Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0E044208.260ON31482592129470.0
Smik_12.1468.260ON2958257960950.0
YLR087C (CSF1)8.260ON2958258160710.0
Suva_10.1718.260ON2958257560660.0
Skud_12.1558.260ON2959257860010.0
NCAS0B050108.260ON2952257459860.0
NDAI0B019808.260ON2959257558890.0
TDEL0F038708.260ON2942258057870.0
KAFR0B027208.260ON2982262657710.0
Kpol_392.78.260ON2995260555730.0
CAGL0L12210g8.260ON2981261655310.0
KNAG0G020308.260ON2998260054640.0
ZYRO0C01694g8.260ON3006260053070.0
TPHA0J007308.260ON3046259647940.0
SAKL0H17072g8.260ON2997262742130.0
KLTH0G13728g8.260ON2966261136640.0
Kwal_YGOB_56.238088.260ON2941261635900.0
Kwal_56.23810singletonOFF2763261635840.0
AGR088W8.260ON2887266728630.0
Ecym_43108.260ON2943119916121e-180
KLLA0F19096g8.260ON2923110015051e-167
Kwal_56.23808singletonOFF62591372e-09
Smik_4.5415.302ON62153802.5
KLTH0H06710g6.110ON49464784.6
CAGL0J11022g5.329ON21992756.8
YDR292C (SRP101)5.302ON62153768.4
CAGL0I02090g5.88ON113683769.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0E04420
         (3148 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0E04420 Chr5 complement(1126342..1135788) [9447 bp, 3148 aa]...  4991   0.0  
Smik_12.146 Chr12 complement(286690..295566) [8877 bp, 2958 aa] ...  2352   0.0  
YLR087C Chr12 complement(306855..315731) [8877 bp, 2958 aa] {ON}...  2343   0.0  
Suva_10.171 Chr10 complement(311672..320548) [8877 bp, 2958 aa] ...  2341   0.0  
Skud_12.155 Chr12 complement(290039..298918) [8880 bp, 2959 aa] ...  2316   0.0  
NCAS0B05010 Chr2 complement(922165..931023) [8859 bp, 2952 aa] {...  2310   0.0  
NDAI0B01980 Chr2 complement(483519..492398) [8880 bp, 2959 aa] {...  2273   0.0  
TDEL0F03870 Chr6 complement(713797..722625) [8829 bp, 2942 aa] {...  2233   0.0  
KAFR0B02720 Chr2 complement(549702..558650) [8949 bp, 2982 aa] {...  2227   0.0  
Kpol_392.7 s392 (10369..19356) [8988 bp, 2995 aa] {ON} (10369..1...  2151   0.0  
CAGL0L12210g Chr12 complement(1315265..1324210) [8946 bp, 2981 a...  2135   0.0  
KNAG0G02030 Chr7 complement(453579..462575) [8997 bp, 2998 aa] {...  2109   0.0  
ZYRO0C01694g Chr3 (121250..130270) [9021 bp, 3006 aa] {ON} simil...  2048   0.0  
TPHA0J00730 Chr10 complement(165253..174393) [9141 bp, 3046 aa] ...  1851   0.0  
SAKL0H17072g Chr8 (1498942..1507935) [8994 bp, 2997 aa] {ON} sim...  1627   0.0  
KLTH0G13728g Chr7 (1175228..1184128) [8901 bp, 2966 aa] {ON} sim...  1415   0.0  
Kwal_YGOB_56.23808 s56 (712095..712280,712384..721023) [8826 bp,...  1387   0.0  
Kwal_56.23810 s56 (712732..721023) [8292 bp, 2763 aa] {OFF} YLR0...  1385   0.0  
AGR088W Chr7 (892680..901343) [8664 bp, 2887 aa] {ON} Syntenic h...  1107   0.0  
Ecym_4310 Chr4 (657929..666760) [8832 bp, 2943 aa] {ON} similar ...   625   e-180
KLLA0F19096g Chr6 complement(1762215..1770986) [8772 bp, 2923 aa...   584   e-167
Kwal_56.23808 s56 (712095..712280) [186 bp, 62 aa] {OFF} YLR087C...    57   2e-09
Smik_4.541 Chr4 complement(974729..976594) [1866 bp, 621 aa] {ON...    35   2.5  
KLTH0H06710g Chr8 (590346..591830) [1485 bp, 494 aa] {ON} simila...    35   4.6  
CAGL0J11022g Chr10 (1075366..1076025) [660 bp, 219 aa] {ON} high...    33   6.8  
YDR292C Chr4 complement(1043146..1045011) [1866 bp, 621 aa] {ON}...    34   8.4  
CAGL0I02090g Chr9 complement(177324..180734) [3411 bp, 1136 aa] ...    34   9.3  

>TBLA0E04420 Chr5 complement(1126342..1135788) [9447 bp, 3148 aa] {ON}
            Anc_8.260 YLR087C
          Length = 3148

 Score = 4991 bits (12947), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 2458/2592 (94%), Positives = 2458/2592 (94%)

Query: 557  IAEAGASPDTDRNNESDASNNQQRNTYSRSTTDNISAPPESNMEFQLFDASINYGPWAHR 616
            IAEAGASPDTDRNNESDASNNQQRNTYSRSTTDNISAPPESNMEFQLFDASINYGPWAHR
Sbjct: 557  IAEAGASPDTDRNNESDASNNQQRNTYSRSTTDNISAPPESNMEFQLFDASINYGPWAHR 616

Query: 617  NIMNIQRIFSPIVSRTPELQPDPEPGFLRRYTMTKISVSIMEDSSWRVPTREPSKDQDFL 676
            NIMNIQRIFSPIVSRTPELQPDPEPGFLRRYTMTKISVSIMEDSSWRVPTREPSKDQDFL
Sbjct: 617  NIMNIQRIFSPIVSRTPELQPDPEPGFLRRYTMTKISVSIMEDSSWRVPTREPSKDQDFL 676

Query: 677  KRYMKTNDSSRSFGWFDLNFSRNSEATFCISSIPDVNGYANKLNLDFKDLEVRSSVNHDI 736
            KRYMKTNDSSRSFGWFDLNFSRNSEATFCISSIPDVNGYANKLNLDFKDLEVRSSVNHDI
Sbjct: 677  KRYMKTNDSSRSFGWFDLNFSRNSEATFCISSIPDVNGYANKLNLDFKDLEVRSSVNHDI 736

Query: 737  FFRSKSYRVDSDIGYPLGWNDEVTWSFVFDSYQLETFFLREHLVLIADTFSDFSSGEPTP 796
            FFRSKSYRVDSDIGYPLGWNDEVTWSFVFDSYQLETFFLREHLVLIADTFSDFSSGEPTP
Sbjct: 737  FFRSKSYRVDSDIGYPLGWNDEVTWSFVFDSYQLETFFLREHLVLIADTFSDFSSGEPTP 796

Query: 797  YEFFRPSIYKVDWNFHGYSAYLNVNDHNIINNPLDFNENCYISVHGDDAHIGVEIPRLGI 856
            YEFFRPSIYKVDWNFHGYSAYLNVNDHNIINNPLDFNENCYISVHGDDAHIGVEIPRLGI
Sbjct: 797  YEFFRPSIYKVDWNFHGYSAYLNVNDHNIINNPLDFNENCYISVHGDDAHIGVEIPRLGI 856

Query: 857  TATYTDIIFQISTPMFRXXXXXXXXXXXXEFMRNKEIGRGYDFTAEGSYIIYSDLDIDNV 916
            TATYTDIIFQISTPMFR            EFMRNKEIGRGYDFTAEGSYIIYSDLDIDNV
Sbjct: 857  TATYTDIIFQISTPMFRLLLNTPPWNTLNEFMRNKEIGRGYDFTAEGSYIIYSDLDIDNV 916

Query: 917  DSLTIECSTRRMTLLTYGFVIGYLLNVQMNYFGEFSHFITAEEYTDIVRGNDNDIVSTLA 976
            DSLTIECSTRRMTLLTYGFVIGYLLNVQMNYFGEFSHFITAEEYTDIVRGNDNDIVSTLA
Sbjct: 917  DSLTIECSTRRMTLLTYGFVIGYLLNVQMNYFGEFSHFITAEEYTDIVRGNDNDIVSTLA 976

Query: 977  DFXXXXXXXXXXXXXXXQHNPDNSSKSNIIDPLYNPPLRKDDIKRKVNETDIWFTFSVWE 1036
            DF               QHNPDNSSKSNIIDPLYNPPLRKDDIKRKVNETDIWFTFSVWE
Sbjct: 977  DFSVMSETNSVSNVSNSQHNPDNSSKSNIIDPLYNPPLRKDDIKRKVNETDIWFTFSVWE 1036

Query: 1037 GALLLPEVLYNSDPCIALSFKELIIDFRNCDYYLDLLATLNGTSFKRCIRKNQNDIFELV 1096
            GALLLPEVLYNSDPCIALSFKELIIDFRNCDYYLDLLATLNGTSFKRCIRKNQNDIFELV
Sbjct: 1037 GALLLPEVLYNSDPCIALSFKELIIDFRNCDYYLDLLATLNGTSFKRCIRKNQNDIFELV 1096

Query: 1097 HNNAIKNLEEHGSVSNISIHGHRMYGAPPTSPSYFSDWAVDVNNLSINSDIYFIRGFISY 1156
            HNNAIKNLEEHGSVSNISIHGHRMYGAPPTSPSYFSDWAVDVNNLSINSDIYFIRGFISY
Sbjct: 1097 HNNAIKNLEEHGSVSNISIHGHRMYGAPPTSPSYFSDWAVDVNNLSINSDIYFIRGFISY 1156

Query: 1157 ITKVGFEFSNLQNILLYDESVLDNMTSVTVHGTGIDILVADKSTSAQVLLNMDGITFNRI 1216
            ITKVGFEFSNLQNILLYDESVLDNMTSVTVHGTGIDILVADKSTSAQVLLNMDGITFNRI
Sbjct: 1157 ITKVGFEFSNLQNILLYDESVLDNMTSVTVHGTGIDILVADKSTSAQVLLNMDGITFNRI 1216

