMQRYHSIKAAVLTQEYCDMLNTGTLSPENIIKYDTKLTNHSKALEKYNFTSRRYYL 117
           G ++   +       LTQ+  +++ T +L+ E + +   K  +   A  K  F  R+YY+
Sbjct: 124 GERETPIFLESLTRQLTQKIYELIKTKSLTAETLQQISDKY-DGVAAENKLLFLERQYYV 182

Query: 118 NEDNNIIDKRKPGRIICEPKYMYDIVIAYHL--KLHSSYAVSERLKKFFSNVGRQYIDYC 175
           + + N+ D+R   +I CEPK++YD+V+A HL  K      +   L   F+N     ID+ 
Sbjct: 183 DNEGNVRDRRNNDKIYCEPKHIYDMVMATHLMNKHLRGKTLHSFLFSHFANTSHAIIDWV 242

Query: 176 AKYCSKCFPDETEHMKLFTDDITFKNIRNNIIDRPLFPMERIHIEIFNPFDDLKIENKYQ 235
            ++CSKC  ++   +K   +   +K  R ++ D+ L PMERIHIE+F P+    IE KY 
Sbjct: 243 QQFCSKC--NKKGKIKPLKE---YK--RPDMYDK-LLPMERIHIEVFEPYGGKAIEGKYP 294

Query: 236 RILYIRDYSTRYIWTFTLKKLKLKHITNILTEFFLSIATNVPIFLQSSTIDNTDLFDICE 295
            +L  RDY + ++W   LK  K KH+  +++  FLS A  +PIF+ SST+D  DL+DICE
Sbjct: 295 YVLLCRDYRSSFMWLLPLKSTKFKHLIPVVSSLFLSFA-RIPIFVTSSTLDKDDLYDICE 353

Query: 296 KISREYHISLGLGTNNKHDHFHLSGIEMFKQLVNLNKSKCLKSWSNFLVFGSVLHNNKFN 355
           +I+ +Y + +GLG  +    FH  GI   +  +N  K +CL  W   L +G    N + N
Sbjct: 354 EIASKYGLRIGLGLKSSA-RFHTGGILCIQYALNSYKEECLADWGKCLRYGPYRFNRRRN 412

Query: 356 SRILSKPIDIINCNNLAQGKKKFRDRRLRIIKQTITDNYVKLGNVASIIFIED 408
            R   KP  ++  + +     KF  +R R+I+ T   N   +     +I++ED
Sbjct: 413 KRTKRKPTQVL-LSEVPGHNAKFETKRERVIENTYARNMFTMAGGKGLIYLED 464

>Smik_4.356 Chr4 (637418..639148) [1731 bp, 576 aa] {ON} YDR110W
           (REAL)
          Length = 576

 Score =  205 bits (521), Expect = 7e-59,   Method: Compositional matrix adjust.
 Identities = 128/376 (34%), Positives = 206/376 (54%), Gaps = 17/376 (4%)

Query: 35  LGISYTDYLDEKNSNVNIELLEKGYKDMQRYHSIKAAVLTQEYCDMLNTGTLSPENIIKY 94
           +G SYT+Y+D   S +N+ELLE+G ++   +       LTQ+  +++ T +L+ + + + 
Sbjct: 53  MGESYTEYVD---SYLNLELLERGERETPIFLESLTRQLTQKIYELIKTKSLTADTLQQI 109

Query: 95  DTKLTNHSKALEKYNFTSRRYYLNEDNNIIDKRKPGRIICEPKYMYDIVIAYHL--KLHS 152
             K  +   A  K  F  R+YY++++ N+ D R   +I CEP ++YD+V+A HL  K   
Sbjct: 110 SDKY-DGVVAENKLLFLQRQYYVDDEGNVRDGRNNDKIYCEPNHIYDMVMATHLINKHLR 168

Query: 153 SYAVSERLKKFFSNVGRQYIDYCAKYCSKCFPDETEHMKLFTDDITFKNIRNNIIDRPLF 212
              +   L  +F+N+    ID+  ++CSKC  ++   +K   +   +K  R ++ D+ L 
Sbjct: 169 GKTLHSFLFSYFANISHAIIDWVQQFCSKC--NKKGKIKPLKE---YK--RPDMYDK-LL 220

Query: 213 PMERIHIEIFNPFDDLKIENKYQRILYIRDYSTRYIWTFTLKKLKLKHITNILTEFFLSI 272
           PMERIHIE+F PF    IE KY  +L  RDY + ++W   LK  K KH+  +++  FLS 
Sbjct: 221 PMERIHIEVFEPFSGETIEGKYSYVLLCRDYRSSFMWLLPLKSTKFKHLIPVISSLFLSF 280

Query: 273 ATNVPIFLQSSTIDNTDLFDICEKISREYHISLGLGTNNKHDHFHLSGIEMFKQLVNLNK 332
           A  VPIF+ SST+D  DL+DICE+I+ +Y + +GLG  +    FH  GI      +N  K
Sbjct: 281 A-RVPIFVTSSTLDKDDLYDICEEIASKYGLRIGLGLKSSA-RFHTGGILCIHYALNSYK 338

Query: 333 SKCLKSWSNFLVFGSVLHNNKFNSRILSKPIDIINCNNLAQGKKKFRDRRLRIIKQTITD 392
            +CL  W   L +G    N + N R   KP  ++  + +     KF  +R R+I+ T + 
Sbjct: 339 EECLADWGKCLRYGPYRFNRRRNKRTKRKPAQVL-LSEIPGHNAKFETKRERVIENTYSR 397

Query: 393 NYVKLGNVASIIFIED 408
           N  K      +I++ED
Sbjct: 398 NMFKTAGGKGLIYLED 413

>KLTH0G13684g Chr7 complement(1171645..1173171) [1527 bp, 508 aa]
           {ON} weakly similar to uniprot|O13329 Saccharomyces
           cerevisiae YDR110W FOB1 Nucleolar protein required for
           DNA replication fork blocking and recombinational
           hotspot activities binds to the replication fork barrier
           site in the rDNA region related to retroviral integrases
          Length = 508

 Score =  202 bits (515), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 119/377 (31%), Positives = 212/377 (56%), Gaps = 22/377 (5%)

Query: 43  LDEKNSNVNIELLEKGYKDMQRYHSIKAAVLTQEYCDMLNTGTLSPENIIKYDTKLTNHS 102
           +++ ++ +N+ELLE+G  D  +Y       LTQ+  D++ + +L+ +N++    KL  H+
Sbjct: 28  IEKYHNGLNLELLERGRLDFIKYQESVKGQLTQDQFDLVRSCSLTEDNLMTTSDKL--HA 85

Query: 103 KALE-KYNFTSRRYYLNEDNNIIDKRKPGRIICEPKYMYDIVIAYHLK---LHSSYAVSE 158
             +E K+    RRYY++ D  + D +    ++CEP+ M+D+++  HLK   LH    +  
Sbjct: 86  GNVETKFLLLKRRYYVDADGIVRDYKCSDTVVCEPELMFDLIMCGHLKNGHLHWR-RLHS 144

