Re-run this search with the SEG filter switched off

Re-run this search as BLASTP i.e. protein query (default)

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0E044308.262ON48145223800.0
SAKL0H17028g8.262ON5503836384e-76
Kpol_392.68.262ON4574126062e-72
KAFR0B055408.262ON5194236024e-71
TDEL0F038908.262ON4764125872e-69
Suva_2.2708.262ON6324625711e-65
YDR110W (FOB1)8.262ON5664505662e-65
Skud_4.3718.262ON5804625637e-65
Smik_4.3568.262ON5764255575e-64
Kwal_56.237998.262ON4884095421e-62
ZYRO0C01650g8.262ON5864125472e-62
KLTH0G13684g8.262ON5083775247e-60
CAGL0B01771g8.262ON5364015205e-59
NCAS0B038508.262ON5884535087e-57
KLLA0F19140g8.262ON5274304961e-55
Kpol_543.388.262ON4424124743e-53
Ecym_43088.262ON5293604706e-52
NDAI0J013808.262ON6244114615e-50
AGR086C8.262ON5343754559e-50
TPHA0J007408.262ON4084014461e-49
KNAG0H032408.262ON5193653776e-39
TPHA0A018108.262ON4573683535e-36
TBLA0F030708.262ON4454073526e-36
NDAI0D03010na 1ON7783091072e-04
KAFR0B06620singletonON1185158890.035
Kpol_1035.3singletonON1130259880.046
CAGL0L09669g2.653ON1662322850.11
NDAI0B06160singletonON140396840.14
NDAI0G00550singletonON41267830.14
NDAI0G00600singletonON48867830.15
TBLA0A054201.79ON129150810.32
NCAS0A06040na 1ON588221780.64
Kpol_423.43.535ON41265751.3
TBLA0I013602.447ON660117751.5
KNAG0B014403.368ON77778751.5
TPHA0G003307.523ON27169731.9
TBLA0H038908.590ON700165742.0
KLTH0F13904g7.168ON739150732.6
KAFR0L006607.201ON117381732.8
Kpol_1031.648.470ON607135723.4
Kpol_1002.976.140ON660110723.4
KLLA0E17843g3.126ON1099105723.7
NCAS0J005108.63ON360167713.8
TDEL0H04520singletonON61264714.4
TBLA0I028704.235ON759350714.6
TPHA0A037603.330ON1166132714.9
TDEL0E00260singletonON124864714.9
KLLA0A06061g1.198ON532120705.7
SAKL0H23320g4.67ON28793696.0
NDAI0J003507.536ON354122696.6
AGL022W8.69ON214572698.8
BLASTX 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= TBLA0E04430
         (1446 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0E04430 Chr5 (1136737..1138182) [1446 bp, 481 aa] {ON} Anc_8...   921   0.0  
SAKL0H17028g Chr8 complement(1495187..1496839) [1653 bp, 550 aa]...   250   4e-76
Kpol_392.6 s392 complement(8453..9826) [1374 bp, 457 aa] {ON} co...   238   2e-72
KAFR0B05540 Chr2 complement(1134547..1136106) [1560 bp, 519 aa] ...   236   4e-71
TDEL0F03890 Chr6 (724664..726094) [1431 bp, 476 aa] {ON} Anc_8.2...   230   2e-69
Suva_2.270 Chr2 (470408..472306) [1899 bp, 632 aa] {ON} YDR110W ...   224   1e-65
YDR110W Chr4 (676102..677802) [1701 bp, 566 aa] {ON}  FOB1Nucleo...   222   2e-65
Skud_4.371 Chr4 (647726..649468) [1743 bp, 580 aa] {ON} YDR110W ...   221   7e-65
Smik_4.356 Chr4 (637418..639148) [1731 bp, 576 aa] {ON} YDR110W ...   219   5e-64
Kwal_56.23799 s56 complement(708590..710056) [1467 bp, 488 aa] {...   213   1e-62
ZYRO0C01650g Chr3 complement(117323..119083) [1761 bp, 586 aa] {...   215   2e-62
KLTH0G13684g Chr7 complement(1171645..1173171) [1527 bp, 508 aa]...   206   7e-60
CAGL0B01771g Chr2 (163063..164673) [1611 bp, 536 aa] {ON} weakly...   204   5e-59
NCAS0B03850 Chr2 complement(685424..687190) [1767 bp, 588 aa] {O...   200   7e-57
KLLA0F19140g Chr6 (1773327..1774910) [1584 bp, 527 aa] {ON} some...   195   1e-55
Kpol_543.38 s543 (84712..86040) [1329 bp, 442 aa] {ON} (84712..8...   187   3e-53
Ecym_4308 Chr4 complement(654030..655619) [1590 bp, 529 aa] {ON}...   185   6e-52
NDAI0J01380 Chr10 complement(317185..319059) [1875 bp, 624 aa] {...   182   5e-50
AGR086C Chr7 complement(888758..890362) [1605 bp, 534 aa] {ON} S...   179   9e-50
TPHA0J00740 Chr10 (175036..176262) [1227 bp, 408 aa] {ON} Anc_8....   176   1e-49
KNAG0H03240 Chr8 complement(603920..605479) [1560 bp, 519 aa] {O...   149   6e-39
TPHA0A01810 Chr1 complement(365982..367355) [1374 bp, 457 aa] {O...   140   5e-36
TBLA0F03070 Chr6 complement(745795..747132) [1338 bp, 445 aa] {O...   140   6e-36
NDAI0D03010 Chr4 complement(712188..714524) [2337 bp, 778 aa] {O...    46   2e-04
KAFR0B06620 Chr2 complement(1376088..1379645) [3558 bp, 1185 aa]...    39   0.035
Kpol_1035.3 s1035 complement(5707..9099) [3393 bp, 1130 aa] {ON}...    39   0.046
CAGL0L09669g Chr12 (1036568..1041556) [4989 bp, 1662 aa] {ON} si...    37   0.11 
NDAI0B06160 Chr2 (1494425..1498636) [4212 bp, 1403 aa] {ON}            37   0.14 
NDAI0G00550 Chr7 complement(116985..118223) [1239 bp, 412 aa] {O...    37   0.14 
NDAI0G00600 Chr7 complement(130877..132343) [1467 bp, 488 aa] {O...    37   0.15 
TBLA0A05420 Chr1 (1329965..1333840) [3876 bp, 1291 aa] {ON} Anc_...    36   0.32 
NCAS0A06040 Chr1 complement(1193225..1194991) [1767 bp, 588 aa] ...    35   0.64 
Kpol_423.4 s423 complement(5205..6128,6130..6216,6218..6445) [12...    33   1.3  
TBLA0I01360 Chr9 complement(290912..292627,292882..293148) [1983...    33   1.5  
KNAG0B01440 Chr2 complement(272166..274499) [2334 bp, 777 aa] {O...    33   1.5  
TPHA0G00330 Chr7 (57459..58274) [816 bp, 271 aa] {ON} Anc_7.523 ...    33   1.9  
TBLA0H03890 Chr8 (940387..942489) [2103 bp, 700 aa] {ON} Anc_8.5...    33   2.0  
KLTH0F13904g Chr6 complement(1141955..1144174) [2220 bp, 739 aa]...    33   2.6  
KAFR0L00660 Chr12 complement(123550..127071) [3522 bp, 1173 aa] ...    33   2.8  
Kpol_1031.64 s1031 (161135..162958) [1824 bp, 607 aa] {ON} (1611...    32   3.4  
Kpol_1002.97 s1002 complement(243708..245690) [1983 bp, 660 aa] ...    32   3.4  
KLLA0E17843g Chr5 complement(1582644..1585943) [3300 bp, 1099 aa...    32   3.7  
NCAS0J00510 Chr10 (77425..78507) [1083 bp, 360 aa] {ON} Anc_8.63...    32   3.8  
TDEL0H04520 Chr8 complement(817439..819277) [1839 bp, 612 aa] {O...    32   4.4  
TBLA0I02870 Chr9 (677817..680096) [2280 bp, 759 aa] {ON} Anc_4.2...    32   4.6  
TPHA0A03760 Chr1 (821355..824855) [3501 bp, 1166 aa] {ON} Anc_3....    32   4.9  
TDEL0E00260 Chr5 complement(46841..49489,49491..50588) [3747 bp,...    32   4.9  
KLLA0A06061g Chr1 complement(559396..560994) [1599 bp, 532 aa] {...    32   5.7  
SAKL0H23320g Chr8 (2022223..2023086) [864 bp, 287 aa] {ON} simil...    31   6.0  
NDAI0J00350 Chr10 (58349..59413) [1065 bp, 354 aa] {ON} Anc_7.53...    31   6.6  
AGL022W Chr7 (674947..681384) [6438 bp, 2145 aa] {ON} Syntenic h...    31   8.8  

>TBLA0E04430 Chr5 (1136737..1138182) [1446 bp, 481 aa] {ON} Anc_8.262
            YDR110W
          Length = 481

 Score =  921 bits (2380), Expect = 0.0
 Identities = 452/452 (100%), Positives = 452/452 (100%)
 Frame = +1

Query: 1    MTNDSHQQNSNIQDLKSLTPDEKLEMLKIYNPKDLGISYTDYLDEKNSNVNIELLEKGYK 180
            MTNDSHQQNSNIQDLKSLTPDEKLEMLKIYNPKDLGISYTDYLDEKNSNVNIELLEKGYK
Sbjct: 1    MTNDSHQQNSNIQDLKSLTPDEKLEMLKIYNPKDLGISYTDYLDEKNSNVNIELLEKGYK 60

Query: 181  DMQRYHSIKAAVLTQEYCDMLNTGTLSPENIIKYDTKLTNHSKALEKYNFTSRRYYLNED 360
            DMQRYHSIKAAVLTQEYCDMLNTGTLSPENIIKYDTKLTNHSKALEKYNFTSRRYYLNED
Sbjct: 61   DMQRYHSIKAAVLTQEYCDMLNTGTLSPENIIKYDTKLTNHSKALEKYNFTSRRYYLNED 120

Query: 361  NNIIDKRKPGRIICEPKYMYDIVIAYHLKLHSSYAVSERLKKFFSNVGRQYIDYCAKYCS 540
            NNIIDKRKPGRIICEPKYMYDIVIAYHLKLHSSYAVSERLKKFFSNVGRQYIDYCAKYCS
Sbjct: 121  NNIIDKRKPGRIICEPKYMYDIVIAYHLKLHSSYAVSERLKKFFSNVGRQYIDYCAKYCS 180

Query: 541  KCFPDETEHMKLFTDDITFKNIRNNIIDRPLFPMERIHIEIFNPFDDLKIENKYQRILYI 720
            KCFPDETEHMKLFTDDITFKNIRNNIIDRPLFPMERIHIEIFNPFDDLKIENKYQRILYI
Sbjct: 181  KCFPDETEHMKLFTDDITFKNIRNNIIDRPLFPMERIHIEIFNPFDDLKIENKYQRILYI 240

Query: 721  RDYSTRYIWTFTLKKLKLKHITNILTEFFLSIATNVPIFLQSSTIDNTDLFDICEKISRE 900
            RDYSTRYIWTFTLKKLKLKHITNILTEFFLSIATNVPIFLQSSTIDNTDLFDICEKISRE
Sbjct: 241  RDYSTRYIWTFTLKKLKLKHITNILTEFFLSIATNVPIFLQSSTIDNTDLFDICEKISRE 300

Query: 901  YHISLGLGTNNKHDHFHLSGIEMFKQLVNLNKSKCLKSWSNFLVFGSVLHNNKFNSRILS 1080
            YHISLGLGTNNKHDHFHLSGIEMFKQLVNLNKSKCLKSWSNFLVFGSVLHNNKFNSRILS
Sbjct: 301  YHISLGLGTNNKHDHFHLSGIEMFKQLVNLNKSKCLKSWSNFLVFGSVLHNNKFNSRILS 360

Query: 1081 KPIDIINCNNLAQGKKKFRDRRLRIIKQTITDNYVKLGNVASIIFIEDEATSIAEGLTLE 1260
            KPIDIINCNNLAQGKKKFRDRRLRIIKQTITDNYVKLGNVASIIFIEDEATSIAEGLTLE
Sbjct: 361  KPIDIINCNNLAQGKKKFRDRRLRIIKQTITDNYVKLGNVASIIFIEDEATSIAEGLTLE 420

Query: 1261 GNDKYEQFSDEYRSDIDVIEDDSYDIPLSDTE 1356
            GNDKYEQFSDEYRSDIDVIEDDSYDIPLSDTE
Sbjct: 421  GNDKYEQFSDEYRSDIDVIEDDSYDIPLSDTE 452

>SAKL0H17028g Chr8 complement(1495187..1496839) [1653 bp, 550 aa] {ON}
            similar to uniprot|O13329 Saccharomyces cerevisiae
            YDR110W FOB1 Nucleolar protein required for DNA
            replication fork blocking and recombinational hotspot
            activities binds to the replication fork barrier site in
            the rDNA region related to retroviral integrases
          Length = 550

 Score =  250 bits (638), Expect = 4e-76
 Identities = 141/383 (36%), Positives = 221/383 (57%), Gaps = 3/383 (0%)
 Frame = +1

Query: 88   YNPKDLGISYTDYLDEKNSNVNIELLEKGYKDMQRYHSIKAAVLTQEYCDMLNTGTLSPE 267
            Y    LG S   Y    ++++N+ELLE+G +D  +Y       LTQ   +++ T TL+ E
Sbjct: 26   YVTPKLGESQVTY----STDLNVELLERGGRDFIKYLESVKGQLTQAQYELIKTDTLTLE 81

Query: 268  NIIKYDTKLTNHSKALEKYNFTSRRYYLNEDNNIIDKRKPGRIICEPKYMYDIVIAYHL- 444
             ++     L   S A  KY F  RRYY++ D  + D ++   I+CEP+ MY+++++ HL 
Sbjct: 82   TLLAVTDGLIP-SNAEAKYLFLKRRYYVDSDQIVRDHKRDDTIVCEPELMYELIVSGHLL 140

Query: 445  KLHSSYAVSER-LKKFFSNVGRQYIDYCAKYCSKCFPDETEHMKLFTDDITFKNIRNNII 621
              H  +    R LK  +SN+ R ++  CA+YCS+C P E   +K FT        ++   
Sbjct: 141  NNHLHWRKLHRFLKSQYSNITRDFVQMCARYCSECNPQE--EVKPFT------KFKHTNA 192

Query: 622  DRPLFPMERIHIEIFNPFD-DLKIENKYQRILYIRDYSTRYIWTFTLKKLKLKHITNILT 798
             + L P+ERIH+EIF PF  D  IE KY  +LY RDY +R++W   L  +  + +   LT
Sbjct: 193  YQGLLPLERIHVEIFKPFGTDELIEEKYSHVLYCRDYHSRFVWLSPLTGITFQELVPQLT 252

Query: 799  EFFLSIATNVPIFLQSSTIDNTDLFDICEKISREYHISLGLGTNNKHDHFHLSGIEMFKQ 978
            EF LS+   +PIFL+++T+D  D+FD+CE I+R+Y +++GLG NN   HF+ +GIE  K 
Sbjct: 253  EFLLSLP-RLPIFLETTTLDRQDMFDMCEYIARKYQLAIGLGLNNS-SHFYKNGIERMKY 310