Query: 1217 NFANDRYSSRIDLQVPGLHFAFFDNGSSMDKTCLFEFKTKINFTNFTQMKDGELHSKKQQ 1276
            NFANDRYSSRIDLQVPGLHFAFFDNGSSMDKTCLFEFKTKINFTNFTQMKDGELHSKKQQ
Sbjct: 1217 NFANDRYSSRIDLQVPGLHFAFFDNGSSMDKTCLFEFKTKINFTNFTQMKDGELHSKKQQ 1276

Query: 1277 EFIALNDSAFHRCSFLLLPHIQESLLYHELYGGITXXXXXXXXXXXXQAETIAFIIDDFL 1336
            EFIALNDSAFHRCSFLLLPHIQESLLYHELYGGIT            QAETIAFIIDDFL
Sbjct: 1277 EFIALNDSAFHRCSFLLLPHIQESLLYHELYGGITPSSSVPPLPIPVQAETIAFIIDDFL 1336

Query: 1337 GPFGINSTELLGSISTSTPIHXXXXXXXXXXXXVIHPIESMQSHLVPSQSVTHGNYIIDI 1396
            GPFGINSTELLGSISTSTPIH            VIHPIESMQSHLVPSQSVTHGNYIIDI
Sbjct: 1337 GPFGINSTELLGSISTSTPIHSSNKPLKPPSSSVIHPIESMQSHLVPSQSVTHGNYIIDI 1396

Query: 1397 SYITLDINPLFFTYASNFLDEFYSENIIETIDGIEMAIVNRLGTKSEELDSVTNIKLQIK 1456
            SYITLDINPLFFTYASNFLDEFYSENIIETIDGIEMAIVNRLGTKSEELDSVTNIKLQIK
Sbjct: 1397 SYITLDINPLFFTYASNFLDEFYSENIIETIDGIEMAIVNRLGTKSEELDSVTNIKLQIK 1456

Query: 1457 YLDFFFGQRNTEGLELYVDQIDLEVSQKTFQKKSTVVLDEIAILSRFLSLRASINEKKVL 1516
            YLDFFFGQRNTEGLELYVDQIDLEVSQKTFQKKSTVVLDEIAILSRFLSLRASINEKKVL
Sbjct: 1457 YLDFFFGQRNTEGLELYVDQIDLEVSQKTFQKKSTVVLDEIAILSRFLSLRASINEKKVL 1516

Query: 1517 EDFDERPPALSLALEGWEGWSSTASSQVNSLNISSTDITVDESQIEWLIDYLNRLVVFVH 1576
            EDFDERPPALSLALEGWEGWSSTASSQVNSLNISSTDITVDESQIEWLIDYLNRLVVFVH
Sbjct: 1517 EDFDERPPALSLALEGWEGWSSTASSQVNSLNISSTDITVDESQIEWLIDYLNRLVVFVH 1576

Query: 1577 ELVNSLDSIQKKSNGIQKKLVSDLTLASEYYQISHDPYVITKPAYVMRVSKGHVRQNRSW 1636
            ELVNSLDSIQKKSNGIQKKLVSDLTLASEYYQISHDPYVITKPAYVMRVSKGHVRQNRSW
Sbjct: 1577 ELVNSLDSIQKKSNGIQKKLVSDLTLASEYYQISHDPYVITKPAYVMRVSKGHVRQNRSW 1636

Query: 1637 RIVTRLRHIYTYLPDDWEIHVQEEMRGKDMNDVSDSSDIFLTVFSNWRNWEVSDVARSYI 1696
            RIVTRLRHIYTYLPDDWEIHVQEEMRGKDMNDVSDSSDIFLTVFSNWRNWEVSDVARSYI
Sbjct: 1637 RIVTRLRHIYTYLPDDWEIHVQEEMRGKDMNDVSDSSDIFLTVFSNWRNWEVSDVARSYI 1696

Query: 1697 YKKIFLSNDETTSEKKLQTTVKLNLNSIFFTIYSTGYAIDHNIILTKAVILLELTTETAV 1756
            YKKIFLSNDETTSEKKLQTTVKLNLNSIFFTIYSTGYAIDHNIILTKAVILLELTTETAV
Sbjct: 1697 YKKIFLSNDETTSEKKLQTTVKLNLNSIFFTIYSTGYAIDHNIILTKAVILLELTTETAV 1756

Query: 1757 SPPIEKSILNMTGSLGSIKGEFSDKFLRLLELIPDFSKEEDIKSLTENSSIVSEKSPYFT 1816
            SPPIEKSILNMTGSLGSIKGEFSDKFLRLLELIPDFSKEEDIKSLTENSSIVSEKSPYFT
Sbjct: 1757 SPPIEKSILNMTGSLGSIKGEFSDKFLRLLELIPDFSKEEDIKSLTENSSIVSEKSPYFT 1816

Query: 1817 IHLFLLFENGGLQLTMGDTTLSNNVTDGKISAXXXXXXXXXXXXXXGAYYMKKSEMCLKH 1876
            IHLFLLFENGGLQLTMGDTTLSNNVTDGKISA              GAYYMKKSEMCLKH
Sbjct: 1817 IHLFLLFENGGLQLTMGDTTLSNNVTDGKISALLEKSSYSKEFSYSGAYYMKKSEMCLKH 1876

Query: 1877 NKDIIAEFQLHHLGLISTGIYTPICPVILINLRSADLHFKSLASTEKIVKTIEDITEYSV 1936
            NKDIIAEFQLHHLGLISTGIYTPICPVILINLRSADLHFKSLASTEKIVKTIEDITEYSV
Sbjct: 1877 NKDIIAEFQLHHLGLISTGIYTPICPVILINLRSADLHFKSLASTEKIVKTIEDITEYSV 1936

Query: 1937 HLYKHYDLRKYTTKPTKVDQKPEKINFDVRVACNLSKVSAELTLISPFYLRYETKQLDLY 1996
            HLYKHYDLRKYTTKPTKVDQKPEKINFDVRVACNLSKVSAELTLISPFYLRYETKQLDLY
Sbjct: 1937 HLYKHYDLRKYTTKPTKVDQKPEKINFDVRVACNLSKVSAELTLISPFYLRYETKQLDLY 1996

Query: 1997 FNQNGDGEILLSLWDTDIFVTSHHTKEQYFRFSYDDIQINCNPMSEXXXXXXXXXXXXXX 2056
            FNQNGDGEILLSLWDTDIFVTSHHTKEQYFRFSYDDIQINCNPMSE              
Sbjct: 1997 FNQNGDGEILLSLWDTDIFVTSHHTKEQYFRFSYDDIQINCNPMSEKNKVLVVSLSASLV 2056

Query: 2057 XXTFSEPRRIFASFLQDERITIESFQELKKLKKIFFSNAKNVKKLNNDVPKEDTPTKWAL 2116
              TFSEPRRIFASFLQDERITIESFQELKKLKKIFFSNAKNVKKLNNDVPKEDTPTKWAL
Sbjct: 2057 KLTFSEPRRIFASFLQDERITIESFQELKKLKKIFFSNAKNVKKLNNDVPKEDTPTKWAL 2116

Query: 2117 ELNINYFGILLPIASTFFVLELHMLLGSLTNTTEEIQEVNNQISGQISLENILFLINDRS 2176
            ELNINYFGILLPIASTFFVLELHMLLGSLTNTTEEIQEVNNQISGQISLENILFLINDRS
Sbjct: 2117 ELNINYFGILLPIASTFFVLELHMLLGSLTNTTEEIQEVNNQISGQISLENILFLINDRS 2176

Query: 2177 LPLRLSKLVDFSIRISTLQKTTSSYESLQIESSHFRMCFSPESLVFVLWGVKQLQNELEY 2236
            LPLRLSKLVDFSIRISTLQKTTSSYESLQIESSHFRMCFSPESLVFVLWGVKQLQNELEY
Sbjct: 2177 LPLRLSKLVDFSIRISTLQKTTSSYESLQIESSHFRMCFSPESLVFVLWGVKQLQNELEY 2236

Query: 2237 YKDHKTKRQWNLXXXXXXXXXXXXXXPLNYFRSIHILSYNFCIGWMLPENQKDIPGWMFG 2296
            YKDHKTKRQWNL              PLNYFRSIHILSYNFCIGWMLPENQKDIPGWMFG
Sbjct: 2237 YKDHKTKRQWNLSSHKTGTKSSTSESPLNYFRSIHILSYNFCIGWMLPENQKDIPGWMFG 2296

Query: 2297 YDRLFSAYEKNYGKLTLIEGYMSVTNSNSSNDFFSQGEEKNRHNRSFLPSMQILYWLKEF 2356
            YDRLFSAYEKNYGKLTLIEGYMSVTNSNSSNDFFSQGEEKNRHNRSFLPSMQILYWLKEF
Sbjct: 2297 YDRLFSAYEKNYGKLTLIEGYMSVTNSNSSNDFFSQGEEKNRHNRSFLPSMQILYWLKEF 2356

Query: 2357 NSKKDLFIRLHGDALDVDILSNFVNIIELIFKSYQIFEDFRKSKIVQNIEKQKHHEHIKS 2416
            NSKKDLFIRLHGDALDVDILSNFVNIIELIFKSYQIFEDFRKSKIVQNIEKQKHHEHIKS
Sbjct: 2357 NSKKDLFIRLHGDALDVDILSNFVNIIELIFKSYQIFEDFRKSKIVQNIEKQKHHEHIKS 2416

Query: 2417 ENATEFVPTFLSDINSINCEFKYEGGTLRVFSVDDVEIDSTPSLELNAPKVSIYLNYKHF 2476
            ENATEFVPTFLSDINSINCEFKYEGGTLRVFSVDDVEIDSTPSLELNAPKVSIYLNYKHF
Sbjct: 2417 ENATEFVPTFLSDINSINCEFKYEGGTLRVFSVDDVEIDSTPSLELNAPKVSIYLNYKHF 2476