Query: 159 RLKKFFSNVGRQYIDYCAKYCSKCFPDETEHMKLFTDDITFKNIRNNIIDRPLFPMERIH 218
            L+  ++N  R +   C KYCS+C P+E            +K  R+  I   L P+ER+H
Sbjct: 145 YLRHNYANTTRAFAQICVKYCSQCNPEEELR--------PYKKFRHTNIYSGLLPLERVH 196

Query: 219 IEIFNPFDDLKIENKYQRILYIRDYSTRYIWTFTLKKLKLKHITNILTEFFLSIATNVPI 278
           +EI +PF +  IE  Y  +L+ RDY +R++W   LK   ++ IT  L    L +   +PI
Sbjct: 197 VEIISPFSE-AIEGTYSHVLFFRDYYSRFVWMQPLKGDDVRDITKGLLAT-LLLLPRIPI 254

Query: 279 FLQSSTIDNTDLFDICEKISREYHISLGLGTNNKHDHFHLSGIEMFKQLVNLNKSKCLKS 338
           F+++STID  DLF+ CE ++ +Y + +GLG + +   F  +G+E  + L+  N+ +CL+S
Sbjct: 255 FIETSTIDRQDLFEACEDVAGQYSLYIGLGMS-QSSTFQKNGVERLRYLLQRNEEQCLRS 313

Query: 339 WSNFLVFGSVLHNNKFNSRILSKPIDIINCNNLAQGKKKFRDRRLRIIKQTITDNYVKL- 397
           W   L +G+  HN  +N+RIL  P ++++      G ++F  +R  +I++    N V++ 
Sbjct: 314 WYMCLKYGATNHNLNYNARILGVPGNLLHSTVCDYG-RQFELKREDLIEKLFARNVVEIK 372

Query: 398 --GNVASIIFIEDEATS 412
             G    II++EDE ++
Sbjct: 373 VSGRRRGIIYLEDETSA 389

>CAGL0B01771g Chr2 (163063..164673) [1611 bp, 536 aa] {ON} weakly
           similar to uniprot|O13329 Saccharomyces cerevisiae
           YDR110w FOB1 DNA replication fork blocking protein
          Length = 536

 Score =  200 bits (509), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 125/401 (31%), Positives = 215/401 (53%), Gaps = 27/401 (6%)

Query: 23  KLEMLKIYNPKDLGISYTDYLDEKNSNVNIELLEKGYKDMQRYHSIKAAVLTQEYCDMLN 82
           +LE+   +    L  +Y DYL  ++S ++++ L++G KDM+R+    A  LTQE   +L 
Sbjct: 53  ELELYNKFVMPALDETYEDYLVGEDSTIDVDFLKRGEKDMRRFAEGLAGKLTQETYTLLM 112

Query: 83  TGTLSPENIIKYDTKLTNHSKALEKYNFTSRRYYLNEDNNIIDKRKPGRIICEPKYMYDI 142
              L+ E ++K    +   + A  KY+   +R+Y +++ NI D +    I+ EP  ++++
Sbjct: 113 NNNLTMETVMKA-MNIWPPNAAETKYSNLIKRFYKDKEGNIRDAKVDNNIVLEPDKLFNL 171

Query: 143 VIAYHLK-LHSSYAVS-ERLKKFFSNVGRQYIDYCAKYCSKCFPDETEHMKLFTDDITFK 200
           ++  HLK  H   AV  + L++ ++N  R ++     YC++C PD   ++K        +
Sbjct: 172 ILTAHLKNGHLKTAVLFQCLREVYANCTRDFVQTALFYCNRCNPDR--YIK------PIE 223

Query: 201 NIRNNIIDRPLFPMERIHIEIFNPFDD--------------LKIENKYQRILYIRDYSTR 246
            +R+  I+  L P+ER+HIE+F PF+               +KIE KY  + Y RD+ TR
Sbjct: 224 KVRHRNINEELLPLERVHIEVFAPFEKEEGDIKQEDSQNPYIKIEGKYSHVFYCRDFRTR 283

Query: 247 YIWTFTLKKLKLKHITNILTEFFLSIATNVPIFLQSSTIDNTDLFDICEKISREYHISLG 306
           Y+W F LK +K K + + +  FF+++  + PIF++SSTID  DL +I E ++ +Y + LG
Sbjct: 284 YVWCFPLKNMKFKTLVDNIATFFMTVLYDPPIFVESSTIDRDDLKEIFELLASKYGLKLG 343

Query: 307 LGTNNKHDHFHLSGIEMFKQLVNLNKSKCLKSWSNFLVFGSVLHNNKFNSRILSKPIDII 366
           LG  N    FH  GI+ FK  ++  KS+C   W   L  G+    N+   R L K  +I+
Sbjct: 344 LGFAN-FTKFHAQGIKRFKTHLHRAKSECADDWLMCLKQGT-YSANRVIERQLGKASNIL 401

Query: 367 NCNNLAQGKKKFRDRRLRIIKQTITDNYVKLGNVASIIFIE 407
               + Q ++  R ++L+ I+Q+ ++N          IFIE
Sbjct: 402 FTELMGQFERDMRKKKLKYIEQSFSENIKTYPKSGGCIFIE 442

>NCAS0B03850 Chr2 complement(685424..687190) [1767 bp, 588 aa] {ON}
           Anc_8.262 YDR110W
          Length = 588

 Score =  196 bits (498), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 113/384 (29%), Positives = 206/384 (53%), Gaps = 19/384 (4%)

Query: 27  LKIYNPKDLGISYTDYLDEKNSNVNIELLEKGYKDMQRYHSIKAAVLTQEYCDMLNTGTL 86
           LK Y   ++G  Y DY+DE   ++++  +++G ++   +       L +   +++ T +L
Sbjct: 79  LKGYLIPNIGEKYKDYVDE---DMDLAFVQRGEREFFEFQKTINGQLNESTYELIKTNSL 135

Query: 87  SPENIIKYDTKLTNHSKALEKYNFTSRRYYLNEDNNIIDKRKPGRIICEPKYMYDIVIAY 146
           + E +     K+ +  +A  +  F +RRY L+E  N+ DK +  R++CEP ++YD+++ +
Sbjct: 136 TQETLSATALKM-DKFRAASRLVFLNRRYGLDEQGNVRDKLRQNRMVCEPVFIYDMIMTW 194

Query: 147 HL--KLHSSYAVSERLKKFFSNVGRQYIDYCAKYCSKCFPDETEHMKLFTDDITFKNIRN 204
           HL           + L   +SN+ R +++   ++CS C P +        + I FK  ++
Sbjct: 195 HLINDHGRPRKCHQLLGPMYSNITRFFVERICQFCSVCNPSK--------ETIPFKKYKH 246