Query: 979  LVNLNKSKCLKSWSNFLVFGSVLHNNKFNSRILSKPIDIINCNNLAQGKKKFRDRRLRII 1158
            L+  NK KC K W   L +GS  +N  +N RI+    D++ CN ++   KKF+ +R +II
Sbjct: 311  LLQTNKKKCAKDWGMCLKYGSYHNNTAYNPRIMGFSNDLL-CNEVSSCGKKFKLKREKII 369

Query: 1159 KQTITDNYVKLGNVASIIFIEDE 1227
             +    N V L +   ++++E+E
Sbjct: 370  HELFAHNVVTLKDTGGMVYVENE 392

>Kpol_392.6 s392 complement(8453..9826) [1374 bp, 457 aa] {ON}
            complement(8453..9826) [1374 nt, 458 aa]
          Length = 457

 Score =  238 bits (606), Expect = 2e-72
 Identities = 139/412 (33%), Positives = 225/412 (54%), Gaps = 6/412 (1%)
 Frame = +1

Query: 19   QQNSNIQDLKSLTPDEKLEMLKIYNPKDLGISYTDYLDE--KNSNVNIELLEKGYKDMQR 192
            +  S  +D   +  +E    L   + K+L +     LDE    S +N EL  +G++D+ +
Sbjct: 32   KSRSKSKDKSKIDDEEPAISLPRSHLKELVLPEIKNLDELISESGLNKELFNRGHQDLAK 91

Query: 193  YHSIKAAVLTQEYCDMLNTGTLSPENIIKYDTKLTNHSKALEKYNFTSRRYYLNEDNNII 372
            + S     L+Q   D++ T  L+P+ + +   K  N S   EKY F   RYY+++    +
Sbjct: 92   FQSTINGYLSQRIYDLILTDKLTPKKVSREKVKWANKSN--EKYYFLKNRYYVSDKGTTV 149

Query: 373  -DKRKPGRIICEPKYMYDIVIAYHL-KLHSSY-AVSERLKKFFSNVGRQYIDYCAKYCSK 543
             D+R   +I+C P  + ++V+  HL   H+++ +V   L K ++N+ R        YCS 
Sbjct: 150  RDRRNDDKILCPPNKVLEVVLCTHLINEHAAHKSVHRNLHKRYANISRTITRISLLYCSF 209

Query: 544  CFPDETEHMKLFTDDITFKNIRNNIIDRPLFPMERIHIEIFNPFDDLK-IENKYQRILYI 720
            C P  +EH+K        K  + N +   L P ERIHIEIF PF D K IE  Y  ILYI
Sbjct: 210  CNP--SEHVK------PLKKSKKNEVYEGLLPFERIHIEIFKPFGDEKLIEGTYSHILYI 261

Query: 721  RDYSTRYIWTFTLKKLKLKHITNILTEFFLSIATNVPIFLQSSTIDNTDLFDICEKISRE 900
            RDY +RY+W + LKK   K +T  L  +F +I T  PI+++SSTI+  DL  + +KI+ +
Sbjct: 262  RDYYSRYVWLYPLKKTAFKELTQTLVTYFFTI-TKTPIYIESSTINRNDLIAMVQKIALK 320

Query: 901  YHISLGLGTNNKHDHFHLSGIEMFKQLVNLNKSKCLKSWSNFLVFGSVLHNNKFNSRILS 1080
            Y + +G+G  N   +FH +G+E  KQL+ L++ +CL  W   L +G  LHNN  N ++L 
Sbjct: 321  YDLRIGIGIGNS-SYFHYNGLETMKQLLLLHEDECLGDWGMCLKYGKNLHNNLKNRKVLG 379

Query: 1081 KPIDIINCNNLAQGKKKFRDRRLRIIKQTITDNYVKLGNVASIIFIEDEATS 1236
             PI+++  + +++   K++ ++  +I +T   N + L N  S I++ED  TS
Sbjct: 380  MPINLLLNSGISECSIKYKSKKNTVIDETFPHNMIVLDNGKSEIYLEDNLTS 431

>KAFR0B05540 Chr2 complement(1134547..1136106) [1560 bp, 519 aa] {ON}
            Anc_8.262 YDR110W
          Length = 519

 Score =  236 bits (602), Expect = 4e-71
 Identities = 140/423 (33%), Positives = 240/423 (56%), Gaps = 2/423 (0%)
 Frame = +1

Query: 64   EKLEMLKIYNPKDLGISYTDYLDEKNSNVNIELLEKGYKDMQRYHSIKAAVLTQEYCDML 243
            E + + + Y    +G SYT Y D   S +N+ELL++G +++ ++       LT+E  D++
Sbjct: 39   ENIVIKESYIVPRMGESYTSYTD---SFMNLELLKRGEREVFKFQQSINGHLTEETYDLI 95

Query: 244  NTGTLSPENIIKYDTKLTNHSKALEKYNFTSRRYYLNEDNNIIDKRKPGRIICEPKYMYD 423
             T +L+PE +   + K T  + A  +Y F  RRYY + +  I D  +  +I+CEP Y++D
Sbjct: 96   RTDSLTPETLASTNPKWTKIT-AEPRYLFLKRRYYRDNNGLIHDHLRKDKIVCEPVYVFD 154

Query: 424  IVIAYHLKLHSSYA--VSERLKKFFSNVGRQYIDYCAKYCSKCFPDETEHMKLFTDDITF 597
            +++  HL  +  +   +   L  F+SN+ R       K+CS C P++ +  KL  +    
Sbjct: 155  MIMGCHLMNNHGFVKKIHHSLSTFYSNITRDLCLKALKFCSVCNPEQ-KIGKL--EKFKH 211

Query: 598  KNIRNNIIDRPLFPMERIHIEIFNPFDDLKIENKYQRILYIRDYSTRYIWTFTLKKLKLK 777
            +NI N      L P+ER+HIEIF PF + KIE KY  ILY RDY +RYIW   LK  K K
Sbjct: 212  RNIYNE-----LMPLERVHIEIFEPFPNEKIEKKYSHILYCRDYHSRYIWMLPLKNTKFK 266

Query: 778  HITNILTEFFLSIATNVPIFLQSSTIDNTDLFDICEKISREYHISLGLGTNNKHDHFHLS 957
            H+   +   FLS     PIF++++++D  D+FDICEKI+ EY + +GLGT +K + FH +
Sbjct: 267  HLVPTMASLFLSFIRQ-PIFIETASLDWQDMFDICEKIAFEYDLQIGLGT-SKPNTFHAA 324

Query: 958  GIEMFKQLVNLNKSKCLKSWSNFLVFGSVLHNNKFNSRILSKPIDIINCNNLAQGKKKFR 1137
            GI   K  +  ++ +CL SW+  L +GS  HN + N R    P D+++ + + +   KF+
Sbjct: 325  GIRQMKAKLEAHREECLLSWNLCLKYGSYDHNIRHNDRAGGVPGDLLS-SQIQECSLKFK 383

Query: 1138 DRRLRIIKQTITDNYVKLGNVASIIFIEDEATSIAEGLTLEGNDKYEQFSDEYRSDIDVI 1317
            ++ ++I++  ++++ +++ N   +IF+E     + E      ++ Y++F  ++  D  + 
Sbjct: 384  EKIIQILENAVSESVLRVDN--GLIFLE-----VDEPHDEPHDEPYDEF--QFEGDQSID 434

Query: 1318 EDD 1326
            E+D
Sbjct: 435  EED 437

>TDEL0F03890 Chr6 (724664..726094) [1431 bp, 476 aa] {ON} Anc_8.262
            YDR110W
          Length = 476

 Score =  230 bits (587), Expect = 2e-69
 Identities = 143/412 (34%), Positives = 229/412 (55%), Gaps = 3/412 (0%)
 Frame = +1

Query: 19   QQNSNIQDLKSLTPDEKLEMLKIYNPKDLGISYTDYLDEKNSNVNIELLEKGYKDMQRYH 198
            + +S+ Q+ K L  DE   +   +    +G SY +Y    NS +N+ELLE+G +D+ +Y 
Sbjct: 18   EAHSDTQEDKIL--DEYNGVKSQFLAPSMGESYKEYA---NSYMNMELLERGEQDLLKYQ 72

Query: 199  -SIKAAVLTQEYCDMLNTGTLSPENIIKYDTKLTNHSKALEKYNFTSRRYYLNEDNNIID 375
             SI   VL   Y +++ T +L+PE +     K    S A  KY F  RRYY  E+  + D
Sbjct: 73   ESINGQVLHPIY-ELIRTNSLTPETLASNSDKWDKDS-AESKYMFLMRRYYA-ENGIVRD 129

Query: 376  KRKPGRIICEPKYMYDIVIAYHLKL-HSSYA-VSERLKKFFSNVGRQYIDYCAKYCSKCF 549
            +RK  +I+CEP  ++D+++  HL   H +Y  +   L K +SN+ R ++    +YCS C 
Sbjct: 130  RRKGDKIVCEPLCIFDLIMCAHLMNDHMTYRPIYTCLNKIYSNITRDFVQMAVRYCSSCN 189

Query: 550  PDETEHMKLFTDDITFKNIRNNIIDRPLFPMERIHIEIFNPFDDLKIENKYQRILYIRDY 729
            PD   H +        +  R+  I + L P+ER+HIEIF  FD+  I NK+  +LY RDY
Sbjct: 190  PDG--HFR------PLEKYRHKNIFKGLLPLERVHIEIFEVFDNESISNKFTNVLYCRDY 241

Query: 730  STRYIWTFTLKKLKLKHITNILTEFFLSIATNVPIFLQSSTIDNTDLFDICEKISREYHI 909
             TR++W   LK  K KH+ + +    L + T VPIF++SST+D  DLFDICE++  +Y++
Sbjct: 242  HTRFVWLAPLKNTKFKHLVSAVGTLLLGM-TYVPIFMESSTLDKQDLFDICEQLCGKYNM 300

Query: 910  SLGLGTNNKHDHFHLSGIEMFKQLVNLNKSKCLKSWSNFLVFGSVLHNNKFNSRILSKPI 1089
             LGLG N+    FH++GI+  K+L+N  K  C+  W+  L +G    N + N+     P 
Sbjct: 301  KLGLGANSS-SQFHINGIKRMKKLLNTRKVDCISDWNMCLRYGPYHLNRRHNTLAGGIPN 359

Query: 1090 DIINCNNLAQGKKKFRDRRLRIIKQTITDNYVKLGNVASIIFIEDEATSIAE 1245
            D++  ++    +K FR ++  II +    N V +     ++++EDE + + E
Sbjct: 360  DLLYHSD-HTNRKHFRPKQEMIIDELPAQNVVHVNK--GLLYLEDENSDVFE 408

>Suva_2.270 Chr2 (470408..472306) [1899 bp, 632 aa] {ON} YDR110W
            (REAL)
          Length = 632

 Score =  224 bits (571), Expect = 1e-65
 Identities = 148/462 (32%), Positives = 241/462 (52%), Gaps = 17/462 (3%)
 Frame = +1

Query: 1    MTNDSHQQNSNIQDLKSLTPDEKLEMLK---IYNPKDLGISYTDYLDEKNSNVNIELLEK 171
            + ++S +  S+ Q  K+ +P E  E LK   +  P  +G SYT+Y+D   S +N+ELLE+
Sbjct: 68   LPSESAKSKSSPQRRKTTSPRESRESLKDRLLILPL-MGESYTEYVD---SYLNLELLER 123

Query: 172  GYKDMQRYHSIKAAVLTQEYCDMLNTGTLSPENIIKYDTKLTNHSKALEKYNFTSRRYYL 351
            G ++   +       LTQ+  +++ T +L+ E + +   K    + A  K  F  R+YY+
Sbjct: 124  GERETPIFLESLTRQLTQKIYELIKTKSLTAETLQQISDKYDGVA-AENKLLFLERQYYV 182

Query: 352  NEDNNIIDKRKPGRIICEPKYMYDIVIAYHL--KLHSSYAVSERLKKFFSNVGRQYIDYC 525
            + + N+ D+R   +I CEPK++YD+V+A HL  K      +   L   F+N     ID+ 
Sbjct: 183  DNEGNVRDRRNNDKIYCEPKHIYDMVMATHLMNKHLRGKTLHSFLFSHFANTSHAIIDWV 242

Query: 526  AKYCSKCFPDETEHMKLFTDDITFKNIRNNIIDRPLFPMERIHIEIFNPFDDLKIENKYQ 705
             ++CSKC  ++   +K   +   +K  R ++ D+ L PMERIHIE+F P+    IE KY 
Sbjct: 243  QQFCSKC--NKKGKIKPLKE---YK--RPDMYDK-LLPMERIHIEVFEPYGGKAIEGKYP 294

Query: 706  RILYIRDYSTRYIWTFTLKKLKLKHITNILTEFFLSIATNVPIFLQSSTIDNTDLFDICE 885
             +L  RDY + ++W   LK  K KH+  +++  FLS A  +PIF+ SST+D  DL+DICE
Sbjct: 295  YVLLCRDYRSSFMWLLPLKSTKFKHLIPVVSSLFLSFA-RIPIFVTSSTLDKDDLYDICE 353

Query: 886  KISREYHISLGLGTNNKHDHFHLSGIEMFKQLVNLNKSKCLKSWSNFLVFGSVLHNNKFN 1065
            +I+ +Y + +GLG  +    FH  GI   +  +N  K +CL  W   L +G    N + N
Sbjct: 354  EIASKYGLRIGLGLKSS-ARFHTGGILCIQYALNSYKEECLADWGKCLRYGPYRFNRRRN 412

Query: 1066 SRILSKPIDIINCNNLAQGKKKFRDRRLRIIKQTITDNYVKLGNVASIIFIEDEAT--SI 1239
             R   KP  ++  + +     KF  +R R+I+ T   N   +     +I++ED  T   +
Sbjct: 413  KRTKRKPTQVL-LSEVPGHNAKFETKRERVIENTYARNMFTMAGGKGLIYLEDVNTFALV 471

Query: 1240 AEGLTLEGNDKY-------EQFSDEYRSDIDVIED---DSYD 1335
             EG +   N+         + F +E +   D+ E    D YD
Sbjct: 472  NEGESSNNNENLNNTNIGNDNFEEEVQKQFDLTEQNYIDEYD 513

>YDR110W Chr4 (676102..677802) [1701 bp, 566 aa] {ON}  FOB1Nucleolar
            protein that binds the rDNA replication fork barrier
            (RFB) site; required for replication fork blocking,
            recombinational hotspot activity, condensin recruitment
            to RFB and rDNA repeat segregation; related to retroviral
            integrases
          Length = 566

 Score =  222 bits (566), Expect = 2e-65
 Identities = 144/450 (32%), Positives = 233/450 (51%), Gaps = 17/450 (3%)
 Frame = +1

Query: 37   QDLKSLTPDEKLEMLK--IYNPKDLGISYTDYLDEKNSNVNIELLEKGYKDMQRYHSIKA 210
            Q  K+ +P E  E  K  +     +G SYT+Y+D   S +N+ELLE+G ++   +     
Sbjct: 27   QRRKATSPGESRESSKDRLLILPSMGESYTEYVD---SYLNLELLERGERETPIFLESLT 83