Query: 2477 DDSPKPHWLRCVIDIHSSHNILYSKCAPFVIEFVESIQEILENRPVEPKQSVSKIATPNR 2536
            DDSPKPHWLRCVIDIHSSHNILYSKCAPFVIEFVESIQEILENRPVEPKQSVSKIATPNR
Sbjct: 2477 DDSPKPHWLRCVIDIHSSHNILYSKCAPFVIEFVESIQEILENRPVEPKQSVSKIATPNR 2536

Query: 2537 TYKRILAPFDIAFRIKAAKQMLSFSCEPSAKVQANVGLDSFLFGISTGGSSVEDPLSLTL 2596
            TYKRILAPFDIAFRIKAAKQMLSFSCEPSAKVQANVGLDSFLFGISTGGSSVEDPLSLTL
Sbjct: 2537 TYKRILAPFDIAFRIKAAKQMLSFSCEPSAKVQANVGLDSFLFGISTGGSSVEDPLSLTL 2596

Query: 2597 CINKISTSVQHIFSKEASASFSLNFIDLTFIFTQPTLYCVGLISDIDIFFNMKQQQNLLL 2656
            CINKISTSVQHIFSKEASASFSLNFIDLTFIFTQPTLYCVGLISDIDIFFNMKQQQNLLL
Sbjct: 2597 CINKISTSVQHIFSKEASASFSLNFIDLTFIFTQPTLYCVGLISDIDIFFNMKQQQNLLL 2656

Query: 2657 FLDIWHLSESIGIRPNXXXXXXXXXXGHTQIPETPQPGKIIPWNFNIIFTNVNADIHLGP 2716
            FLDIWHLSESIGIRPN          GHTQIPETPQPGKIIPWNFNIIFTNVNADIHLGP
Sbjct: 2657 FLDIWHLSESIGIRPNRKKRKHKKHKGHTQIPETPQPGKIIPWNFNIIFTNVNADIHLGP 2716

Query: 2717 ALGIVSAKLEKTWFISDRYLDKRQILQLFTDGMVLKSRGRLSGMLDISNAGWRLEVNYAD 2776
            ALGIVSAKLEKTWFISDRYLDKRQILQLFTDGMVLKSRGRLSGMLDISNAGWRLEVNYAD
Sbjct: 2717 ALGIVSAKLEKTWFISDRYLDKRQILQLFTDGMVLKSRGRLSGMLDISNAGWRLEVNYAD 2776

Query: 2777 NELNYNSPIVAIGIDIGCVALKTAFDYHMFMISKVNNIHFRLHSERDPEGKLPDXXXXXX 2836
            NELNYNSPIVAIGIDIGCVALKTAFDYHMFMISKVNNIHFRLHSERDPEGKLPD      
Sbjct: 2777 NELNYNSPIVAIGIDIGCVALKTAFDYHMFMISKVNNIHFRLHSERDPEGKLPDLLLTTL 2836

Query: 2837 XCEEISICSTTLVASNILDIYNTIIRTRQDTKNSYFETLMESNNQDTRTNIPYSDILKSL 2896
             CEEISICSTTLVASNILDIYNTIIRTRQDTKNSYFETLMESNNQDTRTNIPYSDILKSL
Sbjct: 2837 LCEEISICSTTLVASNILDIYNTIIRTRQDTKNSYFETLMESNNQDTRTNIPYSDILKSL 2896

Query: 2897 NLLRTDVQIDVSKLQLQISPISLFDFEVLVINIDNMSARSETTSTDKLKTRLELQVCNAS 2956
            NLLRTDVQIDVSKLQLQISPISLFDFEVLVINIDNMSARSETTSTDKLKTRLELQVCNAS
Sbjct: 2897 NLLRTDVQIDVSKLQLQISPISLFDFEVLVINIDNMSARSETTSTDKLKTRLELQVCNAS 2956

Query: 2957 VALSTAKEELDEESVNKISVADYMTYASKIKGGTILIIPKLLVGMTTWQKVTSNTIEYTF 3016
            VALSTAKEELDEESVNKISVADYMTYASKIKGGTILIIPKLLVGMTTWQKVTSNTIEYTF
Sbjct: 2957 VALSTAKEELDEESVNKISVADYMTYASKIKGGTILIIPKLLVGMTTWQKVTSNTIEYTF 3016

Query: 3017 TCKFDGKVSVRWNLGPVNFIKEMWATHVKSLAVRQARXXXXXXXXXXXXXXXXXXXXXXP 3076
            TCKFDGKVSVRWNLGPVNFIKEMWATHVKSLAVRQAR                      P
Sbjct: 3017 TCKFDGKVSVRWNLGPVNFIKEMWATHVKSLAVRQARIEEPVEYSSEELESSPESIYLEP 3076

Query: 3077 AQPKFTYVALVEPSIEMPQIKDLEDATPPMEWFGLNRKKFPSFTHQTAVIVVQKLVHAVE 3136
            AQPKFTYVALVEPSIEMPQIKDLEDATPPMEWFGLNRKKFPSFTHQTAVIVVQKLVHAVE
Sbjct: 3077 AQPKFTYVALVEPSIEMPQIKDLEDATPPMEWFGLNRKKFPSFTHQTAVIVVQKLVHAVE 3136

Query: 3137 KEYAKIIGHSEQ 3148
            KEYAKIIGHSEQ
Sbjct: 3137 KEYAKIIGHSEQ 3148

 Score =  860 bits (2221), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 419/493 (84%), Positives = 419/493 (84%)

Query: 1   MVDEPKFVSVSLSREKYFSWVFLVTWILTCILCLLMFFYIDRVFAYSLTFILDWLLWRPY 60
           MVDEPKFVSVSLSREKYFSWVFLVTWILTCILCLLMFFYIDRVFAYSLTFILDWLLWRPY
Sbjct: 1   MVDEPKFVSVSLSREKYFSWVFLVTWILTCILCLLMFFYIDRVFAYSLTFILDWLLWRPY 60

Query: 61  KVKIHCEXXXXXXXXXXXXFKNLCIITENSTISILEGKIIWQYWLLNTRVSAYELHQQQK 120
           KVKIHCE            FKNLCIITENSTISILEGKIIWQYWLLNTRVSAYELHQQQK
Sbjct: 61  KVKIHCESIRLSLLSARISFKNLCIITENSTISILEGKIIWQYWLLNTRVSAYELHQQQK 120

Query: 121 EHGYITPGSGFKNIQLPCKFLFQCEGAEIFVYNKTSAYENIIDSFSPDEKIKYKEFLHKH 180
           EHGYITPGSGFKNIQLPCKFLFQCEGAEIFVYNKTSAYENIIDSFSPDEKIKYKEFLHKH
Sbjct: 121 EHGYITPGSGFKNIQLPCKFLFQCEGAEIFVYNKTSAYENIIDSFSPDEKIKYKEFLHKH 180

Query: 181 FRFSKDDTPIERPDIFDSKTMKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 240
           FRFSKDDTPIERPDIFDSKTMK                                      
Sbjct: 181 FRFSKDDTPIERPDIFDSKTMKNTDFNPTTNNNDKNNNDTHMHSQHNHQHHTTGSSTTTA 240

Query: 241 XXXXXXXXINDNNFDKLRNEELSSXXXXXXXXXXXXXXXXQKLSIIQRLQVMYEEFQLNF 300
                   INDNNFDKLRNEELSS                QKLSIIQRLQVMYEEFQLNF
Sbjct: 241 STSMATSTINDNNFDKLRNEELSSKIDKPPIIKKKEVKRPQKLSIIQRLQVMYEEFQLNF 300

Query: 301 YPFGLKLTKGSIIFGNKFTPSLLIISYKSAEGIVDVLPATNPRVDLYKMKMKLDFQNFEI 360
           YPFGLKLTKGSIIFGNKFTPSLLIISYKSAEGIVDVLPATNPRVDLYKMKMKLDFQNFEI
Sbjct: 301 YPFGLKLTKGSIIFGNKFTPSLLIISYKSAEGIVDVLPATNPRVDLYKMKMKLDFQNFEI 360

Query: 361 EVKPNISYEDDSKPKAFYCDSMLSRLWTKFSTLFDIMPNPLSRYIHFSRLHKNSLFLEDN 420
           EVKPNISYEDDSKPKAFYCDSMLSRLWTKFSTLFDIMPNPLSRYIHFSRLHKNSLFLEDN
Sbjct: 361 EVKPNISYEDDSKPKAFYCDSMLSRLWTKFSTLFDIMPNPLSRYIHFSRLHKNSLFLEDN 420

Query: 421 IFEDEDFEKKWKGLSLYKDAALNRGNPEEHIEFDFLNHEYARYCSIVKAPRLIFTNEYDI 480
           IFEDEDFEKKWKGLSLYKDAALNRGNPEEHIEFDFLNHEYARYCSIVKAPRLIFTNEYDI
Sbjct: 421 IFEDEDFEKKWKGLSLYKDAALNRGNPEEHIEFDFLNHEYARYCSIVKAPRLIFTNEYDI 480

Query: 481 PGIVPYPEDYETH 493
           PGIVPYPEDYETH
Sbjct: 481 PGIVPYPEDYETH 493

>Smik_12.146 Chr12 complement(286690..295566) [8877 bp, 2958 aa] {ON}
            YLR087C (REAL)
          Length = 2958

 Score = 2352 bits (6095), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1183/2579 (45%), Positives = 1668/2579 (64%), Gaps = 64/2579 (2%)

Query: 590  NISAPPESNMEFQLFDASINYGPWAHRNIMNIQRIFSPIVSRTPELQPDPEPGFLRRYTM 649
            N  APP+  ++ Q+   SI YGPWA R + ++QR+ SP+VSRT +      PG  R YT+
Sbjct: 415  NNGAPPDFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRTAKPIKKLPPGSRRVYTL 474