Query: 205 NIIDRPLFPMERIHIEIFNPFDDLKIENKYQRILYIRDYSTRYIWTFTLKKLKLKHITNI 264
               + L P+ER+ +E+F PF   K+  KY +ILY RDY +R+IW   L+  K  H+ ++
Sbjct: 247 INWFKGLLPLERVQVEVFEPFPGEKLGGKYPQILYFRDYRSRFIWMVPLRNSKFGHLVDL 306

Query: 265 LTEFFLSIATNVPIFLQSSTIDNTDLFDICEKISREYHISLGLGTNNKHDHFHLSGIEMF 324
           +++   S+   +PIF +++TI+N D FDI EKI  +Y I++GLGT         +G+   
Sbjct: 307 ISKMIFSM-IRIPIFFETTTIENQDFFDIFEKIVEKYQINIGLGTKLGGKRL-TNGLPQI 364

Query: 325 KQLVNLNKSKCLKSWSNFLVFGSVLHNNKFNSRILSKPIDIINCNNLAQGKKKFRDRRLR 384
           ++L+  +K +CL  W   L +G    NNK N R    P D++   ++     K  D+  +
Sbjct: 365 RKLLGPHKEECLADWIMCLKYGPHTFNNKMNDRACGVPGDLL-TGDIPDLYTKSYDKIEQ 423

Query: 385 IIKQTITDNYVKLGNVASIIFIED 408
           I++   T+N VK+G     I++ED
Sbjct: 424 ILQDLPTENIVKIGR--GCIYLED 445

>KLLA0F19140g Chr6 (1773327..1774910) [1584 bp, 527 aa] {ON} some
           similarities with uniprot|O13329 Saccharomyces
           cerevisiae YDR110W FOB1 Nucleolar protein required for
           DNA replication fork blocking and recombinational
           hotspot activities binds to the replication fork barrier
           site in the rDNA region related to retroviral integrases
          Length = 527

 Score =  189 bits (479), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 131/430 (30%), Positives = 223/430 (51%), Gaps = 39/430 (9%)

Query: 34  DLGISYTDYLDEKNSNVNIELLEKGYKDMQRYHSIKAAVLTQEYCDMLNTGTLSPENIIK 93
           DLG S+   LD+       ++L +G   +++  +     LTQ   D+L++  L+ EN+++
Sbjct: 65  DLG-SFCGELDQ-------DMLIEGRLQLEKEINTVKGQLTQPIYDLLHSDALTKENLLR 116

Query: 94  YDTKLTNHSKALEKYNFTSRRYYLNEDNNIIDKRKPGRIICEPKYMYDIVIAYH-LKLH- 151
              K+TN S    K+    RRYY+ E N + D ++   ++ EP  ++D++++ H L  H 
Sbjct: 117 ASDKVTN-STVENKFVLLKRRYYVQE-NLLHDVKRKDLVVYEPNELFDLIMSVHVLNSHV 174

Query: 152 SSYAVSERLKKFFSNVGRQYIDYCAKYCSKCFPDETEHMKLFTDDITFKNIRNNIIDRPL 211
           SS  +   L  F++NV + +      +CSKC  +E+       + I++K  ++  I   L
Sbjct: 175 SSKGIYNELSTFYANVTQSFCKLVTSFCSKC--NES------GNKISYKKFKHENIHANL 226

Query: 212 FPMERIHIEIFNPFD----------DLKIENKYQRILYIRDYSTRYIWTFTLKKLKLKHI 261
            P+ R H+EIF PFD          +LKIE KY  +LY RDY +RY+W   LK + L  +
Sbjct: 227 IPLGRCHVEIFAPFDSAYQGNDNTDELKIEGKYPFVLYCRDYYSRYVWLEPLKSVTLSDL 286

Query: 262 TNILTEFFLSIATNVPIFLQSSTIDNTDLFDICEKISREYHISLGLGTNNKHDHFHLSGI 321
             ++T+   S+   +PIF+ + T+D  D+FD+CE I+R Y I +GLG N+    F  +GI
Sbjct: 287 LPVMTKLLFSM-IRMPIFIDTCTLDRQDMFDVCENIARIYKIKIGLGMNSS-TSFQKTGI 344

Query: 322 EMFKQLVNLNKSKCLKSWSNFLVFGSVLHNNKFNSRILSKPIDIINCNNLAQGKKKFRDR 381
           +  K L   +K +CL  W+  L       N  ++ R+   P D++ C+      KKFR  
Sbjct: 345 KRMKSLFLQHKEECLHDWNMCLKLVVSRLNQNYSDRVRGVPSDLL-CSTQQDLHKKFRTL 403

Query: 382 RLRIIKQTITDNYVKLGNVASIIFIEDEATSIAEGLTLEGNDKYEQFSDEYRSDI-DVIE 440
           +  +I + +  + V+      +I++EDE +     L L G+D  E+   E+ S+I D + 
Sbjct: 404 QRNVISRLLGHHVVQFEEAGGMIYLEDENSP---NLLLSGDDNSEE--SEHDSEIFDELA 458

Query: 441 DDSYDIPLSD 450
                 P+S+
Sbjct: 459 SSRDGTPISE 468

>Ecym_4308 Chr4 complement(654030..655619) [1590 bp, 529 aa] {ON}
           similar to Ashbya gossypii AGR086C
          Length = 529

 Score =  183 bits (465), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 108/367 (29%), Positives = 204/367 (55%), Gaps = 18/367 (4%)

Query: 53  ELLEKGYKDMQRYHSIKAAVLTQEYCDMLNTGTLSPENIIKYDTKLTNHSKALEKYNFTS 112
           + L+ G  ++ +  +     LTQ+  +++++ TLS + +++   K+T  +    K+    
Sbjct: 54  DWLDTGRNELIKLINTVKGQLTQDIYELISSNTLSTQTLLECCDKVTAGT-VENKFVLLK 112

Query: 113 RRYYLNEDNNIIDKRKPGRIICEPKYMYDIVIAYHL-KLHSSY-AVSERLKKFFSNVGRQ 170
           RRY + +  N++D ++    + EP  ++D+++A HL   H  +  + + LK  ++NV R 
Sbjct: 113 RRYSILQ-GNVVDHKREDLPVIEPDLVFDVIMAAHLINGHLPWRKIHQHLKNLYANVTRD 171

Query: 171 YIDYCAKYCSKCFPDETEHMKLFTDDITFKNIRNNIIDRPLFPMERIHIEIFNPFDD--- 227
           + +    YCS C  D   +MK F   + +K+   N+ D+ + P+ER H+EIF PFDD   
Sbjct: 172 FTNLVTLYCSHCNTDR--NMKRF---LRYKHY--NVYDK-VMPLERCHVEIFAPFDDDGN 223