Query: 211  AVLTQEYCDMLNTGTLSPENIIKYDTKLTNHSKALEKYNFTSRRYYLNEDNNIIDKRKPG 390
              LTQ+  +++ T +L+ + + +   K      A  K  F  R+YY++++ N+ D R   
Sbjct: 84   RQLTQKIYELIKTKSLTADTLQQISDKYDG-VVAENKLLFLQRQYYVDDEGNVRDGRNND 142

Query: 391  RIICEPKYMYDIVIAYHL--KLHSSYAVSERLKKFFSNVGRQYIDYCAKYCSKCFPDETE 564
            +I CEPK++YD+V+A HL  K      +   L   F+N+    ID+  ++CSKC  ++  
Sbjct: 143  KIYCEPKHVYDMVMATHLMNKHLRGKTLHSFLFSHFANISHAIIDWVQQFCSKC--NKKG 200

Query: 565  HMKLFTDDITFKNIRNNIIDRPLFPMERIHIEIFNPFDDLKIENKYQRILYIRDYSTRYI 744
             +K   +   +K  R ++ D+ L PMERIHIE+F PF+   IE KY  +L  RDY + ++
Sbjct: 201  KIKPLKE---YK--RPDMYDK-LLPMERIHIEVFEPFNGEAIEGKYSYVLLCRDYRSSFM 254

Query: 745  WTFTLKKLKLKHITNILTEFFLSIATNVPIFLQSSTIDNTDLFDICEKISREYHISLGLG 924
            W   LK  K KH+  +++  FL+ A  VPIF+ SST+D  DL+DICE+I+ +Y + +GLG
Sbjct: 255  WLLPLKSTKFKHLIPVVSSLFLTFA-RVPIFVTSSTLDKDDLYDICEEIASKYGLRIGLG 313

Query: 925  TNNKHDHFHLSGIEMFKQLVNLNKSKCLKSWSNFLVFGSVLHNNKFNSRILSKPIDIINC 1104
              +    FH  GI   +  +N  K +CL  W   L +G    N + N R   KP+ ++  
Sbjct: 314  LKSS-ARFHTGGILCIQYALNSYKKECLADWGKCLRYGPYRFNRRRNKRTKRKPVQVL-L 371

Query: 1105 NNLAQGKKKFRDRRLRIIKQTITDNYVKLGNVASIIFIEDEATSIA----------EGLT 1254
            + +     KF  +R R+I+ T + N  K+     +I++ED  T              G+ 
Sbjct: 372  SEVPGHNAKFETKRERVIENTYSRNMFKMAGGKGLIYLEDVNTFALANEADNSCNNNGIL 431

Query: 1255 LEGNDKYEQFSDEYRSDIDVIED---DSYD 1335
               N   + F +E +   D+ E    D YD
Sbjct: 432  HNNNIGNDNFEEEVQKQFDLTEKNYIDEYD 461

>Skud_4.371 Chr4 (647726..649468) [1743 bp, 580 aa] {ON} YDR110W
            (REAL)
          Length = 580

 Score =  221 bits (563), Expect = 7e-65
 Identities = 149/462 (32%), Positives = 238/462 (51%), Gaps = 17/462 (3%)
 Frame = +1

Query: 1    MTNDSHQQNSNIQDLKSLTPDEKLEMLK--IYNPKDLGISYTDYLDEKNSNVNIELLEKG 174
            + + S  + S+ Q  K+ +P E  E LK  +     +G SYT Y+D   S +N+ELLE+G
Sbjct: 18   LPSGSVTRKSSPQMRKTTSPRESREPLKDRLLILPSMGESYTAYVD---SYLNLELLERG 74

Query: 175  YKDMQRYHSIKAAVLTQEYCDMLNTGTLSPENIIKYDTKLTNHSKALEKYNFTSRRYYLN 354
             ++   +       LTQ+  +++ T +L+ + + +   K      A  K  F  R+YY++
Sbjct: 75   ERETPIFLESLTRQLTQQIYELIKTKSLTADTLQQISDKYDG-VVAENKLLFLQRQYYVD 133

Query: 355  EDNNIIDKRKPGRIICEPKYMYDIVIAYHL--KLHSSYAVSERLKKFFSNVGRQYIDYCA 528
             + N+ D R   +I CEPK++YD+V+A HL  K      +   L   F+N     ID+  
Sbjct: 134  NEGNVRDGRNNDKIYCEPKHIYDMVMATHLMNKHLRGKTLHSFLFSHFANTSHAIIDWVQ 193

Query: 529  KYCSKCFPDETEHMKLFTDDITFKNIRNNIIDRPLFPMERIHIEIFNPFDDLKIENKYQR 708
            ++CSKC  ++   +K   +   +K  R ++ D+ L PMERIHIE+F PF    IE KY  
Sbjct: 194  QFCSKC--NKKGKIKPLKE---YK--RPDMYDK-LLPMERIHIEVFEPFTGGAIEGKYPY 245

Query: 709  ILYIRDYSTRYIWTFTLKKLKLKHITNILTEFFLSIATNVPIFLQSSTIDNTDLFDICEK 888
            +L  RDY + ++W   LK  K KH+  +++  FLS A  VPIF+ SST+D  DL+DICE+
Sbjct: 246  VLLCRDYRSSFMWLLPLKSTKFKHLIPVISSLFLSFA-RVPIFVTSSTLDKDDLYDICEE 304

Query: 889  ISREYHISLGLGTNNKHDHFHLSGIEMFKQLVNLNKSKCLKSWSNFLVFGSVLHNNKFNS 1068
            I+ +Y + +GLG  +    FH  GI   +  +N  K +CL  W   L +G    N + N 
Sbjct: 305  IASKYGLCIGLGLKSS-ARFHTGGILCIQYALNSYKEECLADWGKCLRYGPYRFNRRRNK 363

Query: 1069 RILSKPIDIINCNNLAQGKKKFRDRRLRIIKQTITDNYVKLGNVASIIFIEDEAT-SIAE 1245
            R   KP  ++  + +     KF  +R R+I+ T + N  K+     +I++ED  T ++A 
Sbjct: 364  RTKRKPAQVL-LSEVPGHNAKFETKRERVIENTYSRNMFKMAGGKGLIYLEDVNTFALAN 422

Query: 1246 GLTLEGNDK---------YEQFSDEYRSDIDVIED---DSYD 1335
                 GN+           + F +E +   D+ E    D YD
Sbjct: 423  EAENNGNNNRNHPDNNFGNDDFEEEVQKQFDLTEQNYIDEYD 464

>Smik_4.356 Chr4 (637418..639148) [1731 bp, 576 aa] {ON} YDR110W
            (REAL)
          Length = 576

 Score =  219 bits (557), Expect = 5e-64
 Identities = 138/425 (32%), Positives = 221/425 (52%), Gaps = 14/425 (3%)
 Frame = +1

Query: 103  LGISYTDYLDEKNSNVNIELLEKGYKDMQRYHSIKAAVLTQEYCDMLNTGTLSPENIIKY 282
            +G SYT+Y+D   S +N+ELLE+G ++   +       LTQ+  +++ T +L+ + + + 
Sbjct: 53   MGESYTEYVD---SYLNLELLERGERETPIFLESLTRQLTQKIYELIKTKSLTADTLQQI 109

Query: 283  DTKLTNHSKALEKYNFTSRRYYLNEDNNIIDKRKPGRIICEPKYMYDIVIAYHL--KLHS 456
              K      A  K  F  R+YY++++ N+ D R   +I CEP ++YD+V+A HL  K   
Sbjct: 110  SDKYDG-VVAENKLLFLQRQYYVDDEGNVRDGRNNDKIYCEPNHIYDMVMATHLINKHLR 168

Query: 457  SYAVSERLKKFFSNVGRQYIDYCAKYCSKCFPDETEHMKLFTDDITFKNIRNNIIDRPLF 636
               +   L  +F+N+    ID+  ++CSKC  ++   +K   +   +K  R ++ D+ L 
Sbjct: 169  GKTLHSFLFSYFANISHAIIDWVQQFCSKC--NKKGKIKPLKE---YK--RPDMYDK-LL 220

Query: 637  PMERIHIEIFNPFDDLKIENKYQRILYIRDYSTRYIWTFTLKKLKLKHITNILTEFFLSI 816
            PMERIHIE+F PF    IE KY  +L  RDY + ++W   LK  K KH+  +++  FLS 
Sbjct: 221  PMERIHIEVFEPFSGETIEGKYSYVLLCRDYRSSFMWLLPLKSTKFKHLIPVISSLFLSF 280

Query: 817  ATNVPIFLQSSTIDNTDLFDICEKISREYHISLGLGTNNKHDHFHLSGIEMFKQLVNLNK 996
            A  VPIF+ SST+D  DL+DICE+I+ +Y + +GLG  +    FH  GI      +N  K
Sbjct: 281  A-RVPIFVTSSTLDKDDLYDICEEIASKYGLRIGLGLKSS-ARFHTGGILCIHYALNSYK 338

Query: 997  SKCLKSWSNFLVFGSVLHNNKFNSRILSKPIDIINCNNLAQGKKKFRDRRLRIIKQTITD 1176
             +CL  W   L +G    N + N R   KP  ++  + +     KF  +R R+I+ T + 
Sbjct: 339  EECLADWGKCLRYGPYRFNRRRNKRTKRKPAQVL-LSEIPGHNAKFETKRERVIENTYSR 397

Query: 1177 NYVKLGNVASIIFIEDEAT---------SIAEGLTLEGNDKYEQFSDEYRSDIDVIED-- 1323
            N  K      +I++ED  T         S   G +   +   + F +E +   D+ E   
Sbjct: 398  NMFKTAGGKGLIYLEDVNTFALANKADNSYNNGSSHNNDVDNDNFEEEVQKQFDLTEQNY 457

Query: 1324 -DSYD 1335
             D YD
Sbjct: 458  IDEYD 462

>Kwal_56.23799 s56 complement(708590..710056) [1467 bp, 488 aa] {ON}
            YDR110W (FOB1) - DNA replication fork blocking protein
            [contig 173] FULL
          Length = 488

 Score =  213 bits (542), Expect = 1e-62
 Identities = 124/409 (30%), Positives = 222/409 (54%), Gaps = 6/409 (1%)
 Frame = +1

Query: 127  LDEKNSNVNIELLEKGYKDMQRYHSIKAAVLTQEYCDMLNTGTLSPENIIKYDTKLTNHS 306
            L++  + +N ELL +G  D  +Y       LTQE  D++ +  L+ EN++    KL  HS
Sbjct: 28   LEKYGNGLNDELLARGRLDFIKYQESVKGQLTQEQFDLVRSSALTAENLMSTSDKL--HS 85

Query: 307  KALE-KYNFTSRRYYLNEDNNIIDKRKPGRIICEPKYMYDIVIAYHLKLHSSY--AVSER 477
              +E K+    RR+Y++ D  + D +    ++CEP+ ++D+++  HLK    +   +   
Sbjct: 86   GNIETKFLLLKRRFYVDADGTVRDFKCDDTVVCEPESLFDLIMCGHLKNGHIHWRRLHHY 145

Query: 478  LKKFFSNVGRQYIDYCAKYCSKCFPDETEHMKLFTDDITFKNIRNNIIDRPLFPMERIHI 657
            L++ ++N  R +   C +YCS+C P+E            ++  R+  I   L P+ER+H+
Sbjct: 146  LRRKYANTTRAFAQICVRYCSECNPEEVLR--------PYRKFRHTNIYSGLLPLERVHV 197

Query: 658  EIFNPFDDLKIENKYQRILYIRDYSTRYIWTFTLKKLKLKHITNILTEFFLSIATNVPIF 837
            EI  PF  L IE  Y  +LY+RDY +R++W   L   ++  IT     F LS+   VPIF
Sbjct: 198  EIIAPFPKL-IEGLYSHVLYLRDYYSRFVWMQPLASERVSEITKAFLTFLLSLP-RVPIF 255

Query: 838  LQSSTIDNTDLFDICEKISREYHISLGLGTNNKHDHFHLSGIEMFKQLVNLNKSKCLKSW 1017
            +++ST+   DLF++CE I+ +Y +S+GLG  ++   F  +G+E  + L+  N+  CLKSW
Sbjct: 256  VETSTLKRQDLFEVCENIASQYGLSIGLGM-SRSTTFQRNGVERLRYLLQQNEEPCLKSW 314

Query: 1018 SNFLVFGSVLHNNKFNSRILSKPIDIINCNNLAQGKKKFRDRRLRIIKQTITDNYVKL-- 1191
               L FG   HN  +N+R+L  P ++++ + ++   ++F  +R  +I++    N V+L  
Sbjct: 315  HMCLKFGVTNHNMTYNARVLGLPGNLLH-STVSDYGRQFELKREELIEKLFASNVVELRN 373

Query: 1192 -GNVASIIFIEDEATSIAEGLTLEGNDKYEQFSDEYRSDIDVIEDDSYD 1335
             G    +I++EDE+++            ++   +EY S  +  E++ +D
Sbjct: 374  EGRRRGMIYLEDESSA------------FKMPDEEYISAENETENEGFD 410

>ZYRO0C01650g Chr3 complement(117323..119083) [1761 bp, 586 aa] {ON}
            some similarities with uniprot|O13329 Saccharomyces
            cerevisiae YDR110W FOB1 Nucleolar protein required for
            DNA replication fork blocking and recombinational hotspot
            activities binds to the replication fork barrier site in
            the rDNA region related to retroviral integrases
          Length = 586

 Score =  215 bits (547), Expect = 2e-62
 Identities = 132/412 (32%), Positives = 223/412 (54%), Gaps = 9/412 (2%)
 Frame = +1

Query: 148  VNIELLEKGYKDMQRYHSIKAAVLTQEYCDMLNTGTLSPENIIKYDTKLTNHSKALEKYN 327
            +N+ LLE+G ++  ++    A  LTQ+  +++ + TLS  N+ +   K    S  +E Y 
Sbjct: 55   MNLNLLEQGAEESLQFQGTVAGQLTQQIYELIRSDTLSIANLERCH-KWKGESSEIEYYY 113

Query: 328  FTSRRYYLNEDNNII-DKRKPGRIICEPKYMYDIVIAYHLKLH--SSYAVSERLKKFFSN 498
              SR Y+++E+N ++ D+++  RI+CEP  M+ +V+  HL+ +  +SY +   L K ++N
Sbjct: 114  LRSR-YFVSEENGMVCDRKRDDRIVCEPASMFHLVMCSHLQNNHVTSYNIHRNLVKTYAN 172

Query: 499  VGRQYIDYCAKYCSKCFPDETEHMKLFTDDITFKNIRNNIIDRPLFPMERIHIEIFNPFD 678
            + R YI     YCSKC PD             F+  R+  +   L P+ER+HIE+F PFD
Sbjct: 173  ITRDYIVTAISYCSKCNPDLKAK--------PFQKKRHKNVYWELLPLERVHIEVFEPFD 224

Query: 679  DLKIENKYQRILYIRDYSTRYIWTFTLKKLKLKHITNILTEFFLSIATNVPIFLQSSTID 858
              KI+ ++  +LY RDY +RY+W   L+  K KH+   ++ F L +   +PIFL+S+TID
Sbjct: 225  GEKIQGRFSHLLYFRDYFSRYVWILPLQNDKRKHMIRAMSSFLLGL-PRIPIFLESTTID 283