Query: 650  TKISVSIMEDSSWRVPTREPSKDQDFLKRYMKTNDSSRSFGWFDLNFSRNSEATFCISSI 709
             ++++SI ED++WR+PTRE SKD +FL+ Y +T++  R FGW DL F +++ A F IS  
Sbjct: 475  FRMNISITEDTTWRIPTRETSKDAEFLQHYKETSEEYRPFGWMDLRFCKDTYANFNISVC 534

Query: 710  PDVNGYANKLNLDFKDLEVRSSVNHDIFFRSKSYRVDSDIGYPLGWNDEVTWSFVFDSYQ 769
            P V G+ N  ++ F + E+RSSVNHDI  +SK + +D DIGYPLGWN +  W     S Q
Sbjct: 535  PTVEGFQNNFHVHFVETEIRSSVNHDILLKSKVFNIDGDIGYPLGWNSKAIWIINMKSEQ 594

Query: 770  LETFFLREHLVLIADTFSDFSSGEPTPYEFFRPSIYKVDWNFHGYSAYLNVNDHNIINNP 829
            LE F LREH+ L+ADT SDFS+G+PTPYE FRP +YKV+W   GYS YLNVNDHNI+NNP
Sbjct: 595  LEAFLLREHITLVADTLSDFSAGDPTPYELFRPFVYKVNWEMEGYSIYLNVNDHNIVNNP 654

Query: 830  LDFNENCYISVHGDDAHIGVEIPRLGITATYTDIIFQISTPMFRXXXXXXXXXXXXEFMR 889
            LDFNENCY+S+HGD   I V +PR  I  TYTDI ++ISTPMFR            EFM+
Sbjct: 655  LDFNENCYLSLHGDKLAIDVTVPRESILGTYTDISYEISTPMFRMMLNTPPWNTLNEFMK 714

Query: 890  NKEIGRGYDFTAEGSYIIYSDLDIDNVDSLTIECSTRRMTLLTYGFVIGYLLNVQMNYFG 949
            +KE+GR YDFT +G+Y++YS+LDIDNVD+L IEC++    L  YGFV+ YL NV+MNYFG
Sbjct: 715  HKEVGRAYDFTIKGTYLLYSELDIDNVDTLVIECTSNSTVLHCYGFVMRYLTNVKMNYFG 774

Query: 950  EFSHFITAEEYTDIVRGNDNDIVSTLADFXXXXXXXXXXXXXXXQHNPDNSSKSNIIDPL 1009
            EF +F+T+EEYT ++   D   V+T +                      NSS  N  +  
Sbjct: 775  EFFNFVTSEEYTGVLGARDVGDVTTKSSVVDLASTVDSGY--------QNSSVKN--NSE 824

Query: 1010 YNPPLRKDDIKRKVNETDIWFTFSVWEGALLLPEVLYNSDPCIALSFKELIIDFRNCDYY 1069
               P+++ D+KR  NETDIWFTFSVW GAL+LPE +Y+ DPCIAL F EL++DFR+C+YY
Sbjct: 825  AKGPMKRSDLKRTTNETDIWFTFSVWNGALILPETIYSFDPCIALHFSELVVDFRSCNYY 884

Query: 1070 LDLLATLNGTSFKRCIRKNQNDIFELVHNNAIKNLEEHGSVSNISIHGHRMYGAPPTSPS 1129
            +D++A L+GTS KR + K  N++F+ +  N   + +EHGS+S+++IHGHRMYG PPT P+
Sbjct: 885  MDIMAVLDGTSIKRHVSKQINEVFDFIRRNNGADEQEHGSLSDLTIHGHRMYGLPPTEPT 944

Query: 1130 YFSDWAVDVNNLSINSDIYFIRGFISYITKVGFEFSNLQNILLYDESVLDNMTSVTVHGT 1189
            YF  W +++ +LSI+SD+ FI+GF S   K+GF +++L+NILLYD   +D+MTS+TVH  
Sbjct: 945  YFCQWDINLGDLSIDSDVEFIKGFFSSFYKIGFGYNDLENILLYDTETIDDMTSLTVHAE 1004

Query: 1190 GIDILVADKSTSAQVLLNMDGITFNRINFANDRYSSRIDLQVPGLHFAF-FDNGSSMDKT 1248
             I I + D    +Q +++ + I F  I+F N+ YS RID++VP L  +     G  +D +
Sbjct: 1005 RIRISLEDPVMKSQSVISAESILFTLIDFENENYSQRIDVKVPKLKISLNCVMGDGVDMS 1064

Query: 1249 CLFEFKTKINFTNFTQMKDGELHSKKQQEFIALNDSAFHRCSFLLLPHIQESLLYHELYG 1308
             L +F+TK+ FTNF Q KD +    +Q+++I  +DS +HRCSFLL    Q+S  Y +LYG
Sbjct: 1065 FL-KFETKLRFTNFEQYKDIDKKRSEQRKYITFHDSPYHRCSFLLPLFYQDSDTYQKLYG 1123

Query: 1309 GITXXXXXXXXXXXXQAETIAFIIDDFLGPFG--INSTELLGSISTSTPIHXXXXXXXXX 1366
             I               +TI FII+D +G +   + +          TP           
Sbjct: 1124 AIAPSSSIPTLPLPTLPDTIDFIIEDIVGEYATLLEAANPFKDSFAETPSTVEPSKASFT 1183

Query: 1367 XXXVIHPIESMQSHLVPSQSVTHG-----NYIIDISYITLDINPLFFTYASNFLDEFYSE 1421
                 +  E+  S   P      G     NY++D+SYI LDI+PL F +  + L++ YSE
Sbjct: 1184 EDD--NDEEASSSGFKPGAFTEDGDDEKDNYVVDVSYILLDIDPLLFVFTKSLLEQLYSE 1241

Query: 1422 NIIETIDGIEMAIVNRLGTKSEELDSVTNIKLQIKYLDFFFGQRNTEGLELYVDQIDLEV 1481
            N+++ +D IE+ IV RL    E + S++NI + I YL+  + +   EG ELY+D+ID ++
Sbjct: 1242 NMVQVLDDIEIGIVKRLSNLQEGITSISNIDIHIAYLNLIWQETGEEGFELYLDRIDYQM 1301

Query: 1482 SQKTFQKKSTVVLDEIAILSRFLSLRASINEKKVLEDFDERPPALSLALEGWEGWSSTAS 1541
             +K+ +K  T  L E+A L+R  ++R ++N+KK  +  ++RPPALSL LEG+E WSST  
Sbjct: 1302 REKSLEKNRTTKLLEVAALARVKTVRVTVNQKKNPDLSEDRPPALSLGLEGFEIWSSTEG 1361

Query: 1542 SQVNSLNISSTDITVDESQIEWLIDYLNRLVVFVHELVNSLDSIQKKSNGIQKKLVSDLT 1601
             QVNSLN++S+DIT+DESQ+EWL  Y +     + E+  S  SIQ      + +L+S+LT
Sbjct: 1362 RQVNSLNLTSSDITIDESQMEWLFQYCSDQANLLQEVATSFHSIQDTRTSSKTELISELT 1421

Query: 1602 LASEYYQISHDPYVITKPAYVMRVSKGHVRQNRSWRIVTRLRHIYTYLPDDWEIHVQEEM 1661
             ASEYYQISHDPYVITKPA++MR+SKGHVR+NRSW+I+TRLRHI TYLPDDW+ ++ + +
Sbjct: 1422 AASEYYQISHDPYVITKPAFIMRLSKGHVRENRSWKIITRLRHILTYLPDDWQNNIDKVL 1481

Query: 1662 RGKDMNDVSDSSDIFLTVFSNWRNWEVSDVARSYIYKKIFLSNDETTSEKKLQTTVKLNL 1721
            + +     +D+ +IF++VFS WRNWE SDVARSYIY K+F +++E   +  ++  +K  +
Sbjct: 1482 KERKYTSANDAKNIFMSVFSTWRNWEFSDVARSYIYGKLFSTDNEKHKQNLIKKLLKCTM 1541

Query: 1722 NSIFFTIYSTGYAIDHNIILTKAVILLELTTETAVSPPIEKSILN------MTGSLGSIK 1775
             S + T+Y  GY ++HN ++  A ++++LT      PP+    LN      +TG +GS+K
Sbjct: 1542 GSFYLTVYGEGYEVEHNFVVADANLVVDLT------PPVTSLSLNREETIEITGRIGSVK 1595

Query: 1776 GEFSDKFLRLLELIPDFSK-EEDIKSLTENSSIVSEKSPYFTIHLFLLFENGGLQLTMGD 1834
            G+FSD+ L+L +LIP  +   ED KS  +     +E S  F ++  LL +   LQL M +
Sbjct: 1596 GKFSDRLLKLQDLIPLVAAVGEDDKSDPK-----TELSKQFRMNTVLLVDKSELQLVMDE 1650

Query: 1835 TTLSNNVTDGKISAXXXXXXXXXXXXXXGAYYMKKSEMCLKHNKDIIAEFQLHHLGLIST 1894
            T L +    G++S                  + +KSE+ LKH   I+ E QL    +++T
Sbjct: 1651 TKLMSRTVGGRVSLLWENLKDSTSQAGSVVIFSQKSEVWLKHASIILGEAQLRDFSILAT 1710

Query: 1895 GIYTPICPVILINLRSADLHFKSLASTEKIVKTIEDITEYSVHLYKHYDLRKYTTKPTK- 1953
                   P ILIN + ADLHF++++STE+ V  I +I E ++ + +    +  + K ++ 
Sbjct: 1711 TEAWSHKPTILINNQCADLHFRAMSSTEQTVTAITEIRESALKIKERIKFKPKSKKKSQF 1770