Query: 228 LKIENKYQRILYIRDYSTRYIWTFTLKKLKLKHITNILTEFFLSIATNVPIFLQSSTIDN 287
            KIE+KY  +LY RDY +R++W   L+ +  + +   LT+   S+   +PIFL+++T+D 
Sbjct: 224 EKIEDKYSHVLYCRDYHSRFVWMLPLEGITFRDLVPALTQLLCSM-IRLPIFLETATLDR 282

Query: 288 TDLFDICEKISREYHISLGLGTNNKHDHFHLSGIEMFKQLVNLNKSKCLKSWSNFLVFGS 347
            D+FD+CE I+R+Y + +GLG N+  D F  +G+   K L   +K +C+K W+  L    
Sbjct: 283 QDMFDVCEYIARKYKLKIGLGLNSGTD-FQRNGVTRIKNLFAEHKEQCIKEWNMCLRLVL 341

Query: 348 VLHNNKFNSRILSKPIDIINCNNLAQGKKKFRDRRLRIIKQTITDNYVKLGNVASIIFIE 407
              N  ++ R+   P D++ CN ++    KF+ ++ +II +    + V+      +I++E
Sbjct: 342 TRVNQNYSDRVRGIPSDLL-CNEISNIAHKFKLKQRKIIDELYAHHVVQFREAGGMIYLE 400

Query: 408 DEATSIA 414
           D+ ++  
Sbjct: 401 DDNSAFV 407

>Kpol_543.38 s543 (84712..86040) [1329 bp, 442 aa] {ON}
           (84712..86040) [1329 nt, 443 aa]
          Length = 442

 Score =  176 bits (446), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 121/415 (29%), Positives = 213/415 (51%), Gaps = 33/415 (7%)

Query: 29  IYNPKDLGISYTDYLDEKNSNVNIELLEKGYKDMQRYHSIKAAVLTQEYC-----DMLNT 83
           +++   +G +  +Y+D   S+ ++  LE G    + Y       L+Q        D+L+ 
Sbjct: 42  VFDYPKVGATLYEYID---SSYSVPFLEFGRGAAKEYLDSIIGTLSQTVYELIRDDLLDV 98

Query: 84  GTLSPENIIKYDTKLTNHSKALEKYNFTSRRYYLNEDNNIIDKRKPGRIICEPKYMYDIV 143
            TLS +      +++  ++K L    +  RRY L +   +ID  +  +I+ EP   YD +
Sbjct: 99  DTLSEKTRW---SRINANAKCL----YLKRRYKLTKKGTVIDLTRENKIVYEPDLRYDYI 151

Query: 144 IAYH-LKLHSSY-AVSERLKKFFSNVGRQYIDYCAKYCSKCFPDET-EHMKLFTDDITFK 200
           I+ H L  H  Y  + +RLK  +SN+ R YI     +CS C PD+   +++        K
Sbjct: 152 ISTHILNRHLGYQGIHKRLKAIYSNLSRDYIKMVLDFCSHCNPDKVIPNLE--------K 203

Query: 201 NIRNNIIDRPLFPMERIHIEIFNPFDDLKIENKYQRILYIRDYSTRYIWTFTLKKLKLKH 260
            +  NI ++ L P+ER+ ++IF PF++ KI+N+Y  I+YIRDY +R++W + LK  K K 
Sbjct: 204 TVHMNIYEKYL-PLERVQLDIFEPFENEKIQNRYSHIIYIRDYRSRFVWIYPLKNTKFKT 262

Query: 261 ITNILTEFFLSIATNVPIFLQSSTIDNTDLFDICEKISREYHISLGLGTNNKHDHFHLSG 320
           + + +    L +   +PI++ ++TI+  D+  IC++I+ +Y ISLG+GT  +   F+  G
Sbjct: 263 LASEIGMLLLDLP-RIPIYIDTTTIERRDMLAICKRIAEKYEISLGIGT-IEPSSFYSIG 320

Query: 321 IEMFKQLVNLNKSKCLKSWSNFLVFGSVLHNNKFNSRILSKPIDIINCNNLAQGKKKFRD 380
           +   K L+N NK KCLK W+  L  GS  +N K  +     P ++   + +      F  
Sbjct: 321 LSRLKCLLNENKDKCLKDWNMCLKLGSYYYNKKSITTARGVPSELF-LDEMECSATTFES 379

Query: 381 RRLRIIKQTITDNYVKLGNVASIIFIEDE--ATSIAEGLTLE-GNDKYEQFSDEY 432
           +R  II      N  K      +++ +DE   TS  +   +E G+D + ++ D +
Sbjct: 380 KRTEIINSLPIQNSYKTSTNKGLVYAQDEILTTSKNKSSNMENGDDTFLEYDDTF 434

>NDAI0J01380 Chr10 complement(317185..319059) [1875 bp, 624 aa] {ON}
           Anc_8.262 YDR110W
          Length = 624

 Score =  175 bits (443), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 108/379 (28%), Positives = 198/379 (52%), Gaps = 22/379 (5%)

Query: 34  DLGISYTDYLDEKNSNVNIELLEKGYKDMQRYHSIKAAVLTQEYCDMLNTGTLSPENIIK 93
           ++G SY DY+D +   V+++LL++G      +       L +   +++ T +L+ E +  
Sbjct: 95  NVGESYMDYVDPE---VDVDLLKRGEVTFLNFQRSIHGQLDEVVYELIRTKSLTEETL-- 149

Query: 94  YDTKLTNHSKALEKYNFTSRRYYLNEDNNIIDKRKPGRIICEPKYMYDIVIAYHL-KLHS 152
                  H  A  +     RRY  + +  + D+ +  RI+C+P  +Y++++  HL   H+
Sbjct: 150 --AANFPHFHAPTRCALFKRRYVADNEGRVRDQLRGNRIVCDPVLLYEMMMTCHLMNDHA 207

Query: 153 SYAVSE-RLKKFFSNVGRQYIDYCAKYCSKCFPDETEHMKLFTDDITFKNIRNNIIDRPL 211
            Y      L   ++N+ R ++    ++CS C P      KL    + FK++      + +
Sbjct: 208 QYRRCHVALSSIYANITRDFLYKAVQFCSVCNPS-----KLVGPLLKFKHVN---YYKGM 259

Query: 212 FPMERIHIEIFNPFDDLKIENKYQRILYIRDYSTRYIWTFTLKKLKLKHITNILTEFFLS 271
            P+ER+HIEIF PF+  KIE KY  ++Y RDY +RYI    LK  K K++ + + +   +
Sbjct: 260 LPLERVHIEIFEPFNGKKIEGKYSHVIYCRDYRSRYIMLEPLKNTKFKNLVSAIAKLLFN 319

Query: 272 IATNVPIFLQSSTIDNTDLFDICEKISREYHISLGLGTNNKHDHFHLSGIEMFKQLVNLN 331
           +   +PIF+++ +++  D FDI E I  +Y I++GLG       FH  G++  K L+  +
Sbjct: 320 LP-RIPIFIETVSLNTQDAFDIFEAIVEKYQINVGLGMKTAK-RFHTRGVKQMKILLEGH 377