Query: 859  NTDLFDICEKISREYHISLGLGTNNKHDHFHLSGIEMFKQLVNLNKSKCLKSWSNFLVFG 1038
               LFD+C +I+  Y + LGLG  N    FH +GI+  K+L+  +K +CL+ W+  L +G
Sbjct: 284  REHLFDLCGQIAEHYSLKLGLGVKNS-QRFHNNGIKDMKELLGSHKEECLQDWNLCLKYG 342

Query: 1039 SVLHNNKFNSRILSKPIDIINCNNLAQGKKKFRDRRLRIIKQTITDNYVKLGNVASIIFI 1218
                N   N     +P D++   ++    +KF  +R  +I  T +   V LG    ++F+
Sbjct: 343  PFHINQNINVSSDGRPGDLL-FTSVPDCNRKFVKKRNDVILDTPSQQVVHLGE--GVLFL 399

Query: 1219 EDE------ATSIAEGLTLEGNDKYEQFSDEYRSDIDVIEDDSYDIPLSDTE 1356
            E+         ++ E +T    D+ E+  ++  +D  V  D+  D+  S TE
Sbjct: 400  ENNKEEHKTVEAVKENITHSDPDE-ERAENDNTNDTQVRIDEG-DVSPSKTE 449

>KLTH0G13684g Chr7 complement(1171645..1173171) [1527 bp, 508 aa] {ON}
            weakly similar to uniprot|O13329 Saccharomyces cerevisiae
            YDR110W FOB1 Nucleolar protein required for DNA
            replication fork blocking and recombinational hotspot
            activities binds to the replication fork barrier site in
            the rDNA region related to retroviral integrases
          Length = 508

 Score =  206 bits (524), Expect = 7e-60
 Identities = 119/377 (31%), Positives = 211/377 (55%), Gaps = 7/377 (1%)
 Frame = +1

Query: 127  LDEKNSNVNIELLEKGYKDMQRYHSIKAAVLTQEYCDMLNTGTLSPENIIKYDTKLTNHS 306
            +++ ++ +N+ELLE+G  D  +Y       LTQ+  D++ + +L+ +N++    KL  H+
Sbjct: 28   IEKYHNGLNLELLERGRLDFIKYQESVKGQLTQDQFDLVRSCSLTEDNLMTTSDKL--HA 85

Query: 307  KALE-KYNFTSRRYYLNEDNNIIDKRKPGRIICEPKYMYDIVIAYHLK---LHSSYAVSE 474
              +E K+    RRYY++ D  + D +    ++CEP+ M+D+++  HLK   LH    +  
Sbjct: 86   GNVETKFLLLKRRYYVDADGIVRDYKCSDTVVCEPELMFDLIMCGHLKNGHLHWR-RLHS 144

Query: 475  RLKKFFSNVGRQYIDYCAKYCSKCFPDETEHMKLFTDDITFKNIRNNIIDRPLFPMERIH 654
             L+  ++N  R +   C KYCS+C P+E            +K  R+  I   L P+ER+H
Sbjct: 145  YLRHNYANTTRAFAQICVKYCSQCNPEEELR--------PYKKFRHTNIYSGLLPLERVH 196

Query: 655  IEIFNPFDDLKIENKYQRILYIRDYSTRYIWTFTLKKLKLKHITNILTEFFLSIATNVPI 834
            +EI +PF +  IE  Y  +L+ RDY +R++W   LK   ++ IT  L    L +   +PI
Sbjct: 197  VEIISPFSEA-IEGTYSHVLFFRDYYSRFVWMQPLKGDDVRDITKGLLATLL-LLPRIPI 254

Query: 835  FLQSSTIDNTDLFDICEKISREYHISLGLGTNNKHDHFHLSGIEMFKQLVNLNKSKCLKS 1014
            F+++STID  DLF+ CE ++ +Y + +GLG +     F  +G+E  + L+  N+ +CL+S
Sbjct: 255  FIETSTIDRQDLFEACEDVAGQYSLYIGLGMSQSST-FQKNGVERLRYLLQRNEEQCLRS 313

Query: 1015 WSNFLVFGSVLHNNKFNSRILSKPIDIINCNNLAQGKKKFRDRRLRIIKQTITDNYVKL- 1191
            W   L +G+  HN  +N+RIL  P ++++      G ++F  +R  +I++    N V++ 
Sbjct: 314  WYMCLKYGATNHNLNYNARILGVPGNLLHSTVCDYG-RQFELKREDLIEKLFARNVVEIK 372

Query: 1192 --GNVASIIFIEDEATS 1236
              G    II++EDE ++
Sbjct: 373  VSGRRRGIIYLEDETSA 389

>CAGL0B01771g Chr2 (163063..164673) [1611 bp, 536 aa] {ON} weakly
            similar to uniprot|O13329 Saccharomyces cerevisiae
            YDR110w FOB1 DNA replication fork blocking protein
          Length = 536

 Score =  204 bits (520), Expect = 5e-59
 Identities = 125/401 (31%), Positives = 215/401 (53%), Gaps = 16/401 (3%)
 Frame = +1

Query: 67   KLEMLKIYNPKDLGISYTDYLDEKNSNVNIELLEKGYKDMQRYHSIKAAVLTQEYCDMLN 246
            +LE+   +    L  +Y DYL  ++S ++++ L++G KDM+R+    A  LTQE   +L 
Sbjct: 53   ELELYNKFVMPALDETYEDYLVGEDSTIDVDFLKRGEKDMRRFAEGLAGKLTQETYTLLM 112

Query: 247  TGTLSPENIIKYDTKLTNHSKALEKYNFTSRRYYLNEDNNIIDKRKPGRIICEPKYMYDI 426
               L+ E ++K    +   + A  KY+   +R+Y +++ NI D +    I+ EP  ++++
Sbjct: 113  NNNLTMETVMKA-MNIWPPNAAETKYSNLIKRFYKDKEGNIRDAKVDNNIVLEPDKLFNL 171

Query: 427  VIAYHLKL-HSSYAVS-ERLKKFFSNVGRQYIDYCAKYCSKCFPDETEHMKLFTDDITFK 600
            ++  HLK  H   AV  + L++ ++N  R ++     YC++C PD   ++K        +
Sbjct: 172  ILTAHLKNGHLKTAVLFQCLREVYANCTRDFVQTALFYCNRCNPDR--YIK------PIE 223

Query: 601  NIRNNIIDRPLFPMERIHIEIFNPFDD--------------LKIENKYQRILYIRDYSTR 738
             +R+  I+  L P+ER+HIE+F PF+               +KIE KY  + Y RD+ TR
Sbjct: 224  KVRHRNINEELLPLERVHIEVFAPFEKEEGDIKQEDSQNPYIKIEGKYSHVFYCRDFRTR 283

Query: 739  YIWTFTLKKLKLKHITNILTEFFLSIATNVPIFLQSSTIDNTDLFDICEKISREYHISLG 918
            Y+W F LK +K K + + +  FF+++  + PIF++SSTID  DL +I E ++ +Y + LG
Sbjct: 284  YVWCFPLKNMKFKTLVDNIATFFMTVLYDPPIFVESSTIDRDDLKEIFELLASKYGLKLG 343

Query: 919  LGTNNKHDHFHLSGIEMFKQLVNLNKSKCLKSWSNFLVFGSVLHNNKFNSRILSKPIDII 1098
            LG  N    FH  GI+ FK  ++  KS+C   W   L  G+    N+   R L K  +I+
Sbjct: 344  LGFAN-FTKFHAQGIKRFKTHLHRAKSECADDWLMCLKQGT-YSANRVIERQLGKASNIL 401

Query: 1099 NCNNLAQGKKKFRDRRLRIIKQTITDNYVKLGNVASIIFIE 1221
                + Q ++  R ++L+ I+Q+ ++N          IFIE
Sbjct: 402  FTELMGQFERDMRKKKLKYIEQSFSENIKTYPKSGGCIFIE 442

>NCAS0B03850 Chr2 complement(685424..687190) [1767 bp, 588 aa] {ON}
            Anc_8.262 YDR110W
          Length = 588

 Score =  200 bits (508), Expect = 7e-57
 Identities = 126/453 (27%), Positives = 230/453 (50%), Gaps = 13/453 (2%)
 Frame = +1

Query: 19   QQNSNIQDLKSLTPDEKLEMLKI--YNPKDLGISYTDYLDEKNSNVNIELLEKGYKDMQR 192
            ++   + D      D+ ++ LK+  Y   ++G  Y DY+DE   ++++  +++G ++   
Sbjct: 57   EEEDGLYDYDYSKRDKPIKRLKLKGYLIPNIGEKYKDYVDE---DMDLAFVQRGEREFFE 113

Query: 193  YHSIKAAVLTQEYCDMLNTGTLSPENIIKYDTKLTNHSKALEKYNFTSRRYYLNEDNNII 372
            +       L +   +++ T +L+ E +     K+    +A  +  F +RRY L+E  N+ 
Sbjct: 114  FQKTINGQLNESTYELIKTNSLTQETLSATALKMDKF-RAASRLVFLNRRYGLDEQGNVR 172

Query: 373  DKRKPGRIICEPKYMYDIVIAYHL--------KLHSSYAVSERLKKFFSNVGRQYIDYCA 528
            DK +  R++CEP ++YD+++ +HL        K H      + L   +SN+ R +++   
Sbjct: 173  DKLRQNRMVCEPVFIYDMIMTWHLINDHGRPRKCH------QLLGPMYSNITRFFVERIC 226

Query: 529  KYCSKCFPDETEHMKLFTDDITFKNIRNNIIDRPLFPMERIHIEIFNPFDDLKIENKYQR 708
            ++CS C P +        + I FK  ++    + L P+ER+ +E+F PF   K+  KY +
Sbjct: 227  QFCSVCNPSK--------ETIPFKKYKHINWFKGLLPLERVQVEVFEPFPGEKLGGKYPQ 278

Query: 709  ILYIRDYSTRYIWTFTLKKLKLKHITNILTEFFLSIATNVPIFLQSSTIDNTDLFDICEK 888
            ILY RDY +R+IW   L+  K  H+ +++++   S+   +PIF +++TI+N D FDI EK
Sbjct: 279  ILYFRDYRSRFIWMVPLRNSKFGHLVDLISKMIFSM-IRIPIFFETTTIENQDFFDIFEK 337

Query: 889  ISREYHISLGLGTNNKHDHFHLSGIEMFKQLVNLNKSKCLKSWSNFLVFGSVLHNNKFNS 1068
            I  +Y I++GLGT         +G+   ++L+  +K +CL  W   L +G    NNK N 
Sbjct: 338  IVEKYQINIGLGTKLGGKRL-TNGLPQIRKLLGPHKEECLADWIMCLKYGPHTFNNKMND 396

Query: 1069 RILSKPIDIINCNNLAQGKKKFRDRRLRIIKQTITDNYVKLGNVASIIFIEDEATSIAEG 1248
            R    P D++   ++     K  D+  +I++   T+N VK+G     I++ED      E 
Sbjct: 397  RACGVPGDLLT-GDIPDLYTKSYDKIEQILQDLPTENIVKIGR--GCIYLEDRNPEDPEA 453

Query: 1249 LTLEGNDKYEQFSDEYRSDIDVIE---DDSYDI 1338
                   +YE  +D+     D +E   +D  DI
Sbjct: 454  -------EYEANTDDESDTEDNVEHRQEDEEDI 479

>KLLA0F19140g Chr6 (1773327..1774910) [1584 bp, 527 aa] {ON} some
            similarities with uniprot|O13329 Saccharomyces cerevisiae
            YDR110W FOB1 Nucleolar protein required for DNA
            replication fork blocking and recombinational hotspot
            activities binds to the replication fork barrier site in
            the rDNA region related to retroviral integrases
          Length = 527

 Score =  195 bits (496), Expect = 1e-55
 Identities = 130/430 (30%), Positives = 220/430 (51%), Gaps = 13/430 (3%)
 Frame = +1

Query: 100  DLGISYTDYLDEKNSNVNIELLEKGYKDMQRYHSIKAAVLTQEYCDMLNTGTLSPENIIK 279
            DLG S+   LD+       ++L +G   +++  +     LTQ   D+L++  L+ EN+++
Sbjct: 65   DLG-SFCGELDQ-------DMLIEGRLQLEKEINTVKGQLTQPIYDLLHSDALTKENLLR 116

Query: 280  YDTKLTNHSKALEKYNFTSRRYYLNEDNNIIDKRKPGRIICEPKYMYDIVIAYH-LKLH- 453
               K+TN S    K+    RRYY+ E N + D ++   ++ EP  ++D++++ H L  H 
Sbjct: 117  ASDKVTN-STVENKFVLLKRRYYVQE-NLLHDVKRKDLVVYEPNELFDLIMSVHVLNSHV 174

Query: 454  SSYAVSERLKKFFSNVGRQYIDYCAKYCSKCFPDETEHMKLFTDDITFKNIRNNIIDRPL 633
            SS  +   L  F++NV + +      +CSKC     +        I++K  ++  I   L
Sbjct: 175  SSKGIYNELSTFYANVTQSFCKLVTSFCSKCNESGNK--------ISYKKFKHENIHANL 226

Query: 634  FPMERIHIEIFNPFD----------DLKIENKYQRILYIRDYSTRYIWTFTLKKLKLKHI 783
             P+ R H+EIF PFD          +LKIE KY  +LY RDY +RY+W   LK + L  +
Sbjct: 227  IPLGRCHVEIFAPFDSAYQGNDNTDELKIEGKYPFVLYCRDYYSRYVWLEPLKSVTLSDL 286

Query: 784  TNILTEFFLSIATNVPIFLQSSTIDNTDLFDICEKISREYHISLGLGTNNKHDHFHLSGI 963
              ++T+   S+   +PIF+ + T+D  D+FD+CE I+R Y I +GLG N+    F  +GI
Sbjct: 287  LPVMTKLLFSM-IRMPIFIDTCTLDRQDMFDVCENIARIYKIKIGLGMNSS-TSFQKTGI 344

Query: 964  EMFKQLVNLNKSKCLKSWSNFLVFGSVLHNNKFNSRILSKPIDIINCNNLAQGKKKFRDR 1143
            +  K L   +K +CL  W+  L       N  ++ R+   P D++ C+      KKFR  
Sbjct: 345  KRMKSLFLQHKEECLHDWNMCLKLVVSRLNQNYSDRVRGVPSDLL-CSTQQDLHKKFRTL 403

Query: 1144 RLRIIKQTITDNYVKLGNVASIIFIEDEATSIAEGLTLEGNDKYEQFSDEYRSDI-DVIE 1320
            +  +I + +  + V+      +I++EDE    +  L L G+D  E+   E+ S+I D + 
Sbjct: 404  QRNVISRLLGHHVVQFEEAGGMIYLEDEN---SPNLLLSGDDNSEE--SEHDSEIFDELA 458

Query: 1321 DDSYDIPLSD 1350
                  P+S+
Sbjct: 459  SSRDGTPISE 468

>Kpol_543.38 s543 (84712..86040) [1329 bp, 442 aa] {ON} (84712..86040)
            [1329 nt, 443 aa]
          Length = 442

 Score =  187 bits (474), Expect = 3e-53
 Identities = 117/412 (28%), Positives = 212/412 (51%), Gaps = 8/412 (1%)
 Frame = +1