Query: 1954 VDQKPEKINFDVRVACNLSKVSAELTLISPFYLRYETKQLDLYFNQNGDGEILLSLWDTD 2013
            V QK   +     + C  S VS+E+  +SPFY+R+E KQLD+YFN+ G  EIL+S+WDTD
Sbjct: 1771 VGQKINTV-----LTCYFSNVSSEIMPLSPFYIRHEAKQLDIYFNKFGSNEILISIWDTD 1825

Query: 2014 IFVTSHHTKEQYFRFSYDDIQINCNPMSEXXXXXXXXXXXXXXXXTFSEPRRIFASFLQD 2073
             F+TSH TKEQY RFS+ DI+I      E                TFSEPRRI  SFLQD
Sbjct: 1826 FFMTSHQTKEQYLRFSFGDIEIKGGVSKEGYSLINVDISISMIKLTFSEPRRIVNSFLQD 1885

Query: 2074 ERITIESFQELKKLKKIFFSNAKNVKKLNNDVPKEDTPTKWALELNINYFGILLPIASTF 2133
            E++  +    L  LK +FFS+  N+ K    VP       W L+ +I+YFGIL+P+AST+
Sbjct: 1886 EKLASQGINLLCSLKSLFFSS--NIPKKEKQVPA--LMINWTLDTSISYFGILIPVASTY 1941

Query: 2134 FVLELHMLLGSLTNTTEEIQEVNNQISGQISLENILFLINDRSLPLRLSKLVDFSIRIST 2193
            FV ELHMLL SLTNT   +     +++GQ S+ENILFLI +RSLP+ LSK++DFSI++ST
Sbjct: 1942 FVFELHMLLLSLTNTNNGMLPEETKVTGQFSIENILFLIKERSLPIGLSKVLDFSIKVST 2001

Query: 2194 LQKTTSSYESLQIESSHFRMCFSPESLVFVLWGVKQLQNELEYYKDHKTKRQWNLXXXXX 2253
            LQ+T  + +S Q+ESSHFR+C SP+SL+ ++WG  +L +   YY  H     WN+     
Sbjct: 2002 LQRTIDTEQSFQVESSHFRVCLSPDSLLRLMWGAHKLLDLGHYYTKHHAPNIWNIKMFTG 2061

Query: 2254 XXXXXXXXXPLNYFRSIHILSYNFCIGWMLPENQKDIPGWMFGYDRLFSAYEKNYGKLTL 2313
                     PLN FRSIHILSY FCIGW+        PG M GY+RLFSAYE+++GK T+
Sbjct: 2062 KSDKPKEI-PLN-FRSIHILSYKFCIGWLFQYGTGSDPGLMLGYNRLFSAYERDFGKFTV 2119

Query: 2314 IEGYMSVTNSNSSNDFFSQGEEKNRHNRSFLPSMQILYWLKEFNSKKDLFIRLHGDALDV 2373
            ++ + SV N N+S+ FFS+G EK+++NRSFLP+MQI YW K     KD F R HG+ALDV
Sbjct: 2120 VDSFFSVANGNTSSTFFSEGNEKDKYNRSFLPNMQISYWFKRCGELKDWFFRFHGEALDV 2179

Query: 2374 DILSNFVNIIELIFKSYQIFEDFRKSKIVQNIEKQKHHE--HIKSENATEFVPT----FL 2427
            + + +F+++I+   +S + F++ +++  + ++ +  H E  +I + ++ E  P+    FL
Sbjct: 2180 NFVPSFMDVIDSTLQSMRAFQELKRN--ILDVSENSHSEDSNIYAASSVENAPSSLAPFL 2237

Query: 2428 SDINSINCEFKYEGGTLRVFSVDDVEIDSTPSLELNAPKVSIYLNYKHFDDSPKPHWLRC 2487
            ++I S+N  FKY+GG  RV++ +D+E  S PS E+ +P V+I   YKH +D  +PH +R 
Sbjct: 2238 NNIRSVNSNFKYDGGVFRVYTYEDIEAKSEPSFEIKSPVVTINCTYKHDEDKVRPHKIRT 2297

Query: 2488 VIDIHSSHNILYSKCAPFVIEFVESIQEILENRPVEPKQSVSKIATPNRTYKRILAPFDI 2547
            +I +  +HN LY+ CAP ++EF ES+Q++++    + K + +K +  N  YKR+L  FD+
Sbjct: 2298 LITVDPTHNTLYAGCAPLLMEFSESLQKMIKKHSTDEKPNFTKPSPQNVDYKRLLDQFDV 2357

Query: 2548 AFRIKAAKQMLSFSCEPSAKVQANVGLDSFLFGISTGGSSVEDPLSLTLCINKISTSVQH 2607
            A ++ +AKQ LS SCEP AKVQA+VG +SFLF ++T     E PL  +L +     S++H
Sbjct: 2358 AVKLTSAKQQLSLSCEPKAKVQADVGFESFLFSVTTNEFDSEHPLEFSLTLEHTKASIKH 2417

Query: 2608 IFSKEASASFSLNFIDLTFIFTQP---TLYCVGLISDIDIFFNMKQQQNLLLFLDIWHLS 2664
            IFS+E S SF + F+DLT +FT P   ++Y +GL+SD+++FFN+KQ QNL LFLDIW  S
Sbjct: 2418 IFSREVSTSFEVGFMDLTILFTHPDVISMYGIGLVSDLNVFFNVKQLQNLYLFLDIWRFS 2477

Query: 2665 ESIGIRPNXXXXXXXXXXGHTQIPETPQPGKIIPWNFNIIFTNVNADIHLGPALGIVSAK 2724
              +  RP                      G  IPW F +IFTNV+ D+ LGP+LG++S +
Sbjct: 2478 SILHTRPAQRSVNKGIDMHSLTSTSHVDLGTEIPWCFTLIFTNVSGDVDLGPSLGVISLR 2537

Query: 2725 LEKTWFISDRYLDKRQILQLFTDGMVLKSRGRLSGMLDISNAGWRLEVNYADNELNYNSP 2784
             ++TW  +D Y +KRQ+L  FTDG+ L S GRLSG+ +++NA W  EV ++  +     P
Sbjct: 2538 TQRTWLATDHYDEKRQLLHAFTDGISLTSEGRLSGLFEVANASWLSEVKWSPEKGKNTHP 2597

Query: 2785 IVAIGIDIGCVALKTAFDYHMFMISKVNNIHFRLHSERDPEGKLPDXXXXXXXCEEISIC 2844
            +V+  ++I  +A+K AFDYHMF+I  +NNIHF+LH+E+D +G LPD        +EI + 
Sbjct: 2598 LVSTSLNIDDMAIKAAFDYHMFLIGTINNIHFQLHNEKDAKGVLPDLLQVSFSSDEIILS 2657

Query: 2845 STTLVASNILDIYNTIIRTRQDTKNSYFETLMESNNQDTRTNIPYSDILKSLNLLRTDVQ 2904
            ST LVA+NILDIYNTI+R RQD K SY ETL +SN  ++R  + Y DIL+SL LLRTD+ 
Sbjct: 2658 STALVAANILDIYNTIVRMRQDNKISYMETLRDSNPGESRQPVLYKDILRSLKLLRTDLS 2717

Query: 2905 IDVSKLQLQISPISLFDFEVLVINIDNMSARSETTSTDKLKTRLELQVCNASVALSTAKE 2964
            + +S L++QISPISLFD EVLV+ ID +S RSET S  KLKT L+LQV + S ALST+KE
Sbjct: 2718 VSISSLKVQISPISLFDVEVLVVRIDKVSIRSETHSGKKLKTDLQLQVLDVSAALSTSKE 2777

Query: 2965 ELDEESVNKISVADYMTYASKIKGGTILIIPKLLVGMTTWQKVTSNTIEYTFTCKFDGKV 3024
            ELDEE    I++ DYM YASKI GGTI+ IPKL V MTT Q+  +N +EY F C F  K+
Sbjct: 2778 ELDEEVGASIAIDDYMHYASKIVGGTIIDIPKLAVHMTTLQEEKTNNLEYLFACSFSDKI 2837

Query: 3025 SVRWNLGPVNFIKEMWATHVKSLAVRQARXXXXXXXXXXXXXXXXXXXXXXPAQPKFTYV 3084
            SVRWNLGPVNFIKEMW THVK+LAVR+++                       +  KF Y+
Sbjct: 2838 SVRWNLGPVNFIKEMWTTHVKALAVRRSQIANISFGQTEEELEESINKEETAS--KFNYI 2895

Query: 3085 ALVEPSIEMPQIKDLEDATPPMEWFGLNRKKFPSFTHQTAVIVVQKLVHAVEKEYAKII 3143
            AL EP IE+PQI+DL DATPPMEWFG+NRK+FP FTHQTAVI VQKLV+  EK+Y KI+
Sbjct: 2896 ALEEPQIEVPQIRDLGDATPPMEWFGVNRKRFPKFTHQTAVIPVQKLVYLAEKQYVKIL 2954

 Score =  170 bits (430), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 82/172 (47%), Positives = 115/172 (66%), Gaps = 9/172 (5%)

Query: 9   SVSLSREKYFSWVFLVTWILTCILCLLMFFYIDRVFAYSLTFILDWLLWRPYKVKIHCEX 68
            V L+ +K FSWVFLV WILT + CL M FY+ R++AY ++FIL+WLLW+  KVKI+ E 
Sbjct: 9   GVPLTHQKDFSWVFLVDWILTIVACLTMVFYMGRIYAYLVSFILEWLLWKRAKVKINVET 68

Query: 69  XXXXXXXXXXXFKNLCIITENSTISILEGKIIWQYWLLNTRVSAYELHQQQKEHGYITPG 128
                      FK+L +I ++ TISILEG I W+YWLLN R +  EL    K     +P 
Sbjct: 69  LRVSLLGGRIHFKHLSVIHKDYTISILEGSITWKYWLLNCRKA--ELIDNNK-----SPS 121