Query: 332 KSKCLKSWSNFLVFGSVLHNNKFNSRILSKPIDIINCNNLAQGKKKFRDRRLRIIKQTIT 391
           + +CL  W+  L +G   +N K N R    P+D++ C N+     K  ++  +II+    
Sbjct: 378 RKECLNDWTMCLKYGPHNYNTKHNDRACGVPVDLLTC-NVKDVTHKSIEKYEQIIRTLPK 436

Query: 392 DNYVKLGNVASIIFIEDEA 410
           DN V++GN +  I++E++ 
Sbjct: 437 DNIVQIGNGS--IYLEEKV 453

>AGR086C Chr7 complement(888758..890362) [1605 bp, 534 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR110W
           (FOB1)
          Length = 534

 Score =  169 bits (428), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 107/365 (29%), Positives = 192/365 (52%), Gaps = 18/365 (4%)

Query: 53  ELLEKGYKDMQRYHSIKAAVLTQEYCDMLNTGTLSPENIIKYDTKLTNHSKALEKYNFTS 112
           E +++G  ++++        LTQE  D++ + TLS + +++   K+T ++    KY    
Sbjct: 48  EWIDRGRGELRKIMKTVKGQLTQEIYDLIASDTLSTQKLLECCDKVTPNT-VENKYVLLK 106

Query: 113 RRYYLNEDNNIIDKRKPGRIICEPKYMYDIVIAYHL-KLHSSY-AVSERLKKFFSNVGRQ 170
           RRY + +   +ID+++    + EP  ++D++++ HL   H  +  V + +K  ++NV R+
Sbjct: 107 RRY-VAKGGIVIDRKRKDAPVIEPDSLFDMIMSAHLINDHMPWRKVYQHMKGLYANVTRE 165

Query: 171 YIDYCAKYCSKCFPDETEHMKLFTDDITFKNIRNNIIDRPLFPMERIHIEIFNPFDDL-- 228
             +    YCS C  D +           F   ++  +   L P+ER H+E+F PFDD   
Sbjct: 166 LTNMVTGYCSHCNMDRSVR--------RFSRYKHYNVHEKLMPLERCHVEVFAPFDDEGV 217

Query: 229 -KIENKYQRILYIRDYSTRYIWTFTLKKLKLKHITNILTEFFLSIATNVPIFLQSSTIDN 287
            KI+ KY   LY RDY +R+IW   L+ +  +++   L +   ++   VPIFL+++T+D 
Sbjct: 218 EKIQGKYSHFLYCRDYHSRFIWLLPLEGIAFRYLLPALAQLLCTM-IRVPIFLETATLDR 276

Query: 288 TDLFDICEKISREYHISLGLGTNNKHDHFHLSGIEMFKQLVNLNKSKCLKSWSNFLVFGS 347
            D+FDICE I+R Y   +GLG N+  + F  +GI+  KQL++  K +C   W+  L    
Sbjct: 277 QDMFDICEVIARRYKFKIGLGLNSGTE-FQKNGIKRVKQLLSEYKEECQDDWNMCLRLVL 335

Query: 348 VLHNNKFNSRILSKPIDIINCNNLAQGKKKFRDRRLRIIKQTITDNYVKLGNVASIIFIE 407
              N  +  R+   P D++ CN +     KF+ ++ +II Q    + V       +I++E
Sbjct: 336 SRVNQTYADRVRGIPSDLL-CNEIPNISMKFKQKQKKIIDQLYAHHVVHFKEAGGMIYLE 394

Query: 408 DEATS 412
           DE ++
Sbjct: 395 DEESA 399

>TPHA0J00740 Chr10 (175036..176262) [1227 bp, 408 aa] {ON} Anc_8.262
           YDR110W
          Length = 408

 Score =  166 bits (419), Expect = 9e-46,   Method: Compositional matrix adjust.
 Identities = 114/384 (29%), Positives = 197/384 (51%), Gaps = 34/384 (8%)

Query: 45  EKNSNVNIELLEKGYKDMQRYHSIKAAVLTQEYCDMLNTGTLSPENIIKYDTKLTNH--- 101
           E  S+++IE +  G  D  +  S+ ++ LTQ+   ++     + E    ++  + +H   
Sbjct: 34  ELGSDIDIERINHGRNDHLQLESVFSSFLTQKMYTLIREKNFNYET---FEEAMKSHYTD 90

Query: 102 -----SKALEKYNFTSRRYYLNEDNNIIDKRKPGRIICEPKYMYDIVIAYH-LKLH-SSY 154
                  A +K+     RY LNE   I DKR   ++I  P  +YD+++  H L  H  S 
Sbjct: 91  SGKYMGTANKKFMLMEDRYQLNELGQITDKRNDYKLIVPPNQIYDLIMHCHFLNDHLGST 150

Query: 155 AVSERLKKFFSNVGRQYIDYCAKYCSKCFPDET----EHMKLFTDDITFKNIRNNIIDRP 210
            +   L++ +SN+ R  +    + CS C P  T    E+ + F+ D   KN         
Sbjct: 151 KIHHSLREKYSNISRALVRLSLQNCSHCNPKSTYKHIEYTRHFSCD---KN--------- 198

Query: 211 LFPMERIHIEIFNPFDDL-KIENKYQRILYIRDYSTRYIWTFTLKKLKLKHITNILTEFF 269
            F  E+IH+EIF PF+D+    NK+  ++YIRDY TRY+W + L+K+ +K + N L    
Sbjct: 199 -FAFEKIHVEIFQPFEDVDTFANKFSHVIYIRDYFTRYVWLYPLEKISVKELANTLATHL 257

Query: 270 LSIATNVPIFLQSSTIDNTDLFDICEKISREYHISLGLGTNNKHDHFHLSGIEMFKQLVN 329
           L ++  +PI+++S T+D ++L  I ++IS+  ++ LG+GT  K D F  SGI   K+L  
Sbjct: 258 L-LSLRIPIYIESLTLDESNLLKILKRISKTTNLILGVGT-TKLDEFQASGINHMKELFV 315

Query: 330 LNKSKCLKSWSNFLVFGSVLHNNKFNSRILSKPIDIINCNNLAQGKKKFRDRRLRIIKQT 389
            N+  C  +W+ +++     +N  +N  I   P++++    LA   K ++ +R R I  T
Sbjct: 316 QNREYCGNNWNKYVIRCQNHYNTTYNKWIYGIPLNLMAQETLADN-KTYKKKRQRTILLT 374

Query: 390 ITDNYVKLGNVASIIFIEDEATSI 413
           ++ N + L N  S ++ E    SI
Sbjct: 375 LSKNTILLKNGKSALYKESTENSI 398

>KNAG0H03240 Chr8 complement(603920..605479) [1560 bp, 519 aa] {ON}
           Anc_8.262 YDR110W
          Length = 519