Query: 85   IYNPKDLGISYTDYLDEKNSNVNIELLEKGYKDMQRYHSIKAAVLTQEYCDMLNTGTLSP 264
            +++   +G +  +Y+D   S+ ++  LE G    + Y       L+Q   +++    L  
Sbjct: 42   VFDYPKVGATLYEYID---SSYSVPFLEFGRGAAKEYLDSIIGTLSQTVYELIRDDLLDV 98

Query: 265  ENIIKYD--TKLTNHSKALEKYNFTSRRYYLNEDNNIIDKRKPGRIICEPKYMYDIVIAY 438
            + + +    +++  ++K L    +  RRY L +   +ID  +  +I+ EP   YD +I+ 
Sbjct: 99   DTLSEKTRWSRINANAKCL----YLKRRYKLTKKGTVIDLTRENKIVYEPDLRYDYIIST 154

Query: 439  H-LKLHSSY-AVSERLKKFFSNVGRQYIDYCAKYCSKCFPDET-EHMKLFTDDITFKNIR 609
            H L  H  Y  + +RLK  +SN+ R YI     +CS C PD+   +++        K + 
Sbjct: 155  HILNRHLGYQGIHKRLKAIYSNLSRDYIKMVLDFCSHCNPDKVIPNLE--------KTVH 206

Query: 610  NNIIDRPLFPMERIHIEIFNPFDDLKIENKYQRILYIRDYSTRYIWTFTLKKLKLKHITN 789
             NI ++ L P+ER+ ++IF PF++ KI+N+Y  I+YIRDY +R++W + LK  K K + +
Sbjct: 207  MNIYEKYL-PLERVQLDIFEPFENEKIQNRYSHIIYIRDYRSRFVWIYPLKNTKFKTLAS 265

Query: 790  ILTEFFLSIATNVPIFLQSSTIDNTDLFDICEKISREYHISLGLGTNNKHDHFHLSGIEM 969
             +    L +   +PI++ ++TI+  D+  IC++I+ +Y ISLG+GT  +   F+  G+  
Sbjct: 266  EIGMLLLDL-PRIPIYIDTTTIERRDMLAICKRIAEKYEISLGIGT-IEPSSFYSIGLSR 323

Query: 970  FKQLVNLNKSKCLKSWSNFLVFGSVLHNNKFNSRILSKPIDIINCNNLAQGKKKFRDRRL 1149
             K L+N NK KCLK W+  L  GS  +N K  +     P ++   + +      F  +R 
Sbjct: 324  LKCLLNENKDKCLKDWNMCLKLGSYYYNKKSITTARGVPSELF-LDEMECSATTFESKRT 382

Query: 1150 RIIKQTITDNYVKLGNVASIIFIEDE--ATSIAEGLTLE-GNDKYEQFSDEY 1296
             II      N  K      +++ +DE   TS  +   +E G+D + ++ D +
Sbjct: 383  EIINSLPIQNSYKTSTNKGLVYAQDEILTTSKNKSSNMENGDDTFLEYDDTF 434

>Ecym_4308 Chr4 complement(654030..655619) [1590 bp, 529 aa] {ON}
            similar to Ashbya gossypii AGR086C
          Length = 529

 Score =  185 bits (470), Expect = 6e-52
 Identities = 108/360 (30%), Positives = 201/360 (55%), Gaps = 5/360 (1%)
 Frame = +1

Query: 163  LEKGYKDMQRYHSIKAAVLTQEYCDMLNTGTLSPENIIKYDTKLTNHSKALEKYNFTSRR 342
            L+ G  ++ +  +     LTQ+  +++++ TLS + +++   K+T  +    K+    RR
Sbjct: 56   LDTGRNELIKLINTVKGQLTQDIYELISSNTLSTQTLLECCDKVTAGTVE-NKFVLLKRR 114

Query: 343  YYLNEDNNIIDKRKPGRIICEPKYMYDIVIAYHL-KLHSSYA-VSERLKKFFSNVGRQYI 516
            Y + +  N++D ++    + EP  ++D+++A HL   H  +  + + LK  ++NV R + 
Sbjct: 115  YSILQ-GNVVDHKREDLPVIEPDLVFDVIMAAHLINGHLPWRKIHQHLKNLYANVTRDFT 173

Query: 517  DYCAKYCSKCFPDETEHMKLFTDDITFKNIRNNIIDRPLFPMERIHIEIFNPFDD---LK 687
            +    YCS C  D   +MK F   + +K+   N+ D+ + P+ER H+EIF PFDD    K
Sbjct: 174  NLVTLYCSHCNTDR--NMKRF---LRYKHY--NVYDK-VMPLERCHVEIFAPFDDDGNEK 225

Query: 688  IENKYQRILYIRDYSTRYIWTFTLKKLKLKHITNILTEFFLSIATNVPIFLQSSTIDNTD 867
            IE+KY  +LY RDY +R++W   L+ +  + +   LT+   S+   +PIFL+++T+D  D
Sbjct: 226  IEDKYSHVLYCRDYHSRFVWMLPLEGITFRDLVPALTQLLCSMI-RLPIFLETATLDRQD 284

Query: 868  LFDICEKISREYHISLGLGTNNKHDHFHLSGIEMFKQLVNLNKSKCLKSWSNFLVFGSVL 1047
            +FD+CE I+R+Y + +GLG N+  D F  +G+   K L   +K +C+K W+  L      
Sbjct: 285  MFDVCEYIARKYKLKIGLGLNSGTD-FQRNGVTRIKNLFAEHKEQCIKEWNMCLRLVLTR 343

Query: 1048 HNNKFNSRILSKPIDIINCNNLAQGKKKFRDRRLRIIKQTITDNYVKLGNVASIIFIEDE 1227
             N  ++ R+   P D++ CN ++    KF+ ++ +II +    + V+      +I++ED+
Sbjct: 344  VNQNYSDRVRGIPSDLL-CNEISNIAHKFKLKQRKIIDELYAHHVVQFREAGGMIYLEDD 402

>NDAI0J01380 Chr10 complement(317185..319059) [1875 bp, 624 aa] {ON}
            Anc_8.262 YDR110W
          Length = 624

 Score =  182 bits (461), Expect = 5e-50
 Identities = 115/411 (27%), Positives = 206/411 (50%), Gaps = 2/411 (0%)
 Frame = +1

Query: 1    MTNDSHQQNSNIQDLKSLTPDEKLEMLKIYNPKDLGISYTDYLDEKNSNVNIELLEKGYK 180
            MT    + N +  D      D K      Y   ++G SY DY+D +   V+++LL++G  
Sbjct: 62   MTRPRSEVNGDDDDGNEDERDPKRRHYGSYLIPNVGESYMDYVDPE---VDVDLLKRGEV 118

Query: 181  DMQRYHSIKAAVLTQEYCDMLNTGTLSPENIIKYDTKLTNHSKALEKYNFTSRRYYLNED 360
                +       L +   +++ T +L+ E +         H  A  +     RRY  + +
Sbjct: 119  TFLNFQRSIHGQLDEVVYELIRTKSLTEETLAANFP----HFHAPTRCALFKRRYVADNE 174

Query: 361  NNIIDKRKPGRIICEPKYMYDIVIAYHLKL-HSSYAVSE-RLKKFFSNVGRQYIDYCAKY 534
              + D+ +  RI+C+P  +Y++++  HL   H+ Y      L   ++N+ R ++    ++
Sbjct: 175  GRVRDQLRGNRIVCDPVLLYEMMMTCHLMNDHAQYRRCHVALSSIYANITRDFLYKAVQF 234

Query: 535  CSKCFPDETEHMKLFTDDITFKNIRNNIIDRPLFPMERIHIEIFNPFDDLKIENKYQRIL 714
            CS C P      KL    + FK++      + + P+ER+HIEIF PF+  KIE KY  ++
Sbjct: 235  CSVCNPS-----KLVGPLLKFKHVNYY---KGMLPLERVHIEIFEPFNGKKIEGKYSHVI 286

Query: 715  YIRDYSTRYIWTFTLKKLKLKHITNILTEFFLSIATNVPIFLQSSTIDNTDLFDICEKIS 894
            Y RDY +RYI    LK  K K++ + + +   ++   +PIF+++ +++  D FDI E I 
Sbjct: 287  YCRDYRSRYIMLEPLKNTKFKNLVSAIAKLLFNL-PRIPIFIETVSLNTQDAFDIFEAIV 345

Query: 895  REYHISLGLGTNNKHDHFHLSGIEMFKQLVNLNKSKCLKSWSNFLVFGSVLHNNKFNSRI 1074
             +Y I++GLG       FH  G++  K L+  ++ +CL  W+  L +G   +N K N R 
Sbjct: 346  EKYQINVGLGMKTA-KRFHTRGVKQMKILLEGHRKECLNDWTMCLKYGPHNYNTKHNDRA 404

Query: 1075 LSKPIDIINCNNLAQGKKKFRDRRLRIIKQTITDNYVKLGNVASIIFIEDE 1227
               P+D++ C N+     K  ++  +II+    DN V++GN    I++E++
Sbjct: 405  CGVPVDLLTC-NVKDVTHKSIEKYEQIIRTLPKDNIVQIGN--GSIYLEEK 452

>AGR086C Chr7 complement(888758..890362) [1605 bp, 534 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YDR110W
            (FOB1)
          Length = 534

 Score =  179 bits (455), Expect = 9e-50
 Identities = 108/375 (28%), Positives = 197/375 (52%), Gaps = 5/375 (1%)
 Frame = +1

Query: 127  LDEKNSNVNIELLEKGYKDMQRYHSIKAAVLTQEYCDMLNTGTLSPENIIKYDTKLTNHS 306
            L + + ++  E +++G  ++++        LTQE  D++ + TLS + +++   K+T ++
Sbjct: 38   LYQLDGSLEHEWIDRGRGELRKIMKTVKGQLTQEIYDLIASDTLSTQKLLECCDKVTPNT 97

Query: 307  KALEKYNFTSRRYYLNEDNNIIDKRKPGRIICEPKYMYDIVIAYHL-KLHSSYA-VSERL 480
                KY    RRY + +   +ID+++    + EP  ++D++++ HL   H  +  V + +
Sbjct: 98   VE-NKYVLLKRRY-VAKGGIVIDRKRKDAPVIEPDSLFDMIMSAHLINDHMPWRKVYQHM 155

Query: 481  KKFFSNVGRQYIDYCAKYCSKCFPDETEHMKLFTDDITFKNIRNNIIDRPLFPMERIHIE 660
            K  ++NV R+  +    YCS C  D +           F   ++  +   L P+ER H+E
Sbjct: 156  KGLYANVTRELTNMVTGYCSHCNMDRSVRR--------FSRYKHYNVHEKLMPLERCHVE 207

Query: 661  IFNPFDDL---KIENKYQRILYIRDYSTRYIWTFTLKKLKLKHITNILTEFFLSIATNVP 831
            +F PFDD    KI+ KY   LY RDY +R+IW   L+ +  +++   L +   ++   VP
Sbjct: 208  VFAPFDDEGVEKIQGKYSHFLYCRDYHSRFIWLLPLEGIAFRYLLPALAQLLCTMI-RVP 266

Query: 832  IFLQSSTIDNTDLFDICEKISREYHISLGLGTNNKHDHFHLSGIEMFKQLVNLNKSKCLK 1011
            IFL+++T+D  D+FDICE I+R Y   +GLG N+  + F  +GI+  KQL++  K +C  
Sbjct: 267  IFLETATLDRQDMFDICEVIARRYKFKIGLGLNSGTE-FQKNGIKRVKQLLSEYKEECQD 325

Query: 1012 SWSNFLVFGSVLHNNKFNSRILSKPIDIINCNNLAQGKKKFRDRRLRIIKQTITDNYVKL 1191
             W+  L       N  +  R+   P D++ CN +     KF+ ++ +II Q    + V  
Sbjct: 326  DWNMCLRLVLSRVNQTYADRVRGIPSDLL-CNEIPNISMKFKQKQKKIIDQLYAHHVVHF 384

Query: 1192 GNVASIIFIEDEATS 1236
                 +I++EDE ++
Sbjct: 385  KEAGGMIYLEDEESA 399

>TPHA0J00740 Chr10 (175036..176262) [1227 bp, 408 aa] {ON} Anc_8.262
            YDR110W
          Length = 408

 Score =  176 bits (446), Expect = 1e-49
 Identities = 119/401 (29%), Positives = 204/401 (50%), Gaps = 15/401 (3%)
 Frame = +1

Query: 124  YLDEKNSNVNIELLEKGYKDMQRYHSIKAAVLTQEYCDMLNTGTLSPENIIKYDTKLTNH 303
            Y  E  S+++IE +  G  D  +  S+ ++ LTQ+   ++     + E    ++  + +H
Sbjct: 31   YKIELGSDIDIERINHGRNDHLQLESVFSSFLTQKMYTLIREKNFNYET---FEEAMKSH 87

Query: 304  SKALEKYNFTSR--------RYYLNEDNNIIDKRKPGRIICEPKYMYDIVIAYH-LKLH- 453
                 KY  T+         RY LNE   I DKR   ++I  P  +YD+++  H L  H 
Sbjct: 88   YTDSGKYMGTANKKFMLMEDRYQLNELGQITDKRNDYKLIVPPNQIYDLIMHCHFLNDHL 147

Query: 454  SSYAVSERLKKFFSNVGRQYIDYCAKYCSKCFPDET----EHMKLFTDDITFKNIRNNII 621
             S  +   L++ +SN+ R  +    + CS C P  T    E+ + F+ D   KN      
Sbjct: 148  GSTKIHHSLREKYSNISRALVRLSLQNCSHCNPKSTYKHIEYTRHFSCD---KN------ 198

Query: 622  DRPLFPMERIHIEIFNPFDDLK-IENKYQRILYIRDYSTRYIWTFTLKKLKLKHITNILT 798
                F  E+IH+EIF PF+D+    NK+  ++YIRDY TRY+W + L+K+ +K + N L 
Sbjct: 199  ----FAFEKIHVEIFQPFEDVDTFANKFSHVIYIRDYFTRYVWLYPLEKISVKELANTLA 254

Query: 799  EFFLSIATNVPIFLQSSTIDNTDLFDICEKISREYHISLGLGTNNKHDHFHLSGIEMFKQ 978
               L ++  +PI+++S T+D ++L  I ++IS+  ++ LG+GT  K D F  SGI   K+
Sbjct: 255  THLL-LSLRIPIYIESLTLDESNLLKILKRISKTTNLILGVGT-TKLDEFQASGINHMKE 312

Query: 979  LVNLNKSKCLKSWSNFLVFGSVLHNNKFNSRILSKPIDIINCNNLAQGKKKFRDRRLRII 1158
            L   N+  C  +W+ +++     +N  +N  I   P++++    LA   K ++ +R R I
Sbjct: 313  LFVQNREYCGNNWNKYVIRCQNHYNTTYNKWIYGIPLNLMAQETLAD-NKTYKKKRQRTI 371

Query: 1159 KQTITDNYVKLGNVASIIFIEDEATSIAEGLTLEGNDKYEQ 1281
              T++ N + L N  S ++ E    SI     L   ++YE+
Sbjct: 372  LLTLSKNTILLKNGKSALYKESTENSI----DLHIENRYEE 408