Query: 129 SGFKNIQLPCKFLFQCEGAEIFVYNKTSAYENIIDSFSPDEKIKYKEFLHKH 180
               N++LPCKF  +CEG EIF+YN+T AY+N+I+  S DE+ K++++L++H
Sbjct: 122 KN--NVKLPCKFCLECEGLEIFIYNRTVAYDNVINLLSKDERDKFEKYLNEH 171

 Score =  152 bits (384), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 80/190 (42%), Positives = 117/190 (61%), Gaps = 12/190 (6%)

Query: 298 LNFYPFGLKLTKGSIIFGNKFTPSLLIISYKSAEGIVDVLPATNPRVDLYKMKMKLDFQN 357
           L F P  L  ++GS++ GNKFTPS++I+SY+S EGIVDVLP    RVDLY+ K +++F+N
Sbjct: 221 LKFLPIELNFSRGSLLLGNKFTPSVMILSYESGEGIVDVLPPKE-RVDLYRNKTQMEFKN 279

Query: 358 FEIEVKPNISYEDDSKPKAFYCDSMLSRLWTKFSTLFDIMPNPLSRYIHFSRLHKNSLFL 417
           FEI +K NI Y+D    K       +S+LW  F  +  ++  P+       R  KN+   
Sbjct: 280 FEISIKQNIGYDDAIGLKFKLDTGKVSKLWKAFIRVLQLVSKPVVS----KRTKKNTRSS 335

Query: 418 EDNIFEDEDFEKKWKGLSLYK-DAALNRGNPEEHIEFDFLNHEYARYCSIVKAPRLIFTN 476
            D+      F +KWKGLSLYK  +   + N  + IEFD  NHEYA++ SI+K P++  + 
Sbjct: 336 NDS------FYQKWKGLSLYKATSGEAKANDLDDIEFDLTNHEYAKFTSILKCPKVTISY 389

Query: 477 EYDIPGIVPY 486
           + D+PG+VP+
Sbjct: 390 DVDVPGVVPH 399

>YLR087C Chr12 complement(306855..315731) [8877 bp, 2958 aa] {ON}
            CSF1Protein required for fermentation at low temperature;
            the authentic, non-tagged protein is detected in highly
            purified mitochondria in high-throughput studies
          Length = 2958

 Score = 2343 bits (6071), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1184/2581 (45%), Positives = 1658/2581 (64%), Gaps = 68/2581 (2%)

Query: 590  NISAPPESNMEFQLFDASINYGPWAHRNIMNIQRIFSPIVSRTPELQPDPEPGFLRRYTM 649
            N  APP+  ++ Q+   SI YGPWA R + ++QR+ SP+VSRT +      PG  R YT+
Sbjct: 415  NNGAPPDFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRTAKPIKKLPPGSRRIYTL 474

Query: 650  TKISVSIMEDSSWRVPTREPSKDQDFLKRYMKTNDSSRSFGWFDLNFSRNSEATFCISSI 709
             ++++SIMED++WR+PTRE SKD +FLK Y +TN+  R FGW DL F +++ A F IS  
Sbjct: 475  FRMNISIMEDTTWRIPTRESSKDPEFLKHYKETNEEYRPFGWMDLRFCKDTYANFNISVC 534

Query: 710  PDVNGYANKLNLDFKDLEVRSSVNHDIFFRSKSYRVDSDIGYPLGWNDEVTWSFVFDSYQ 769
            P V G+ N  ++ F + E+RSSVNHDI  +SK + +D DIGYPLGWN +  W     S Q
Sbjct: 535  PTVQGFQNNFHVHFLETEIRSSVNHDILLKSKVFDIDGDIGYPLGWNSKAIWIINMKSEQ 594

Query: 770  LETFFLREHLVLIADTFSDFSSGEPTPYEFFRPSIYKVDWNFHGYSAYLNVNDHNIINNP 829
            LE F LREH+ L+ADT SDFS+G+PTPYE FRP +YKV+W   GYS YLNVNDHNI+NNP
Sbjct: 595  LEAFLLREHITLVADTLSDFSAGDPTPYELFRPFVYKVNWEMEGYSIYLNVNDHNIVNNP 654

Query: 830  LDFNENCYISVHGDDAHIGVEIPRLGITATYTDIIFQISTPMFRXXXXXXXXXXXXEFMR 889
            LDFNENCY+S+HGD   I V +PR  I  TYTD+ ++ISTPMFR            EFM+
Sbjct: 655  LDFNENCYLSLHGDKLSIDVTVPRESILGTYTDMSYEISTPMFRMMLNTPPWNTLNEFMK 714

Query: 890  NKEIGRGYDFTAEGSYIIYSDLDIDNVDSLTIECSTRRMTLLTYGFVIGYLLNVQMNYFG 949
            +KE+GR YDFT +GSY++YS+LDIDNVD+L IEC+++   L  YGFV+ YL NV+MNYFG
Sbjct: 715  HKEVGRAYDFTIKGSYLLYSELDIDNVDTLVIECNSKSTVLHCYGFVMRYLTNVKMNYFG 774

Query: 950  EFSHFITAEEYTDIVRGND-NDIV--STLADFXXXXXXXXXXXXXXXQHNPDNSSKSNII 1006
            EF +F+T+EEYT ++   +  D+   S++AD                     NSS  N  
Sbjct: 775  EFFNFVTSEEYTGVLGAREVGDVTTKSSVADLASTVDSGY-----------QNSSLKN-- 821

Query: 1007 DPLYNPPLRKDDIKRKVNETDIWFTFSVWEGALLLPEVLYNSDPCIALSFKELIIDFRNC 1066
            +     P+++ D+KR  NETDIWFTFSVW+GAL+LPE +Y+ DPCIAL F EL++DFR+C
Sbjct: 822  ESEDKGPMKRSDLKRTTNETDIWFTFSVWDGALILPETIYSFDPCIALHFAELVVDFRSC 881

Query: 1067 DYYLDLLATLNGTSFKRCIRKNQNDIFELVHNNAIKNLEEHGSVSNISIHGHRMYGAPPT 1126
            +YY+D++A LNGTS KR + K  N++F+ +  N   + +EHG +S+++IHGHRMYG PPT
Sbjct: 882  NYYMDIMAVLNGTSIKRHVSKQINEVFDFIRRNNGADEQEHGLLSDLTIHGHRMYGLPPT 941

Query: 1127 SPSYFSDWAVDVNNLSINSDIYFIRGFISYITKVGFEFSNLQNILLYDESVLDNMTSVTV 1186
             P+YF  W +++ +L I+SDI FI+GF +   K+GF +++L+NILLYD   +++MTS+TV
Sbjct: 942  EPTYFCQWDINLGDLCIDSDIEFIKGFFNSFYKIGFGYNDLENILLYDTETINDMTSLTV 1001

Query: 1187 HGTGIDILVADKSTSAQVLLNMDGITFNRINFANDRYSSRIDLQVPGLHFAF-FDNGSSM 1245
            H   I I + D    +Q +++ + I F  I+F N++YS RID+++P L  +     G  +
Sbjct: 1002 HVEKIRIGLKDPVMKSQSVISAESILFTLIDFENEKYSQRIDVKIPKLTISLNCVMGDGV 1061

Query: 1246 DKTCLFEFKTKINFTNFTQMKDGELHSKKQQEFIALNDSAFHRCSFLLLPHIQESLLYHE 1305
            D T   +F+TK+ FTNF Q KD +    +Q+ +I ++DS +HRC FLL    Q+S  Y  
Sbjct: 1062 D-TSFLKFETKLRFTNFEQYKDIDKKRSEQRRYITIHDSPYHRCPFLLPLFYQDSDTYQN 1120

Query: 1306 LYGGITXXXXXXXXXXXXQAETIAFIIDDFLGPFG--INSTELLGSISTSTPIHXXXXXX 1363
            LYG I               +TI +II+D +G +   + +T    +I   TP        
Sbjct: 1121 LYGAIAPSSSIPTLPLPTLPDTIDYIIEDIVGEYATLLETTNPFKNIFAETPSTMEPSRA 1180

Query: 1364 XXXXXXVIHPIESMQSHLVP---SQSVTH--GNYIIDISYITLDINPLFFTYASNFLDEF 1418
                    +  E+  S   P   ++   H   NY++D+SYI LD++PL F +A + L++ 
Sbjct: 1181 SFSEDD--NDEEADPSSFKPVAFTEDRNHERDNYVVDVSYILLDVDPLLFIFAKSLLEQL 1238

Query: 1419 YSENIIETIDGIEMAIVNRLGTKSEELDSVTNIKLQIKYLDFFFGQRNTEGLELYVDQID 1478
            YSEN+++ +D IE+ IV RL    E + S++NI + I YL+  + +   EG ELY+D+ID
Sbjct: 1239 YSENMVQVLDDIEIGIVKRLSNLQEGITSISNIDIHIAYLNLIWQETGEEGFELYLDRID 1298

Query: 1479 LEVSQKTFQKKSTVVLDEIAILSRFLSLRASINEKKVLEDFDERPPALSLALEGWEGWSS 1538
             ++S+K+ +K  T  L E+A L++  ++R ++N+KK  +  ++RPPALSL +EG+E WSS
Sbjct: 1299 YQMSEKSLEKNRTNKLLEVAALAKVKTVRVTVNQKKNPDLSEDRPPALSLGIEGFEVWSS 1358

Query: 1539 TASSQVNSLNISSTDITVDESQIEWLIDYLNRLVVFVHELVNSLDSIQKKSNGIQKKLVS 1598
            T   QVNSLN++S+DIT+DESQ+EWL +Y +     + E+  S +SIQ   +  + +L+S
Sbjct: 1359 TEDRQVNSLNLTSSDITIDESQMEWLFEYCSDQGNLIQEVCTSFNSIQNTRSNSKTELIS 1418