 Score =  149 bits (377), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 113/394 (28%), Positives = 193/394 (48%), Gaps = 30/394 (7%)

Query: 35  LGISYTDYLDEKNSNVNIELLEKGYKDMQRYHSIKAAVLTQEYCDMLNTGTLSPENIIK- 93
           +G  +++Y DEK   ++IE  ++G +D+  Y   +   ++QE   +     ++ ENI + 
Sbjct: 39  IGDKWSNYADEK---LDIEFCKRGERDITAYAPTQPGRMSQELYALFKNDDVTKENIARL 95

Query: 94  YDTKLTNHSKALEKYNFTSRRYYLNEDNNIIDKRKPGRIICEPKYMYDIVIAYHL--KLH 151
           Y T  +       K  + +RRYY + +  I D     RI+ +P + +DI+++ HL  K  
Sbjct: 96  YPTDRSGDES--RKMMYITRRYYKDANGMIRDATMNNRIVYDPIHTFDIIMSCHLMNKHL 153

Query: 152 SSYAVSERLKKFFSNVGRQYIDYCAKYCSKCFPDETEHMKLFTDDITFKNIRNNIIDRPL 211
            S  V   L++F++N G   I    +YCS C P      K+      F+           
Sbjct: 154 GSERVYRCLREFYANGGPLLIKRTLEYCSVCNPSLKLTPKVQPKPYLFEKA--------- 204

Query: 212 FPMERIHIEIFNPFDDLKIENKYQRILYIRDYSTRYIWTFTLKKLKLKHITNILTEFFLS 271
            P+ERI IEI  PF + K+E KY  ++ ++D+  R+ W   LK  K K+I  ++ +  LS
Sbjct: 205 LPLERITIEIIEPFPNEKVEGKYSNMVVMKDFIGRFEWLEPLKNTKFKNIVPVVAKMILS 264

Query: 272 IATNVPIFLQSSTIDNTDLFDICEKISREYHISLGLGTNNKHDHFHLSGIEMFKQLVNLN 331
               VPI+++S+T+D +DLFDI E I  +Y I +GLG   +      +      + +N +
Sbjct: 265 FP-RVPIWVESNTLDWSDLFDIFEMIVTKYGIKIGLGCTTRSSAAQATA--RINRDLNDH 321

Query: 332 KSKCLKSWSNFLVFGSVLHNNKFNSRILSKPIDIINCNNLAQGKKKFRDRRLRIIKQTIT 391
             +CL  ++N L +G   +N          P DII+ ++  Q K KFR +R  I+K + +
Sbjct: 322 HDECLFDFNNCLKYGPTKYNQIKYLGFHKSPCDIIS-HSETQLKAKFRAKRAFILKHSPS 380

Query: 392 DNYVKLGNVASIIFI-------EDEATSIAEGLT 418
              +  G     +++       ED A S A+ L+
Sbjct: 381 SCVMNRG--MGTLYLESPNGIQEDAAASSADELS 412

>TPHA0A01810 Chr1 complement(365982..367355) [1374 bp, 457 aa] {ON}
           Anc_8.262 YDR110W
          Length = 457

 Score =  130 bits (326), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 105/369 (28%), Positives = 191/369 (51%), Gaps = 39/369 (10%)

Query: 53  ELLEKGYKDMQRYHSIKAAVLTQEYCDMLNTGTLSPENI---IKYDTKLTNHSKALEKYN 109
           +LL+KG  ++   +S K   L++E  D++    L+ +N+   +  D K      A+ +  
Sbjct: 51  QLLQKG--EIAVANS-KTNYLSKELYDLVKNDDLTRKNVAVALNLDEK-----NAITRLI 102

Query: 110 FTSRRYYLNEDNNIIDKRKPGRIICEPKYMYDIVIAYHL--KLHSSYAVSERLKKFFSNV 167
               RYY +    + D+ K  +I+ +P + + +V+  HL     +  A+   L K F+N+
Sbjct: 103 PLKHRYYRDSKLMVHDRSKQNKIVIDPAHRFRMVMTTHLLNDHLTRGAIYRTLSKCFANL 162

Query: 168 GRQYIDYCAKYCSKCFPDETEHMKLFTDDITFKNIRN----NIIDRP--LFPMERIHIEI 221
              +I    +YCS C  ++             KNIR      + + P  LF  ER+ +++
Sbjct: 163 SDPFIKTSIEYCSICNSNK-------------KNIRRKKEPQLSNSPDILF-YERLILDV 208

Query: 222 FNPFDDLKIENKYQRILYIRDYSTRYIWTFTLKKLKLKHITNILTEFFLSIATNVPIFLQ 281
             PF   KI+ +Y  IL I D+ T+++W+F LK LKL+ I + +TEF +++    P+F+ 
Sbjct: 209 VAPFGAKKIQKRYTHILTITDFHTKFMWSFPLKNLKLRTIISKVTEFIVALPVK-PVFIS 267

Query: 282 SSTIDNTDLFDICEKISREYHISLGLGTNNKHDHFHLSGIEMFKQLVNLNKSKCLKSWSN 341
           S T+   D+F++C  ++REY+IS+GLGT N    +  S      +++N +K++CLKSW  
Sbjct: 268 SFTLSLNDIFELCCYLAREYNISIGLGTRNMQKAY--SKNPYVTRILNSHKTECLKSWFM 325

Query: 342 FLVF-GSVLHNNKFNSRILSKPIDIINCNNLAQGKKKFRDRRLRIIKQTITDNYVKLGNV 400
            L +      N+KF+ R  +K   +   + +    KK+ +R   II +  ++N++ +   
Sbjct: 326 CLKWLADRQSNSKFDIRPPNKNYGLF--SGMTDFLKKYEERSKMIIGRLPSENFINIDEG 383

Query: 401 ASIIFIEDE 409
           +  I+ EDE
Sbjct: 384 SHFIYSEDE 392

>TBLA0F03070 Chr6 complement(745795..747132) [1338 bp, 445 aa] {ON}
           Anc_8.262 YDR110W
          Length = 445

 Score =  116 bits (291), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 106/370 (28%), Positives = 177/370 (47%), Gaps = 23/370 (6%)

Query: 47  NSNVNIELLEKGYKD-MQRYHSIKAAVLTQEYCDMLNTGTLSPENIIKYDTKLTNHSKAL 105
           +S ++ ++L++G K+ M+  +++K  + +  Y  M +   L  +  I    K+    K  
Sbjct: 42  DSYIDSDMLKRGEKETMEFRNTLKKHITSDLYYAMRDESLLEDDAPIPASLKIKTSKKM- 100

Query: 106 EKYNFTSRRYYLNEDNNIIDKRKPGRIICEPKYMYDIVIAYHLKLH--SSYAVSERLKKF 163
               +   RY  N D ++I+  K  +++CEPKY+Y + +  H   +   S  +   L   
Sbjct: 101 ----YLQIRYSKNSDGDLIET-KTNKLLCEPKYIYKLTMKAHFMNNHMRSNKLYRNLSMK 155