>KNAG0H03240 Chr8 complement(603920..605479) [1560 bp, 519 aa] {ON}
            Anc_8.262 YDR110W
          Length = 519

 Score =  149 bits (377), Expect = 6e-39
 Identities = 109/365 (29%), Positives = 182/365 (49%), Gaps = 6/365 (1%)
 Frame = +1

Query: 91   NPK---DLGISYTDYLDEKNSNVNIELLEKGYKDMQRYHSIKAAVLTQEYCDMLNTGTLS 261
            NPK    +G  +++Y DEK   ++IE  ++G +D+  Y   +   ++QE   +     ++
Sbjct: 32   NPKLVPVIGDKWSNYADEK---LDIEFCKRGERDITAYAPTQPGRMSQELYALFKNDDVT 88

Query: 262  PENIIK-YDTKLTNHSKALEKYNFTSRRYYLNEDNNIIDKRKPGRIICEPKYMYDIVIAY 438
             ENI + Y T  +       K  + +RRYY + +  I D     RI+ +P + +DI+++ 
Sbjct: 89   KENIARLYPTDRSGDES--RKMMYITRRYYKDANGMIRDATMNNRIVYDPIHTFDIIMSC 146

Query: 439  HL--KLHSSYAVSERLKKFFSNVGRQYIDYCAKYCSKCFPDETEHMKLFTDDITFKNIRN 612
            HL  K   S  V   L++F++N G   I    +YCS C P      K+      F+    
Sbjct: 147  HLMNKHLGSERVYRCLREFYANGGPLLIKRTLEYCSVCNPSLKLTPKVQPKPYLFEKA-- 204

Query: 613  NIIDRPLFPMERIHIEIFNPFDDLKIENKYQRILYIRDYSTRYIWTFTLKKLKLKHITNI 792
                    P+ERI IEI  PF + K+E KY  ++ ++D+  R+ W   LK  K K+I  +
Sbjct: 205  -------LPLERITIEIIEPFPNEKVEGKYSNMVVMKDFIGRFEWLEPLKNTKFKNIVPV 257

Query: 793  LTEFFLSIATNVPIFLQSSTIDNTDLFDICEKISREYHISLGLGTNNKHDHFHLSGIEMF 972
            + +  LS    VPI+++S+T+D +DLFDI E I  +Y I +GLG   +      +     
Sbjct: 258  VAKMILSF-PRVPIWVESNTLDWSDLFDIFEMIVTKYGIKIGLGCTTRSSAAQATA--RI 314

Query: 973  KQLVNLNKSKCLKSWSNFLVFGSVLHNNKFNSRILSKPIDIINCNNLAQGKKKFRDRRLR 1152
             + +N +  +CL  ++N L +G   +N          P DII+ ++  Q K KFR +R  
Sbjct: 315  NRDLNDHHDECLFDFNNCLKYGPTKYNQIKYLGFHKSPCDIIS-HSETQLKAKFRAKRAF 373

Query: 1153 IIKQT 1167
            I+K +
Sbjct: 374  ILKHS 378

>TPHA0A01810 Chr1 complement(365982..367355) [1374 bp, 457 aa] {ON}
            Anc_8.262 YDR110W
          Length = 457

 Score =  140 bits (353), Expect = 5e-36
 Identities = 102/368 (27%), Positives = 188/368 (51%), Gaps = 11/368 (2%)
 Frame = +1

Query: 157  ELLEKGYKDMQRYHSIKAAVLTQEYCDMLNTGTLSPENI---IKYDTKLTNHSKALEKYN 327
            +LL+KG   +    + K   L++E  D++    L+ +N+   +  D K      A+ +  
Sbjct: 51   QLLQKGEIAVA---NSKTNYLSKELYDLVKNDDLTRKNVAVALNLDEK-----NAITRLI 102

Query: 328  FTSRRYYLNEDNNIIDKRKPGRIICEPKYMYDIVIAYHLKLH--SSYAVSERLKKFFSNV 501
                RYY +    + D+ K  +I+ +P + + +V+  HL     +  A+   L K F+N+
Sbjct: 103  PLKHRYYRDSKLMVHDRSKQNKIVIDPAHRFRMVMTTHLLNDHLTRGAIYRTLSKCFANL 162

Query: 502  GRQYIDYCAKYCSKCFPDETEHMKLFTDDITFKNIRNN----IIDRP-LFPMERIHIEIF 666
               +I    +YCS C  ++             KNIR      + + P +   ER+ +++ 
Sbjct: 163  SDPFIKTSIEYCSICNSNK-------------KNIRRKKEPQLSNSPDILFYERLILDVV 209

Query: 667  NPFDDLKIENKYQRILYIRDYSTRYIWTFTLKKLKLKHITNILTEFFLSIATNVPIFLQS 846
             PF   KI+ +Y  IL I D+ T+++W+F LK LKL+ I + +TEF +++    P+F+ S
Sbjct: 210  APFGAKKIQKRYTHILTITDFHTKFMWSFPLKNLKLRTIISKVTEFIVALPVK-PVFISS 268

Query: 847  STIDNTDLFDICEKISREYHISLGLGTNNKHDHFHLSGIEMFKQLVNLNKSKCLKSWSNF 1026
             T+   D+F++C  ++REY+IS+GLGT N    +  S      +++N +K++CLKSW   
Sbjct: 269  FTLSLNDIFELCCYLAREYNISIGLGTRNMQKAY--SKNPYVTRILNSHKTECLKSWFMC 326

Query: 1027 LVF-GSVLHNNKFNSRILSKPIDIINCNNLAQGKKKFRDRRLRIIKQTITDNYVKLGNVA 1203
            L +      N+KF+ R  +K   +   + +    KK+ +R   II +  ++N++ +   +
Sbjct: 327  LKWLADRQSNSKFDIRPPNKNYGLF--SGMTDFLKKYEERSKMIIGRLPSENFINIDEGS 384

Query: 1204 SIIFIEDE 1227
              I+ EDE
Sbjct: 385  HFIYSEDE 392

>TBLA0F03070 Chr6 complement(745795..747132) [1338 bp, 445 aa] {ON}
            Anc_8.262 YDR110W
          Length = 445

 Score =  140 bits (352), Expect = 6e-36
 Identities = 113/407 (27%), Positives = 189/407 (46%), Gaps = 8/407 (1%)
 Frame = +1

Query: 139  NSNVNIELLEKGYKDMQRY-HSIKAAVLTQEYCDMLNTGTLSPENIIKYDTKLTNHSKAL 315
            +S ++ ++L++G K+   + +++K  + +  Y  M +   L  +  I    K+    K  
Sbjct: 42   DSYIDSDMLKRGEKETMEFRNTLKKHITSDLYYAMRDESLLEDDAPIPASLKIKTSKKM- 100

Query: 316  EKYNFTSRRYYLNEDNNIIDKRKPGRIICEPKYMYDIVIAYHLKLHS--SYAVSERLKKF 489
                +   RY  N D ++I+  K  +++CEPKY+Y + +  H   +   S  +   L   
Sbjct: 101  ----YLQIRYSKNSDGDLIET-KTNKLLCEPKYIYKLTMKAHFMNNHMRSNKLYRNLSMK 155

Query: 490  FSNVGRQYIDYCAKYCSKCFPDETEHMKLFTDDITFKNIRNNIIDRPLFPMERIHIEIFN 669
            + N+    +    +YCS C  + T  ++   D  +    RN  ID    P+ER+ I+I  
Sbjct: 156  YCNIPNLLVVLVLQYCSHC--NTTGKIR---DIRSNYGQRNQYID--YLPLERLQIDITK 208

Query: 670  PFDD--LKIENKYQRILYIRDYSTRYIWTFTLKKLKLKHITNILTEFFLSIATNVPIFLQ 843
            PF+D  +KI NKY  IL IRDY +RY W F LK   +K+I+  L +F +++    PIFL 
Sbjct: 209  PFNDSDIKIANKYSHILLIRDYHSRYSWIFPLKSPNIKNISTELGKFLVTL-PRTPIFLH 267

Query: 844  SSTIDNTDLFDICEKISREYHISLGLGTNN-KHDHFHLSGIEMFKQLVNL--NKSKCLKS 1014
            S  I  + L  I  KI  EY I + +G    K   F   GI     L+NL  NK KC   
Sbjct: 268  SIGIPESQLIKILTKILLEYKIKIRIGIGGIKGRMFLRKGISRLVYLLNLKENKEKCKSD 327

Query: 1015 WSNFLVFGSVLHNNKFNSRILSKPIDIINCNNLAQGKKKFRDRRLRIIKQTITDNYVKLG 1194
            W   +   +   N +F+    S    +I     A+  K F ++R  ++   + +N +K+G
Sbjct: 328  WYQCIRNTTFKENRRFDRNTGSFANFLIG-KQKAELNKVFENKRDALLSDLLEENVLKIG 386

Query: 1195 NVASIIFIEDEATSIAEGLTLEGNDKYEQFSDEYRSDIDVIEDDSYD 1335
               SII+ ++  +    G  L+  D     ++    + D   DD  D
Sbjct: 387  ECGSIIYFDNNNS----GKELDEKDVNGGVNENSEEESDYENDDDDD 429

>NDAI0D03010 Chr4 complement(712188..714524) [2337 bp, 778 aa] {ON} 
          Length = 778

 Score = 45.8 bits (107), Expect = 2e-04
 Identities = 67/309 (21%), Positives = 118/309 (38%), Gaps = 31/309 (10%)
 Frame = +1

Query: 100 DLGISYTDYLDEKNSNVNI----ELLEKGYKDMQRYHSIKAAVLTQEYCDMLNTGTLSPE 267
           +L +S    LD K  N  +    E L   +    +Y +     + + Y ++L  G L+P 
Sbjct: 39  ELYLSKYGELDNKIMNTYLDASKEALLNDFVANDKYTTHPFLFMNEMYAELLIRGKLTPR 98

Query: 268 NII-----KYDTKLTNH--SKALEKYNFTSRRYYLN---EDNNII---DKRKPGRIICEP 408
            I+     +Y   L N   +K L++     +R  L    ED  +       K   I C P
Sbjct: 99  IIVEEIYKRYGIPLKNELQTKVLQRLRGRCKRMRLTYKFEDGKLFFTSPHNKKKLIWCPP 158

Query: 409 KYMYDIVIAYH---------LKLH-SSYAVSERLKKFFSNVGRQYIDYCAKYCSKCFPDE 558
             ++ ++   H         L+ H     +   L   + N+ +  I      C  C P  
Sbjct: 159 TLLHYVIACVHENWDCDDYTLRKHRDENEIQSILAAKYHNISKFLIHDVVAACPDCKPLS 218

Query: 559 TEHMKLFTDDITFKNIRNNIIDRPLFPMERIHIEIFNPFDDLKIENK----YQRILYIRD 726
           ++          F   R N++    +  +R+ ++I +  D   +  K       ILYI D
Sbjct: 219 SKK---------FNITRVNVLPLTRYSFQRLQVKILSAADYSCVCPKDNCTKNAILYIGD 269

Query: 727 YSTRYIWTFTLKKLKLKHITNILTEFFLSIATNVPIFLQSSTIDNTDLFDICEKISREYH 906
           Y +  +W F L   +      ++ E FL++    P  +Q   +DN       +KI R+ +
Sbjct: 270 YHSGAVWLFALDGEEDATDILLVLEMFLNVVLITPKHIQ---VDN-------QKIFRDEN 319

Query: 907 ISLGLGTNN 933
           I+  L  NN
Sbjct: 320 IAKFLADNN 328

>KAFR0B06620 Chr2 complement(1376088..1379645) [3558 bp, 1185 aa] {ON}
            
          Length = 1185

 Score = 38.9 bits (89), Expect = 0.035
 Identities = 32/158 (20%), Positives = 63/158 (39%), Gaps = 8/158 (5%)
 Frame = +1

Query: 637  PMERIHIEIFNPFDDLKIENKYQRILYIRDYSTRYIWTFTLKKLKLKHITNILTEFFLSI 816
            P + IH ++F P  D+        I ++ D +TR+ W + L+    +HI  +  +    I
Sbjct: 666  PFQYIHTDLFGPMSDVSATTPTYFISFV-DENTRFRWVYPLRSKSAEHILLVFRKLVNFI 724

Query: 817  ATNVPIFLQSSTIDN--------TDLFDICEKISREYHISLGLGTNNKHDHFHLSGIEMF 972
             T     +++  +D          D F I + I   Y+ +    +N   +  +L  +   
Sbjct: 725  RTQFSTKVKAFQMDRGSEYRNELLDDFFIDKGIKSIYNTAADSASNGVAERTNLLFLNDC 784

Query: 973  KQLVNLNKSKCLKSWSNFLVFGSVLHNNKFNSRILSKP 1086
            + L+          W + + F +++ N   NS I   P
Sbjct: 785  RTLLKATNLP-NNMWYHAVEFATLIRNTMINSSINDSP 821

>Kpol_1035.3 s1035 complement(5707..9099) [3393 bp, 1130 aa] {ON}
            complement(5707..9099) [3393 nt, 1131 aa]
          Length = 1130

 Score = 38.5 bits (88), Expect = 0.046
 Identities = 51/259 (19%), Positives = 106/259 (40%), Gaps = 7/259 (2%)
 Frame = +1

Query: 304  SKALEKYNFTSRRYYLNEDNNIIDKRKPGRIICEPKYMYDIVIAYHLKLHSSYAVSERL- 480
            SK ++++ +TS   Y+N D+ +       R++ +  YM D+    H   H ++ V +   
Sbjct: 728  SKIIDRFYYTSGNLYINMDSILF------RVVIDKDYM-DVATKLHALYHCTHRVLQLAM 780

Query: 481  --KKFFSNVGRQYIDYCAKYCSKCFPDETEHMKLFTD-DITFKNIRNNIIDRPLFPMERI 651
              +K ++      +    + CS+C     E  + F+D  I    I       P+F   R 
Sbjct: 781  ADEKLWNPNSNLLLLDVVRLCSRC-----ETYEKFSDLPIELPEIHRT----PVF--SRW 829

Query: 652  HIEIFNPFDDLKIENKYQRILYIRDYSTRYIWTFTLKKLKLKHITNILTEFFLSIA-TNV 828
            H++   P   L   N Y+  L   DY++  I    L +     + +++ + + +    ++
Sbjct: 830  HLDFAGP---LPAHNGYKYFLLAADYTSNLILVRPLAEQSFTSVYDLIFDIYATFGRPHM 886

Query: 829  PIFLQSSTIDNTDLFDICEKISREYHISLGLGT--NNKHDHFHLSGIEMFKQLVNLNKSK 1002
             +    S   N  +  I   +  +Y+ S       N+K +      ++M K+++     K
Sbjct: 887  LVTDNGSPFANNIVPTIAAHLKIKYYQSSAYHPRGNSKAER----SVKMIKEVIKKMDPK 942

Query: 1003 CLKSWSNFLVFGSVLHNNK 1059
              K  SN  +   +++N K
Sbjct: 943  YEKWTSNLSIAAHIVNNTK 961

>CAGL0L09669g Chr12 (1036568..1041556) [4989 bp, 1662 aa] {ON} similar
            to uniprot|P34241 Saccharomyces cerevisiae YKL014c
          Length = 1662