Query: 1599 DLTLASEYYQISHDPYVITKPAYVMRVSKGHVRQNRSWRIVTRLRHIYTYLPDDWEIHVQ 1658
             LT ASEYYQISHDPYVITKPA++MR+SKGHVR+NRSW+I+TRLRHI TYLPDDW+ ++ 
Sbjct: 1419 KLTAASEYYQISHDPYVITKPAFIMRLSKGHVRENRSWKIITRLRHILTYLPDDWQSNID 1478

Query: 1659 EEMRGKDMNDVSDSSDIFLTVFSNWRNWEVSDVARSYIYKKIFLSNDETTSEKKLQTTVK 1718
            E ++ K      D+ +IF++VFS WRNWE SDVARSYIY K+F + +E   +  ++  +K
Sbjct: 1479 EVLKEKKYTSAKDAKNIFMSVFSTWRNWEFSDVARSYIYGKLFTAENEKHKQNLIKKLLK 1538

Query: 1719 LNLNSIFFTIYSTGYAIDHNIILTKAVILLELTTETAVSPPIEKSILNMTGSLGSIKGEF 1778
              + S + T+Y  GY ++HN ++  A ++++LT      P   +  + +TG +GS+KG+F
Sbjct: 1539 CTMGSFYLTVYGEGYEVEHNFVVADANLVVDLTPPVTSLPSNREETIEITGRVGSVKGKF 1598

Query: 1779 SDKFLRLLELIPDFSK-EEDIKSLTENSSIVSEKSPYFTIHLFLLFENGGLQLTMGDTTL 1837
            SD+ L+L +LIP  +   ED KS  +      E S  F ++  LL +   LQL M  T L
Sbjct: 1599 SDRLLKLQDLIPLIAAVGEDDKSDPKK-----ELSKQFKMNTVLLVDKSELQLVMDQTKL 1653

Query: 1838 SNNVTDGKISAXXXXXXXXXXXXXXGAYYMKKSEMCLKHNKDIIAEFQLHHLGLISTGIY 1897
             +    G++S                  + +KSE+ LKH   I+ E QL    +++T   
Sbjct: 1654 MSRTVGGRVSLLWENLKDSTSQAGSLVIFSQKSEVWLKHTSVILGEAQLRDFSVLATTEA 1713

Query: 1898 TPICPVILINLRSADLHFKSLASTEKIVKTIEDITEYSVHLYKHYDLRKYTTKPTK-VDQ 1956
                P ILIN + ADLHF++++STE++V  I +I E  + + +    +  + K ++ VDQ
Sbjct: 1714 WSHKPTILINNQCADLHFRAMSSTEQLVTAITEIRESLMMIKERIKFKPKSKKKSQFVDQ 1773

Query: 1957 KPEKINFDVRVACNLSKVSAELTLISPFYLRYETKQLDLYFNQNGDGEILLSLWDTDIFV 2016
            K   +     ++C  S VS+E+  +SPFY+R+E KQLD+YFN+ G  EILLS+WDTD F+
Sbjct: 1774 KINTV-----LSCYFSNVSSEVMPLSPFYIRHEAKQLDIYFNKFGSNEILLSIWDTDFFM 1828

Query: 2017 TSHHTKEQYFRFSYDDIQINCNPMSEXXXXXXXXXXXXXXXXTFSEPRRIFASFLQDERI 2076
            TSH TKEQY RFS+ DI+I      E                TFSEPRRI  SFLQDE++
Sbjct: 1829 TSHQTKEQYLRFSFGDIEIKGGISREGYSLINVDISISMIKLTFSEPRRIVNSFLQDEKL 1888

Query: 2077 TIESFQELKKLKKIFFSNAKNVKKLNNDVPKEDTPTKWALELNINYFGILLPIASTFFVL 2136
              +    L  LK +FFS+  N+ K     P       W L+ +I YFG+L+P+AST+FV 
Sbjct: 1889 ASQGINLLYSLKPLFFSS--NLPKKEKQAPS--IMINWTLDTSITYFGVLVPVASTYFVF 1944

Query: 2137 ELHMLLGSLTNTTEEIQEVNNQISGQISLENILFLINDRSLPLRLSKLVDFSIRISTLQK 2196
            ELHMLL SLTNT   +     +++GQ S+ENILFLI +RSLP+ LSKL+DFSI++STLQ+
Sbjct: 1945 ELHMLLLSLTNTNNGMLPEETKVTGQFSIENILFLIKERSLPIGLSKLLDFSIKVSTLQR 2004

Query: 2197 TTSSYESLQIESSHFRMCFSPESLVFVLWGVKQLQNELEYYKDHKTKRQWNLXXXXXXXX 2256
            T  + +S Q+ESSHFR+C SP+SL+ ++WG  +L +   YY        WN         
Sbjct: 2005 TVDTEQSFQVESSHFRVCLSPDSLLRLMWGAHKLLDLSHYYSRRHAPNIWN-TKMFTGKS 2063

Query: 2257 XXXXXXPLNYFRSIHILSYNFCIGWMLPENQKDIPGWMFGYDRLFSAYEKNYGKLTLIEG 2316
                  P+N FRSIHILSY FCIGW+        PG M GY+RLFSAYEK++GK T+++ 
Sbjct: 2064 DKSKEMPIN-FRSIHILSYKFCIGWIFQYGAGSNPGLMLGYNRLFSAYEKDFGKFTVVDA 2122

Query: 2317 YMSVTNSNSSNDFFSQGEEKNRHNRSFLPSMQILYWLKEFNSKKDLFIRLHGDALDVDIL 2376
            + SV N N+S+ FFS+G EK+++NRSFLP+MQI YW K     KD F R HG+ALDV+ +
Sbjct: 2123 FFSVANGNTSSTFFSEGNEKDKYNRSFLPNMQISYWFKRCGELKDWFFRFHGEALDVNFV 2182

Query: 2377 SNFVNIIELIFKSYQIFEDFRKSKIVQNIEKQKHHEHIKSENATEF-----------VPT 2425
             +F+++IE   +S + F++ +K+ +          E +++EN   +           +  
Sbjct: 2183 PSFMDVIESTLQSMRAFQELKKNIL-------DVSESLRAENDNSYASTSVESASSSLAP 2235

Query: 2426 FLSDINSINCEFKYEGGTLRVFSVDDVEIDSTPSLELNAPKVSIYLNYKHFDDSPKPHWL 2485
            FL +I S+N  FKY+GG  RV++ +D+E  S PS E+ +P V+I   YKH +D  KPH  
Sbjct: 2236 FLDNIRSVNSNFKYDGGVFRVYTYEDIETKSEPSFEIKSPVVTINCTYKHDEDKVKPHKF 2295

Query: 2486 RCVIDIHSSHNILYSKCAPFVIEFVESIQEILENRPVEPKQSVSKIATPNRTYKRILAPF 2545
            R +I +  +HN LY+ CAP ++EF ES+Q++++    + K + +K ++ N  YKR+L  F
Sbjct: 2296 RTLITVDPTHNTLYAGCAPLLMEFSESLQKMIKKHSTDEKPNFTKPSSQNVDYKRLLDQF 2355

Query: 2546 DIAFRIKAAKQMLSFSCEPSAKVQANVGLDSFLFGISTGGSSVEDPLSLTLCINKISTSV 2605
            D+A ++ +AKQ LS SCEP AKVQA+VG +SFLF ++T     E PL  +L +     S+
Sbjct: 2356 DVAVKLTSAKQQLSLSCEPKAKVQADVGFESFLFSMATNEFDSEQPLEFSLTLEHTKASI 2415

Query: 2606 QHIFSKEASASFSLNFIDLTFIFTQP---TLYCVGLISDIDIFFNMKQQQNLLLFLDIWH 2662
            +HIFS+E S SF + F+DLT +FT P   ++Y  GL+SD+ +FFN+KQ QNL LFLDIW 
Sbjct: 2416 KHIFSREVSTSFEVGFMDLTLLFTHPDVISMYGTGLVSDLSVFFNVKQLQNLYLFLDIWR 2475

Query: 2663 LSESIGIRPNXXXXXXXXXXGHTQIPETPQPGKIIPWNFNIIFTNVNADIHLGPALGIVS 2722
             S  +  RP                      G  IPW F +IFTNV+ D+ LGP+LG++S
Sbjct: 2476 FSSILHTRPVQRTVNKEIEMSSLTSTNYADAGTEIPWCFTLIFTNVSGDVDLGPSLGMIS 2535

Query: 2723 AKLEKTWFISDRYLDKRQILQLFTDGMVLKSRGRLSGMLDISNAGWRLEVNYADNELNYN 2782
             + ++TW  +D Y +KRQ+L  FTDG+ L S GRLSG+ +++NA W  EV +   +    
Sbjct: 2536 LRTQRTWLATDHYNEKRQLLHAFTDGISLTSEGRLSGLFEVANASWLSEVKWPPEKSKNT 2595

Query: 2783 SPIVAIGIDIGCVALKTAFDYHMFMISKVNNIHFRLHSERDPEGKLPDXXXXXXXCEEIS 2842
             P+V+  ++I  +A+K AFDYHMF+I  ++NIHF LH+E+D +G LPD        +EI 
Sbjct: 2596 HPLVSTSLNIDDIAVKAAFDYHMFLIGTISNIHFHLHNEKDAKGVLPDLLQVSFSSDEII 2655

Query: 2843 ICSTTLVASNILDIYNTIIRTRQDTKNSYFETLMESNNQDTRTNIPYSDILKSLNLLRTD 2902
            + ST LV +NILDIYNTI+R RQD K SY ETL +SN  ++R  I Y DIL+SL LLRTD
Sbjct: 2656 LSSTALVVANILDIYNTIVRMRQDNKISYMETLRDSNPGESRQPILYKDILRSLKLLRTD 2715

Query: 2903 VQIDVSKLQLQISPISLFDFEVLVINIDNMSARSETTSTDKLKTRLELQVCNASVALSTA 2962
            + +++S  ++QISPISLFD EVLVI ID +S RSET S  KLKT L+LQV + S ALST+
Sbjct: 2716 LSVNISSSKVQISPISLFDVEVLVIRIDKVSIRSETHSGKKLKTDLQLQVLDVSAALSTS 2775