Query: 164 FSNVGRQYIDYCAKYCSKCFPDETEHMKLFTDDITFKNIRNNIIDRPLFPMERIHIEIFN 223
           + N+    +    +YCS C  + T  ++   D  +    RN  ID    P+ER+ I+I  
Sbjct: 156 YCNIPNLLVVLVLQYCSHC--NTTGKIR---DIRSNYGQRNQYID--YLPLERLQIDITK 208

Query: 224 PFDD--LKIENKYQRILYIRDYSTRYIWTFTLKKLKLKHITNILTEFFLSIATNVPIFLQ 281
           PF+D  +KI NKY  IL IRDY +RY W F LK   +K+I+  L +F +++    PIFL 
Sbjct: 209 PFNDSDIKIANKYSHILLIRDYHSRYSWIFPLKSPNIKNISTELGKFLVTLP-RTPIFLH 267

Query: 282 SSTIDNTDLFDICEKISREYHISLGLGTNNKHDHFHL-SGIEMFKQLVNL--NKSKCLKS 338
           S  I  + L  I  KI  EY I + +G         L  GI     L+NL  NK KC   
Sbjct: 268 SIGIPESQLIKILTKILLEYKIKIRIGIGGIKGRMFLRKGISRLVYLLNLKENKEKCKSD 327

Query: 339 WSNFLVFGSVLHNNKFNSRILSKPIDIINCNNLAQGKKKFRDRRLRIIKQTITDNYVKLG 398
           W   +   +   N +F+    S    +I     A+  K F ++R  ++   + +N +K+G
Sbjct: 328 WYQCIRNTTFKENRRFDRNTGSFANFLIG-KQKAELNKVFENKRDALLSDLLEENVLKIG 386

Query: 399 NVASIIFIED 408
              SII+ ++
Sbjct: 387 ECGSIIYFDN 396

>NDAI0D03010 Chr4 complement(712188..714524) [2337 bp, 778 aa] {ON} 
          Length = 778

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 58/266 (21%), Positives = 103/266 (38%), Gaps = 46/266 (17%)

Query: 73  LTQEYCDMLNTGTLSPENII-----KYDTKLTN--HSKALEKYNFTSRRYYLN---EDNN 122
           + + Y ++L  G L+P  I+     +Y   L N   +K L++     +R  L    ED  
Sbjct: 82  MNEMYAELLIRGKLTPRIIVEEIYKRYGIPLKNELQTKVLQRLRGRCKRMRLTYKFEDGK 141

Query: 123 II---DKRKPGRIICEPKYMYDIVIAYH---------LKLH-SSYAVSERLKKFFSNVGR 169
           +       K   I C P  ++ ++   H         L+ H     +   L   + N+ +
Sbjct: 142 LFFTSPHNKKKLIWCPPTLLHYVIACVHENWDCDDYTLRKHRDENEIQSILAAKYHNISK 201

Query: 170 QYIDYCAKYCSKCFPDETEHMKLFTDDITFKNIRNNIIDRPLFPMERIHIEIFNPFDDLK 229
             I      C  C P  ++          F   R N++    +  +R+ ++I +  D   
Sbjct: 202 FLIHDVVAACPDCKPLSSKK---------FNITRVNVLPLTRYSFQRLQVKILSAADYSC 252

Query: 230 IENK----YQRILYIRDYSTRYIWTFTLKKLKLKHITNILTEFFLSIATNVPIFLQSSTI 285
           +  K       ILYI DY +  +W F L   +      ++ E FL++    P  +Q   +
Sbjct: 253 VCPKDNCTKNAILYIGDYHSGAVWLFALDGEEDATDILLVLEMFLNVVLITPKHIQ---V 309

Query: 286 DNTDLFDICEKISREYHISLGLGTNN 311
           DN       +KI R+ +I+  L  NN
Sbjct: 310 DN-------QKIFRDENIAKFLADNN 328

>NDAI0G00600 Chr7 complement(130877..132343) [1467 bp, 488 aa] {ON} 
          Length = 488

 Score = 35.8 bits (81), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 27/56 (48%), Gaps = 1/56 (1%)

Query: 213 PMERIHIEIFNPFDDLKIENKYQRILYIRDYSTRYIWTFTLKKLKLKHITNILTEF 268
           PM  IH ++F P   + I +  +  +   D +TR+ W F LKK    HI  I  + 
Sbjct: 185 PMSYIHTDLFGPVSGVDITSP-KYFISFTDENTRFRWVFPLKKKDADHILPIFQQL 239

>NDAI0G00550 Chr7 complement(116985..118223) [1239 bp, 412 aa] {ON} 
          Length = 412

 Score = 35.8 bits (81), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 29/62 (46%), Gaps = 1/62 (1%)

Query: 213 PMERIHIEIFNPFDDLKIENKYQRILYIRDYSTRYIWTFTLKKLKLKHITNILTEFFLSI 272
           P E IH ++F P   + I +  +  +   D +TR+ W F LKK    HI  I  +    I
Sbjct: 290 PFEYIHTDLFGPVSGVDITSP-KYFISFTDENTRFRWVFPLKKKDADHILPIFQQLVNYI 348

Query: 273 AT 274
            T
Sbjct: 349 KT 350

>NDAI0B06160 Chr2 (1494425..1498636) [4212 bp, 1403 aa] {ON} 
          Length = 1403

 Score = 35.8 bits (81), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 28/57 (49%), Gaps = 3/57 (5%)

Query: 213 PMERIHIEIFNPFDDLKIEN-KYQRILYIRDYSTRYIWTFTLKKLKLKHITNILTEF 268
           P E IH ++F P   + I + KY   +   D +TR+ W F LKK    HI  I  + 
Sbjct: 375 PFEYIHTDLFGPVSGVDITSPKY--FISFTDENTRFRWVFPLKKKDADHILPIFQQL 429

>KAFR0B06620 Chr2 complement(1376088..1379645) [3558 bp, 1185 aa]
           {ON} 
          Length = 1185

 Score = 34.7 bits (78), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 35/166 (21%), Positives = 64/166 (38%), Gaps = 26/166 (15%)

Query: 213 PMERIHIEIFNPFDDLKIENKYQRILYIRDYSTRYIWTFTLKKLKLKHITNILTEFFLSI 272
           P + IH ++F P  D+        I ++ D +TR+ W + L+    +HI  +  +    I
Sbjct: 666 PFQYIHTDLFGPMSDVSATTPTYFISFV-DENTRFRWVYPLRSKSAEHILLVFRKLVNFI 724

Query: 273 ATNVPIFLQSSTIDNT--------DLFDICEKISREYHISLGLGTNNKHDHFHLSGIEMF 324
            T     +++  +D          D F I + I   Y+ +    +N         G+   
Sbjct: 725 RTQFSTKVKAFQMDRGSEYRNELLDDFFIDKGIKSIYNTAADSASN---------GVAER 775