 Score = 37.4 bits (85), Expect = 0.11
 Identities = 69/322 (21%), Positives = 129/322 (40%), Gaps = 49/322 (15%)
 Frame = +1

Query: 517  DYCAKYCSKCFPDETEH-MKLFTDDITFKNIRNNIIDRPLFPMERIHIE----------- 660
            DYC K  +     E E+ +K+  +D    N + N++    F +E  H +           
Sbjct: 1014 DYCIKNLNNLTDSEMENFLKIIVEDTEILN-QENLLRVSEFALEEYHHKFRAVNVLLVRN 1072

Query: 661  IFNPFDDLKIENKYQRILYIRDY-STRYIWTFTLKKLKLKHITNILTEFFL-------SI 816
            I    D LK +   + +LYI  Y S R    F  K+L +K   +  ++F +        +
Sbjct: 1073 IVAIDDALKKKWLTKLVLYITKYLSERENMNFNFKEL-IKATDDYFSDFNIWENVAPSLL 1131

Query: 817  ATNVPIFLQSSTIDNTDLFDICEKISREYHISLGLGTNNKHDHFHLSGIEMFKQLVNLNK 996
             T + + LQS  I NTD+          Y I L LG++ K     +  + +  + + LN 
Sbjct: 1132 NTQLEVILQSKWISNTDIL--------HYLIKLTLGSSKKIASQRVIQLLLNNENITLND 1183

Query: 997  SKC--LKSWSNFLVFGSVLHNNKFNSRILSKPIDIINCNNLAQGKKKFRDRRLRIIKQT- 1167
            +K   +  +   L+  S+   +  N+      + +  C +  +G     DR L  + +T 
Sbjct: 1184 NKANYITKYLTALLINSICATDIKNT---CTTLTLRKCVSFYRGSLAAHDRVLLNVIETA 1240

Query: 1168 ------------ITDNYVK-LGNVASIIFIEDEATSIAEGLT-------LEGNDKY---- 1275
                        IT +Y++  G+V  ++   +  + I  G         +E   K+    
Sbjct: 1241 EAQTGSSWINDVITWDYIQNAGDVLDVVSDINLISQINGGFVVTLRKDFIENTCKFAGQV 1300

Query: 1276 --EQFSDEYRSDIDVIEDDSYD 1335
                F+D+ RS++  I+ ++ D
Sbjct: 1301 GRPNFTDDIRSELQHIDSNNND 1322

>NDAI0B06160 Chr2 (1494425..1498636) [4212 bp, 1403 aa] {ON} 
          Length = 1403

 Score = 37.0 bits (84), Expect = 0.14
 Identities = 26/96 (27%), Positives = 42/96 (43%), Gaps = 1/96 (1%)
 Frame = +1

Query: 637 PMERIHIEIFNPFDDLKIEN-KYQRILYIRDYSTRYIWTFTLKKLKLKHITNILTEFFLS 813
           P E IH ++F P   + I + KY   +   D +TR+ W F LKK    HI  I  +    
Sbjct: 375 PFEYIHTDLFGPVSGVDITSPKY--FISFTDENTRFRWVFPLKKKDADHILPIFQQLVNY 432

Query: 814 IATNVPIFLQSSTIDNTDLFDICEKISREYHISLGL 921
           I     + + +  +D     +   K+ R+Y    G+
Sbjct: 433 IKNQFKVRVLTFHMDRGS--EYTNKLVRDYFKDKGI 466

>NDAI0G00550 Chr7 complement(116985..118223) [1239 bp, 412 aa] {ON} 
          Length = 412

 Score = 36.6 bits (83), Expect = 0.14
 Identities = 22/67 (32%), Positives = 31/67 (46%), Gaps = 1/67 (1%)
 Frame = +1

Query: 637 PMERIHIEIFNPFDDLKIEN-KYQRILYIRDYSTRYIWTFTLKKLKLKHITNILTEFFLS 813
           P E IH ++F P   + I + KY   +   D +TR+ W F LKK    HI  I  +    
Sbjct: 290 PFEYIHTDLFGPVSGVDITSPKY--FISFTDENTRFRWVFPLKKKDADHILPIFQQLVNY 347

Query: 814 IATNVPI 834
           I T   +
Sbjct: 348 IKTQFKV 354

>NDAI0G00600 Chr7 complement(130877..132343) [1467 bp, 488 aa] {ON} 
          Length = 488

 Score = 36.6 bits (83), Expect = 0.15
 Identities = 22/67 (32%), Positives = 31/67 (46%), Gaps = 1/67 (1%)
 Frame = +1

Query: 637 PMERIHIEIFNPFDDLKIEN-KYQRILYIRDYSTRYIWTFTLKKLKLKHITNILTEFFLS 813
           PM  IH ++F P   + I + KY   +   D +TR+ W F LKK    HI  I  +    
Sbjct: 185 PMSYIHTDLFGPVSGVDITSPKY--FISFTDENTRFRWVFPLKKKDADHILPIFQQLVNY 242

Query: 814 IATNVPI 834
           I T   +
Sbjct: 243 IKTQFKV 249

>TBLA0A05420 Chr1 (1329965..1333840) [3876 bp, 1291 aa] {ON} Anc_1.79
            YNL273W
          Length = 1291

 Score = 35.8 bits (81), Expect = 0.32
 Identities = 20/50 (40%), Positives = 30/50 (60%), Gaps = 4/50 (8%)
 Frame = +1

Query: 1216 IEDEATSI--AEGLTLEGNDKYEQFSD--EYRSDIDVIEDDSYDIPLSDT 1353
            ++D+  S+  A+GL +EG+ +Y    D  EY  D D I+D+ Y   LSDT
Sbjct: 963  VDDKELSVFGADGLNIEGDSEYNSHLDKYEYDEDNDFIDDNDYFKGLSDT 1012

>NCAS0A06040 Chr1 complement(1193225..1194991) [1767 bp, 588 aa]
           {ON} 
          Length = 588

 Score = 34.7 bits (78), Expect = 0.64
 Identities = 47/221 (21%), Positives = 82/221 (37%), Gaps = 31/221 (14%)
 Frame = +1

Query: 190 RYHSIKAAVLTQEYCDMLNTGTLSPENI-----IKYD------TKLTNHSKALEKY-NFT 333
           RY  +   V+     D+L     +PE++      KY       T ++   + L+ + ++ 
Sbjct: 52  RYKMLPFLVMNDLIADLLLANKFNPESLKAAVFSKYTGAENKGTAISRSKRKLKNFCDYI 111

Query: 334 SRRYYLNEDNNIIDKRKPG----RIICEPKYMYDIVIAYHLKL----------HSSYAVS 471
           + RY + ++     K   G    ++ C P  M   +I YH +           H   A +
Sbjct: 112 TARYVVIDEKIYARKASKGDESPKMWCPPSLMTFFIIRYHRRQDIDESERKARHRGVAAT 171

Query: 472 -ERLKKFFSNVGRQYIDYCAKYCSKCFPDETEHMKLFTDDITFKNIRNNIIDRPLFPMER 648
            + + +  S + RQ I      C KC   +   +    DD     +          P E 
Sbjct: 172 HDAIGEKMSGITRQLIQDVTYDCLKCNVTKGVPIIYVPDDNPKAEV----------PFEN 221

Query: 649 IHIEIFNPFDDL----KIENKYQRILYIRDYSTRYIWTFTL 759
           + I+I +  D      K   K  +IL+I D  T Y W + L
Sbjct: 222 LLIDIIDLKDRSCRCPKDNKKKSQILHIMDQYTEYTWLYIL 262

>Kpol_423.4 s423 complement(5205..6128,6130..6216,6218..6445) [1239
            bp, 412 aa] {ON}
            complement(5205..6128,6130..6216,6218..6445) [1239 nt,
            413 aa]
          Length = 412

 Score = 33.5 bits (75), Expect = 1.3
 Identities = 25/65 (38%), Positives = 38/65 (58%), Gaps = 3/65 (4%)
 Frame = +1

Query: 844  SSTIDNTDLFDICEKISREYHISLGLGTNNKHDHFHLSG--IEMFKQL-VNLNKSKCLKS 1014
            S T DN + FDI + I   Y  SLGL T  + + + ++   IE+ K+L  N N +K LKS
Sbjct: 293  SGTKDNNN-FDISKIIDNSYMYSLGLTTTTRIEIYEITKPLIELLKELKQNNNDNKQLKS 351

Query: 1015 WSNFL 1029
            +++ L
Sbjct: 352  YNDRL 356

>TBLA0I01360 Chr9 complement(290912..292627,292882..293148) [1983
           bp, 660 aa] {ON} Anc_2.447 YKL125W
          Length = 660

 Score = 33.5 bits (75), Expect = 1.5
 Identities = 30/117 (25%), Positives = 55/117 (47%), Gaps = 13/117 (11%)
 Frame = +1

Query: 391 RIICE--PKYMYDI---VIAYHLKLHSSYAVSERLKKFFSNVGRQYIDYCAKYCSKCFPD 555
           RI+C   PK+  DI   +I+  +  +SS +    L K+F NV    ++Y   Y SK FP+
Sbjct: 165 RILCSSIPKWWQDISMNLISNFILPNSSTSHHHDLLKYFLNVIPSSMNYIDSYLSKFFPN 224

Query: 556 ETEHMKLFTDDIT--------FKNIRNNIIDRPLFPMERIHIEIFNPFDDLKIENKY 702
           + +  K   + I+         K +R       +  +  I +E+ N  D+L  ++++
Sbjct: 225 KNDTRKKLVNYISNILTLTSYCKELRFQTWSLLIERIISIDVELQNELDELDDDDEF 281

>KNAG0B01440 Chr2 complement(272166..274499) [2334 bp, 777 aa] {ON}
            Anc_3.368 YBR114W
          Length = 777

 Score = 33.5 bits (75), Expect = 1.5
 Identities = 26/78 (33%), Positives = 40/78 (51%), Gaps = 1/78 (1%)
 Frame = +1

Query: 1126 KKFRDRRLRIIKQTITDNYVKLGNVASIIFIEDEATSIAEGLTLEGN-DKYEQFSDEYRS 1302
            ++ R  R R  K  +  NYV++ +  +    ED+AT     L LE   DK+   SD+Y  
Sbjct: 8    RRTRSGRSRAAKAKV--NYVEINDFENE---EDDAT-----LKLEKTPDKHLNISDDYND 57

Query: 1303 DIDVIEDDSYDIPLSDTE 1356
            D D +EDD+   P+ + E
Sbjct: 58   DEDYLEDDTDVAPVKEEE 75

>TPHA0G00330 Chr7 (57459..58274) [816 bp, 271 aa] {ON} Anc_7.523
           YPR167C
          Length = 271

 Score = 32.7 bits (73), Expect = 1.9
 Identities = 27/69 (39%), Positives = 36/69 (52%), Gaps = 3/69 (4%)
 Frame = +1

Query: 4   TNDSHQQNSNIQDLKSLTPDEKLEMLKIYNPKDLGISYTD---YLDEKNSNVNIELLEKG 174
           T     Q S+  DLK L  DE   ++KI NP  +  S+     Y+D+ N   N ELL+ G
Sbjct: 163 TGRRRSQGSSRSDLKFLEIDEINGIIKI-NPF-MNWSFPQVKQYIDDNNVPYN-ELLDLG 219

Query: 175 YKDMQRYHS 201
           YK +  YHS
Sbjct: 220 YKSIGDYHS 228

>TBLA0H03890 Chr8 (940387..942489) [2103 bp, 700 aa] {ON} Anc_8.590
            YBR169C
          Length = 700

 Score = 33.1 bits (74), Expect = 2.0
 Identities = 34/165 (20%), Positives = 67/165 (40%), Gaps = 6/165 (3%)
 Frame = +1

Query: 820  TNVPIFLQSSTIDNTDLFDICEKISREYHIS------LGLGTNNKHDHFHLSGIEMFKQL 981
            T++ +F +   I +T +F +        HI+      +   TN K   +H+ GI + +  
Sbjct: 425  TSLEVFPKDCPIPSTKIFTLPRSGDFSVHINYTNPLEVSKSTNQKLSRWHIHGISLEEDQ 484

Query: 982  VNLNKSKCLKSWSNFLVFGSVLHNNKFNSRILSKPIDIINCNNLAQGKKKFRDRRLRIIK 1161
             ++     L+S  +        +  K +  I  KP      +N +Q  K  RD+RL +  
Sbjct: 485  ESVPVELRLRSEISGFYIIRDAYTLKQDPSITEKPNTGEKNHNNSQKPKYVRDKRLNVKS 544

Query: 1162 QTITDNYVKLGNVASIIFIEDEATSIAEGLTLEGNDKYEQFSDEY 1296
             T   ++  L  +  I     E   I + + +E  ++ +   +EY
Sbjct: 545  HTFAISHKALKELKKI-----EEDMIKQDILVEETEERKNSFEEY 584

>KLTH0F13904g Chr6 complement(1141955..1144174) [2220 bp, 739 aa] {ON}
            similar to uniprot|P39925 Saccharomyces cerevisiae
            YER017C AFG3 Component with Yta12p of the mitochondrial
            inner membrane m-AAA protease that mediates degradation
            of misfolded or unassembled proteins and is also required
            for correct assembly of mitochondrial enzyme complexes
          Length = 739

 Score = 32.7 bits (73), Expect = 2.6
 Identities = 35/150 (23%), Positives = 61/150 (40%), Gaps = 6/150 (4%)
 Frame = +1

Query: 886  KISREYHISLGLGTNNKHDHFHLSGIEMFKQLVNLNKSKCLKSWSNFLVFGSVLHNNKFN 1065
            ++S E H      T+  HD F        K++ N+  +   K   +  V G + ++   +
Sbjct: 599  RVSEELHFPYV--TSGAHDDF--------KKVTNMANAMVTKLGMS-RVMGYIAYDQDNS 647

Query: 1066 SRILSKPIDIINCNNLAQGKKKFRDRRLRIIKQTITDNYVKLGNVA------SIIFIEDE 1227
               ++KP        +    KK  D   R  KQ +TDN  K+  VA       +I  ED 
Sbjct: 648  GVQVNKPFSEQTSRKIDLEVKKIVDEAHRQCKQLLTDNLQKVDAVAQELLRKEVITREDM 707

Query: 1228 ATSIAEGLTLEGNDKYEQFSDEYRSDIDVI 1317
               +      E N+ +E++ D  + D +V+
Sbjct: 708  IRLLGPRPFPEKNEAFEKYLDPKKDDGNVV 737

>KAFR0L00660 Chr12 complement(123550..127071) [3522 bp, 1173 aa]
           {ON} Anc_7.201 YIL026C
          Length = 1173

 Score = 32.7 bits (73), Expect = 2.8
 Identities = 22/81 (27%), Positives = 38/81 (46%), Gaps = 11/81 (13%)
 Frame = +1

Query: 22  QNSNIQDLKSLTPDEKLEMLKIYNPKD-----------LGISYTDYLDEKNSNVNIELLE 168
           +N+  +D+K LT  + L  LK +  KD           L + +  +LDE   N + + +E
Sbjct: 741 ENNYTEDIKVLTLTQTLTHLKNFKLKDIDELWINQITLLKMQFEKFLDENVMNDDEDAIE 800

Query: 169 KGYKDMQRYHSIKAAVLTQEY 231
           K Y     ++  K  +L +EY
Sbjct: 801 KYYNTAYSFYINKLVLLGKEY 821

>Kpol_1031.64 s1031 (161135..162958) [1824 bp, 607 aa] {ON}
           (161135..162958) [1824 nt, 608 aa]
          Length = 607

 Score = 32.3 bits (72), Expect = 3.4
 Identities = 30/135 (22%), Positives = 61/135 (45%), Gaps = 13/135 (9%)
 Frame = +1

Query: 1   MTNDSHQQNSNIQDLKSLTPDEKLEM----LKIYNPKDLGISYTDYLDEKNSNVNIELLE 168
           M+ +S  Q    Q+L++ T +E  E     L+     +L I+  + L ++      E ++
Sbjct: 183 MSQNSLLQQGRQQNLQNQTTNENWEKHFKELEEEVTNNLKINTDEPLTKEGEVDQEEKVQ 242

Query: 169 KGYKDMQRYHSIKAAVLTQEYCDMLNTGT--LSPENIIKYDTKLTNHSK-------ALEK 321
           +  + +++Y  +      QE  D +N     L P+N++  D    +H K       ++E+
Sbjct: 243 EADEQIEQYQDV-----FQEVWDSINQDAEDLLPDNLVGKDAWNNDHQKYFSDRINSVEE 297

Query: 322 YNFTSRRYYLNEDNN 366
           Y F  +  Y+N  N+
Sbjct: 298 YQFDKKNEYMNNPNS 312

>Kpol_1002.97 s1002 complement(243708..245690) [1983 bp, 660 aa] {ON}
            complement(243708..245690) [1983 nt, 661 aa]
          Length = 660

 Score = 32.3 bits (72), Expect = 3.4
 Identities = 29/110 (26%), Positives = 50/110 (45%), Gaps = 4/110 (3%)
 Frame = +1

Query: 775  KHITNILTEFFLSIATNVPIFLQSSTIDNTDLFDICEKISREYHISLGLGTNNKHDH--- 945
            +HI  +  EF L    N   ++Q S +     FDI E I +E+ +   L T++       
Sbjct: 48   RHICRVDNEFVLLERYNEKYWIQWSILS----FDI-EDIKKEHLLLTKLETSDSMSSQML 102

Query: 946  -FHLSGIEMFKQLVNLNKSKCLKSWSNFLVFGSVLHNNKFNSRILSKPID 1092
             F+  GI    + + + KS+C+    N +   S+   +  NS I  KP++
Sbjct: 103  DFNSLGIRDILKSLQMEKSECIVGGDNSIQHLSMTPPDIMNSEIEKKPLE 152

>KLLA0E17843g Chr5 complement(1582644..1585943) [3300 bp, 1099 aa]
            {ON} weakly similar to uniprot|Q08236 Saccharomyces
            cerevisiae YOL078W AVO1 Component of a membrane-bound
            complex containing the Tor2p kinase and other proteins
            which may have a role in regulation of cell growth
          Length = 1099

 Score = 32.3 bits (72), Expect = 3.7
 Identities = 27/105 (25%), Positives = 51/105 (48%), Gaps = 1/105 (0%)
 Frame = +1

Query: 31   NIQDLKSLTPDEKLEMLKIYNPKDLGISYTDYLDEKNSNVNIELLEKGYKDMQRYHSIKA 210
            N   LK+L P E +  ++    ++L +   DY+   + N N+ELL+K     +++  +K 
Sbjct: 819  NYCKLKNLDPTEYVLKME---KRNLILDLNDYVTSLDGNYNVELLKKKDARTKKFERMK- 874

Query: 211  AVLTQEYCDMLNTGTLSPENI-IKYDTKLTNHSKALEKYNFTSRR 342
            AV  Q     + +  L+P  + +  D +L N +   E+ +  S R
Sbjct: 875  AVTNQPVLPTIQSTELTPLTLTMANDNRLLNKTLQEEETSANSGR 919

>NCAS0J00510 Chr10 (77425..78507) [1083 bp, 360 aa] {ON} Anc_8.63
           YPL018W
          Length = 360

 Score = 32.0 bits (71), Expect = 3.8
 Identities = 37/167 (22%), Positives = 61/167 (36%), Gaps = 14/167 (8%)
 Frame = +1

Query: 13  SHQQNSNIQDLKSLTPDEK---LEMLKIYNPKDL-------GISYTDYLDEKNSNVNIEL 162
           + +Q   +QD K     E+   LE +  Y   DL           T   DE N+N+   L
Sbjct: 43  NERQKLKLQDEKEALLRERNLLLEEIAKYKESDLVDENAGEADKETSKADEINANIRATL 102

Query: 163 LEKGYKDMQRYHSIKAAVLTQEYCDMLNTGTLSPENIIKYDT----KLTNHSKALEKYNF 330
              G              L ++   ++   T S     KYDT     L +  + ++KY F
Sbjct: 103 DSNGI------------ALFKDILSIVKDPTSSNVRSSKYDTLPILTLQSRIQYMKKYTF 150

Query: 331 TSRRYYLNEDNNIIDKRKPGRIICEPKYMYDIVIAYHLKLHSSYAVS 471
                 +N      +    G I CE K+  +    + ++L  +Y +S
Sbjct: 151 PYMTLSINSGEESTESENEGSITCEFKFTRNKDTNFSIELQVNYKLS 197

>TDEL0H04520 Chr8 complement(817439..819277) [1839 bp, 612 aa] {ON} 
          Length = 612

 Score = 32.0 bits (71), Expect = 4.4
 Identities = 19/64 (29%), Positives = 30/64 (46%)
 Frame = +1

Query: 637 PMERIHIEIFNPFDDLKIENKYQRILYIRDYSTRYIWTFTLKKLKLKHITNILTEFFLSI 816
           P + IH ++F P     + N  + +L   D  TRY W F L++   + IT   +E    I
Sbjct: 81  PFQFIHTDLFGPVQVTAV-NVPRYLLAFTDECTRYKWVFPLREKDSQSITARFSELVRFI 139

Query: 817 ATNV 828
            T +
Sbjct: 140 ETQL 143

>TBLA0I02870 Chr9 (677817..680096) [2280 bp, 759 aa] {ON} Anc_4.235
            YLR381W
          Length = 759

 Score = 32.0 bits (71), Expect = 4.6
 Identities = 71/350 (20%), Positives = 134/350 (38%), Gaps = 47/350 (13%)
 Frame = +1

Query: 139  NSNVNIELLEKGYKDMQRYHSIKAAVLTQEY------CDMLNTGTLSPENIIKYDTKLTN 300
            N N N  +LE+ YKD+     I +  + +++       + L + T+S   +I   ++   
Sbjct: 177  NKNENTTILEENYKDIHGDAIINSIAILRKFQSFFGKSNELISNTISKLEVIYPISRKKI 236

Query: 301  HSKALEKYNFTSRRYYLNEDNNIIDKRKPGRIICEPKYMYDIVIAYH----LKLHSSYAV 468
             S  L K+ F S+  +++  +NII            ++  + +++Y+    L++    ++
Sbjct: 237  RSSWLSKFKFDSK--FIDTLSNIIP---------SSEFFGESLLSYYEKLTLEIKPDLSL 285

Query: 469  SERLKKFFSNVGRQYIDYCAKYCSKCFPDETEHMKLFT----DDITFKNIRNNIIDRPLF 636
            +     FF N+ +          +KCF D  E+    T     +I F N     I   L 
Sbjct: 286  TSLQPHFFINL-KSINTSSPLLKAKCFEDLIENWGTITIPNNIEILFSNNTPLFIKLYLL 344

Query: 637  PMERIH-IEIFNPFDDLKIENKYQRILYIRDYSTRYIWTFTLKKLKLKHITNILTEFF-- 807
               + H IE  + +  L ++ K  R+L+ +   T   +   ++K +L      + EF+  
Sbjct: 345  QNNKSHFIEEKSIYSWLTVQLK--RLLFSKTKFTHENFIKDIEKNQLIQQLIFILEFYPA 402

Query: 808  ------LSIATNVPIFLQS---------------------STIDNTDLFDICEKISRE-- 900
                  +     +P FL                       S  D T   D+ +K+     
Sbjct: 403  INKRILIDFILQIPYFLTDQQYKSFHLNFELLTLICKLSLSNFDITSSSDLWKKLRESFL 462

Query: 901  -YHISLGLGTNNKHDHFHLSGIEMFKQLVNLNKSKCLKSWSNFLVFGSVL 1047
             YH+     T N         I  F   + +N+S  +K   NF +F S+L
Sbjct: 463  FYHLKRSTETTNLFFVIANELILNFNHALKINESITIK---NFELFTSIL 509

>TPHA0A03760 Chr1 (821355..824855) [3501 bp, 1166 aa] {ON} Anc_3.330
            YPR049C
          Length = 1166

 Score = 32.0 bits (71), Expect = 4.9
 Identities = 35/132 (26%), Positives = 56/132 (42%), Gaps = 6/132 (4%)
 Frame = +1

Query: 7    NDSHQQNSNIQDLKSLTPDEKLEMLKIYNPK-DLGISYTDYLDEK-----NSNVNIELLE 168
            + S   NSN + +  L  D+  E L+    K D+ +     L EK     N  VNIE+  
Sbjct: 658  SSSKFSNSNFEIVDRLRIDDVEEELRRVKQKMDMTLRDNYSLSEKLTKITNDKVNIEVER 717

Query: 169  KGYKDMQRYHSIKAAVLTQEYCDMLNTGTLSPENIIKYDTKLTNHSKALEKYNFTSRRYY 348
              YK+   + + + + LT    DM N  +   +       KL N +K+L      S    
Sbjct: 718  DAYKETLSHLNNELSRLTTIEADMQNILSNKEQTFKDNMIKLVNENKSL----LVSLSSE 773

Query: 349  LNEDNNIIDKRK 384
            + + N I D++K
Sbjct: 774  IEKKNKIRDEQK 785

>TDEL0E00260 Chr5 complement(46841..49489,49491..50588) [3747 bp,
           1248 aa] {ON} 
          Length = 1248

 Score = 32.0 bits (71), Expect = 4.9
 Identities = 19/64 (29%), Positives = 30/64 (46%)
 Frame = +1

Query: 637 PMERIHIEIFNPFDDLKIENKYQRILYIRDYSTRYIWTFTLKKLKLKHITNILTEFFLSI 816
           P + IH ++F P     + N  + +L   D  TRY W F L++   + IT   +E    I
Sbjct: 589 PFQFIHTDLFGPVQVTAV-NVPRYLLAFTDECTRYKWVFPLREKDSQSITARFSELVRFI 647

Query: 817 ATNV 828
            T +
Sbjct: 648 ETQL 651

>KLLA0A06061g Chr1 complement(559396..560994) [1599 bp, 532 aa] {ON}
           similar to uniprot|P47005 Saccharomyces cerevisiae
           YJL149W
          Length = 532

 Score = 31.6 bits (70), Expect = 5.7
 Identities = 32/120 (26%), Positives = 51/120 (42%), Gaps = 17/120 (14%)
 Frame = +1

Query: 499 VGRQYIDYCAKYCSKCFPDETEHMKLFTDDITFKNIRNNIIDRPLFPME---RIH----- 654
           V R Y+   A+Y  +       HM LF D I   N         ++P++   +IH     
Sbjct: 176 VSRTYLPNLAQYLKQRISSNLSHMTLFMDPIQLFNC--------IYPLQFKLQIHDLKLH 227

Query: 655 -IEIFNPFDDLKIENKYQRILYIRD-YSTRYI-------WTFTLKKLKLKHITNILTEFF 807
             + + P D LK  N+Y ++  + D +  R +       W   L K +L+    ILTEF+
Sbjct: 228 WRKEYYPPDQLKPLNQYPKLTKLSDVFDVRTLKVLTIISWNENLNKRELE----ILTEFY 283

>SAKL0H23320g Chr8 (2022223..2023086) [864 bp, 287 aa] {ON} similar
           to uniprot|P07273 YGL043W Saccharomyces cerevisiae DST1
           General transcription elongation factor TFIIS
          Length = 287

 Score = 31.2 bits (69), Expect = 6.0
 Identities = 23/93 (24%), Positives = 41/93 (44%), Gaps = 3/93 (3%)
 Frame = +1

Query: 133 EKNSNVNIELLEKGYKDMQRYHSIKAAVLTQEYCDM---LNTGTLSPENIIKYDTKLTNH 303
           E N   + E  EK YKD  +Y  I + V+++   D+   +N G +SPE ++  D K    
Sbjct: 159 ELNKLNSSEENEKAYKD--KYRVIYSNVISKNNVDLKQKINNGDVSPEYLVTCDPKELAP 216

Query: 304 SKALEKYNFTSRRYYLNEDNNIIDKRKPGRIIC 402
               +K    +++   N     +++    R  C
Sbjct: 217 EHLKKKMEEIAKQNLFNAQGATLERSVTDRFTC 249

>NDAI0J00350 Chr10 (58349..59413) [1065 bp, 354 aa] {ON} Anc_7.536
           YPR180W
          Length = 354

 Score = 31.2 bits (69), Expect = 6.6
 Identities = 31/122 (25%), Positives = 58/122 (47%), Gaps = 7/122 (5%)
 Frame = +1

Query: 643 ERIHIEIFNPFDDLKIENKYQRILYIRDYSTRY---IWTFTLK----KLKLKHITNILTE 801
           E I ++ +   DD KI ++    +  R+Y   +   + T TL+    K +LK ++++L  
Sbjct: 201 EIIDVQTYKAEDDEKIVHEK---ITTRNYYKSFEDMLQTATLEGKLNKRQLKKVSSLLPL 257

Query: 802 FFLSIATNVPIFLQSSTIDNTDLFDICEKISREYHISLGLGTNNKHDHFHLSGIEMFKQL 981
            F S+ +++PI   S       +  +CEK        LGL T+N  + +    +E F++ 
Sbjct: 258 TFTSLVSDIPIETLSQEKLQELVIQVCEK--------LGLATSNISNEY----VEQFQRQ 305

Query: 982 VN 987
            N
Sbjct: 306 TN 307

>AGL022W Chr7 (674947..681384) [6438 bp, 2145 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YFL007W (BLM3)
          Length = 2145

 Score = 31.2 bits (69), Expect = 8.8
 Identities = 21/72 (29%), Positives = 39/72 (54%)
 Frame = +1

Query: 643 ERIHIEIFNPFDDLKIENKYQRILYIRDYSTRYIWTFTLKKLKLKHITNILTEFFLSIAT 822
           +R+ I++++   D  I + ++ I  ++ + TR +    +  L   HI+NILT     I +
Sbjct: 618 DRVLIDLYDSLTDQYIHSVHRVITSLKQF-TRIVRYMVIHPLYRVHISNILTMLISKIGS 676

Query: 823 NVPIFLQSSTID 858
           N  I L S+TI+
Sbjct: 677 N-DISLTSNTIN 687

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 121,996,991
Number of extensions: 2731357
Number of successful extensions: 10487
Number of sequences better than 10.0: 51
Number of HSP's gapped: 10346
Number of HSP's successfully gapped: 51
Length of query: 482
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 369
Effective length of database: 40,524,141
Effective search space: 14953408029
Effective search space used: 14953408029
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 35 (18.1 bits)