Query: 325 KQLVNLNKSKCL--------KSWSNFLVFGSVLHNNKFNSRILSKP 362
             L+ LN  + L          W + + F +++ N   NS I   P
Sbjct: 776 TNLLFLNDCRTLLKATNLPNNMWYHAVEFATLIRNTMINSSINDSP 821

>TDEL0H04520 Chr8 complement(817439..819277) [1839 bp, 612 aa] {ON} 
          Length = 612

 Score = 33.5 bits (75), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 30/64 (46%), Gaps = 1/64 (1%)

Query: 213 PMERIHIEIFNPFDDLKIENKYQRILYIRDYSTRYIWTFTLKKLKLKHITNILTEFFLSI 272
           P + IH ++F P     + N  + +L   D  TRY W F L++   + IT   +E    I
Sbjct: 81  PFQFIHTDLFGPVQVTAV-NVPRYLLAFTDECTRYKWVFPLREKDSQSITARFSELVRFI 139

Query: 273 ATNV 276
            T +
Sbjct: 140 ETQL 143

>TDEL0E00260 Chr5 complement(46841..49489,49491..50588) [3747 bp,
           1248 aa] {ON} 
          Length = 1248

 Score = 33.9 bits (76), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 30/64 (46%), Gaps = 1/64 (1%)

Query: 213 PMERIHIEIFNPFDDLKIENKYQRILYIRDYSTRYIWTFTLKKLKLKHITNILTEFFLSI 272
           P + IH ++F P     + N  + +L   D  TRY W F L++   + IT   +E    I
Sbjct: 589 PFQFIHTDLFGPVQVTAV-NVPRYLLAFTDECTRYKWVFPLREKDSQSITARFSELVRFI 647

Query: 273 ATNV 276
            T +
Sbjct: 648 ETQL 651

>Smik_12.510 Chr12 (896477..897571) [1095 bp, 364 aa] {ON} YLR420W
           (REAL)
          Length = 364

 Score = 32.0 bits (71), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 31/136 (22%), Positives = 56/136 (41%), Gaps = 5/136 (3%)

Query: 43  LDEKNSNVNIELLEKGYKDMQRYHSIK-AAVLTQEYCDM-LNTGTLSPENIIKYDTKLTN 100
           L+   S   I+ +E   +D++    I+ AA LT  +  + ++    +P N  K   KL N
Sbjct: 178 LEHCTSESAIKTIEDINRDVKNAADIRVAATLTAHHLFLTIDDWAGNPVNFCKPVAKLPN 237

Query: 101 HSKALEKYNFTSRRYYL---NEDNNIIDKRKPGRIICEPKYMYDIVIAYHLKLHSSYAVS 157
             KAL K   + + Y+    +   + +  +     +C   Y     I Y  ++       
Sbjct: 238 DKKALVKAAVSGKPYFFFGSDSAPHTVQNKTKYMGVCAGVYSQSFAIPYVAQVFEEQNAL 297

Query: 158 ERLKKFFSNVGRQYID 173
           + LK F S+ G  + D
Sbjct: 298 QNLKGFVSDFGNSFYD 313

>NDAI0J02610 Chr10 complement(646697..647800) [1104 bp, 367 aa] {ON}
           Anc_4.294 YLR420W
          Length = 367

 Score = 31.2 bits (69), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 29/119 (24%), Positives = 56/119 (47%), Gaps = 9/119 (7%)

Query: 60  KDMQRYHSIK-AAVLTQEYCDM-LNTGTLSPENIIKYDTKLTNHSKALEKYNFTSRRYYL 117
           KD++    +K AA LT  +  + ++    +P N  K   KL N  +AL K   + + Y+ 
Sbjct: 198 KDIKDISEVKVAATLTVHHLYLTIDDWAGNPINFCKPVAKLPNDKRALIKAAISGKPYFF 257

Query: 118 ----NEDNNIIDK-RKPGRIICEPKYMYDIVIAYHLKLHSSYAVSERLKKFFSNVGRQY 171
               +  + +++K R  G  +C   +   +VI Y  ++   +   ++LK F S  G ++
Sbjct: 258 FGSDSAPHPLMNKARHVG--VCAGVFTQSLVIPYLAQVFEEFNALDKLKDFVSTFGLRF 314

>YLR420W Chr12 (963785..964879) [1095 bp, 364 aa] {ON}
           URA4Dihydroorotase, catalyzes the third enzymatic step
           in the de novo biosynthesis of pyrimidines, converting
           carbamoyl-L-aspartate into dihydroorotate
          Length = 364

 Score = 31.2 bits (69), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 31/134 (23%), Positives = 56/134 (41%), Gaps = 5/134 (3%)

Query: 43  LDEKNSNVNIELLEKGYKDMQRYHSIK-AAVLTQEYCDM-LNTGTLSPENIIKYDTKLTN 100
           L+   S   I+ +E   K++++   +K AA LT  +  + ++    +P N  K   KL N
Sbjct: 178 LEHCTSESAIKTIEDINKNVKKATDVKVAATLTAHHLFLTIDDWAGNPVNFCKPVAKLPN 237

Query: 101 HSKALEKYNFTSRRYYL---NEDNNIIDKRKPGRIICEPKYMYDIVIAYHLKLHSSYAVS 157
             KAL K   + + Y+    +   + +  +     +C   Y     I Y  ++       
Sbjct: 238 DKKALVKAAVSGKPYFFFGSDSAPHPVQNKANYEGVCAGVYSQSFAIPYIAQVFEEQNAL 297

Query: 158 ERLKKFFSNVGRQY 171
           E LK F S+ G  +
Sbjct: 298 ENLKGFVSDFGISF 311

>TBLA0I01360 Chr9 complement(290912..292627,292882..293148) [1983
           bp, 660 aa] {ON} Anc_2.447 YKL125W
          Length = 660

 Score = 31.2 bits (69), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 35/66 (53%), Gaps = 5/66 (7%)

Query: 131 RIICE--PKYMYDI---VIAYHLKLHSSYAVSERLKKFFSNVGRQYIDYCAKYCSKCFPD 185
           RI+C   PK+  DI   +I+  +  +SS +    L K+F NV    ++Y   Y SK FP+
Sbjct: 165 RILCSSIPKWWQDISMNLISNFILPNSSTSHHHDLLKYFLNVIPSSMNYIDSYLSKFFPN 224

Query: 186 ETEHMK 191
           + +  K
Sbjct: 225 KNDTRK 230

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.137    0.399 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 55,839,113
Number of extensions: 2768142
Number of successful extensions: 9955
Number of sequences better than 10.0: 63
Number of HSP's gapped: 10241
Number of HSP's successfully gapped: 63
Length of query: 481
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 368
Effective length of database: 40,524,141
Effective search space: 14912883888
Effective search space used: 14912883888
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 68 (30.8 bits)