Query: 2963 KEELDEESVNKISVADYMTYASKIKGGTILIIPKLLVGMTTWQKVTSNTIEYTFTCKFDG 3022
            KEELDEE    I++ DYM YASKI GGTI+ IPKL V MTT Q+  +N +EY F C F  
Sbjct: 2776 KEELDEEVGASIAIDDYMHYASKIVGGTIIDIPKLAVHMTTLQEEKTNNLEYLFACSFSD 2835

Query: 3023 KVSVRWNLGPVNFIKEMWATHVKSLAVRQARXXXXXXXXXXXXXXXXXXXXXXPAQPKFT 3082
            K+SVRWNLGPV+FIKEMW THVK+LAVR  R                       A  KF 
Sbjct: 2836 KISVRWNLGPVDFIKEMWTTHVKALAVR--RSQVANISFGQTEEELEESIKKEEAASKFN 2893

Query: 3083 YVALVEPSIEMPQIKDLEDATPPMEWFGLNRKKFPSFTHQTAVIVVQKLVHAVEKEYAKI 3142
            Y+AL EP IE+PQI+DL DATPPMEWFG+NRKKFP FTHQTAVI VQKLV+  EK+Y KI
Sbjct: 2894 YIALEEPQIEVPQIRDLGDATPPMEWFGVNRKKFPKFTHQTAVIPVQKLVYLAEKQYVKI 2953

Query: 3143 I 3143
            +
Sbjct: 2954 L 2954

 Score =  167 bits (424), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 79/172 (45%), Positives = 114/172 (66%), Gaps = 9/172 (5%)

Query: 9   SVSLSREKYFSWVFLVTWILTCILCLLMFFYIDRVFAYSLTFILDWLLWRPYKVKIHCEX 68
            V L+ +K FSWVFLV WILT ++CL M FY+ R++AY ++FIL+WLLW+  K+KI+ E 
Sbjct: 9   GVPLTHQKDFSWVFLVDWILTVVVCLTMIFYMGRIYAYLVSFILEWLLWKRAKIKINVET 68

Query: 69  XXXXXXXXXXXFKNLCIITENSTISILEGKIIWQYWLLNTRVSAYELHQQQKEHGYITPG 128
                      FKNL +I ++ TIS+LEG + W+YWLLN R +  EL +  K        
Sbjct: 69  LRVSLLGGRIHFKNLSVIHKDYTISVLEGSLTWKYWLLNCRKA--ELIENNK-------S 119

Query: 129 SGFKNIQLPCKFLFQCEGAEIFVYNKTSAYENIIDSFSPDEKIKYKEFLHKH 180
           S  K  +LPCK   +CEG EIF+YN+T AY+N+I+  S DE+ K++++L++H
Sbjct: 120 SSGKKAKLPCKISVECEGLEIFIYNRTVAYDNVINLLSKDERDKFEKYLNEH 171

 Score =  144 bits (364), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 76/190 (40%), Positives = 117/190 (61%), Gaps = 12/190 (6%)

Query: 298 LNFYPFGLKLTKGSIIFGNKFTPSLLIISYKSAEGIVDVLPATNPRVDLYKMKMKLDFQN 357
           L F P  LK ++GS++ GNKFTPS++I+SY+S +GI+DVLP    R+DLY+ K +++F+N
Sbjct: 221 LMFLPIELKFSRGSLLLGNKFTPSVMILSYESGKGIIDVLPPKE-RLDLYRNKTQMEFKN 279

Query: 358 FEIEVKPNISYEDDSKPKAFYCDSMLSRLWTKFSTLFDIMPNPLSRYIHFSRLHKNSLFL 417
           FEI +K NI Y+D    K       +S+LW  F  +F I+  P+           +    
Sbjct: 280 FEISIKQNIGYDDAIGLKFKIDRGKVSKLWKTFVRVFQIVTKPVVPKKTKKSAGTS---- 335

Query: 418 EDNIFEDEDFEKKWKGLSLYKDAALN-RGNPEEHIEFDFLNHEYARYCSIVKAPRLIFTN 476
                 D++F  KWKGLSLYK +A + + +  + +EFD  NHEYA++ SI+K P++    
Sbjct: 336 ------DDNFYHKWKGLSLYKASAGDAKASDLDDVEFDLTNHEYAKFTSILKCPKVTIAY 389

Query: 477 EYDIPGIVPY 486
           + D+PG+VP+
Sbjct: 390 DVDVPGVVPH 399

>Suva_10.171 Chr10 complement(311672..320548) [8877 bp, 2958 aa] {ON}
            YLR087C (REAL)
          Length = 2958

 Score = 2341 bits (6066), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1176/2575 (45%), Positives = 1660/2575 (64%), Gaps = 55/2575 (2%)

Query: 590  NISAPPESNMEFQLFDASINYGPWAHRNIMNIQRIFSPIVSRTPELQPDPEPGFLRRYTM 649
            N  APP+  ++ Q+   SI YGPWA R + ++QR+ SP+VSRT +      PG  R YT+
Sbjct: 414  NNGAPPDFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRTAKPIKKLPPGSRRVYTL 473

Query: 650  TKISVSIMEDSSWRVPTREPSKDQDFLKRYMKTNDSSRSFGWFDLNFSRNSEATFCISSI 709
             ++++ IMED++WR+PTRE SKD +FL+ Y KT++  R FGW DL F +++ A F IS  
Sbjct: 474  FRMNILIMEDTTWRIPTRESSKDAEFLQHYKKTSEEYRPFGWMDLRFCKDTYANFNISVC 533

Query: 710  PDVNGYANKLNLDFKDLEVRSSVNHDIFFRSKSYRVDSDIGYPLGWNDEVTWSFVFDSYQ 769
            P V G+ N  ++ F + E+RSSVNHDI  +SK + +D DIGYPLGWN    W     S Q
Sbjct: 534  PTVEGFKNDFHVHFVETEIRSSVNHDILLKSKVFDLDGDIGYPLGWNSNTIWIINMKSEQ 593

Query: 770  LETFFLREHLVLIADTFSDFSSGEPTPYEFFRPSIYKVDWNFHGYSAYLNVNDHNIINNP 829
            LE F LREH+ L+ADT SDFS+G+PTPYE FRP +YK++W   GYS YLNVNDHNI+NNP
Sbjct: 594  LEAFLLREHITLVADTLSDFSAGDPTPYELFRPFVYKMNWEMDGYSIYLNVNDHNIVNNP 653

Query: 830  LDFNENCYISVHGDDAHIGVEIPRLGITATYTDIIFQISTPMFRXXXXXXXXXXXXEFMR 889
            LDFNENCY+S+HGD   I + +PR  I  TYTD+ ++ISTPMFR            EFM+
Sbjct: 654  LDFNENCYLSLHGDKLTIDITVPRESILGTYTDMSYEISTPMFRMMLNTPPWNTLNEFMK 713

Query: 890  NKEIGRGYDFTAEGSYIIYSDLDIDNVDSLTIECSTRRMTLLTYGFVIGYLLNVQMNYFG 949
            +KE+GR YDFT +G Y++YS+LDIDNVDSLTI C++    L  YGFV+ YL+NV+MNYFG
Sbjct: 714  HKEVGRSYDFTIKGCYLLYSELDIDNVDSLTINCTSNSTVLHCYGFVMRYLINVKMNYFG 773

Query: 950  EFSHFITAEEYTDIVRGNDNDIVSTLADFXXXXXXXXXXXXXXXQHNPDNSSKSNIIDPL 1009
            EF +F+T+EEYT ++   +   V T +                      N S  N  D  
Sbjct: 774  EFFNFVTSEEYTGVLGAREVGEVVTKSSVVDLASTLDSEY--------QNGSMKN--DAE 823

Query: 1010 YNPPLRKDDIKRKVNETDIWFTFSVWEGALLLPEVLYNSDPCIALSFKELIIDFRNCDYY 1069
             N P+++ D+KR  NETDIWFTFSVW GAL+LPE +Y+ DPCIAL F EL++DFR+C+YY
Sbjct: 824  DNGPMKRSDLKRTTNETDIWFTFSVWNGALILPETIYSFDPCIALHFTELVVDFRSCNYY 883

Query: 1070 LDLLATLNGTSFKRCIRKNQNDIFELVHNNAIKNLEEHGSVSNISIHGHRMYGAPPTSPS 1129
            +D++A LNGTS KR + K  N++F+ +  N   + +EHG +S+++IHGHRMYG PPT P+
Sbjct: 884  MDIMAVLNGTSIKRHVSKQINEVFDFIRRNNGADEQEHGVLSDLTIHGHRMYGLPPTEPT 943

Query: 1130 YFSDWAVDVNNLSINSDIYFIRGFISYITKVGFEFSNLQNILLYDESVLDNMTSVTVHGT 1189
            YF  W +++  L+INSDI F++GF +   KVGF +++L+NILLYD   +++MTS+TVH  
Sbjct: 944  YFCQWDINLGELNINSDIEFLKGFFTSFYKVGFGYNDLENILLYDTETINDMTSLTVHAE 1003

Query: 1190 GIDILVADKSTSAQVLLNMDGITFNRINFANDRYSSRIDLQVPGLHFAFFDNGSSMDKTC 1249
             I+I + D    +Q +++++ + F  I+F N+RYS RID++VP L  +          T 
Sbjct: 1004 RINISLNDPVMKSQSIVSVESLLFTLIDFENERYSQRIDIKVPKLTVSLSCVMGDGTNTS 1063

Query: 1250 LFEFKTKINFTNFTQMKDGELHSKKQQEFIALNDSAFHRCSFLLLPHIQESLLYHELYGG 1309
               F+TK+ FTNF Q KD +    +Q+ +I +NDS +HRC FLL    Q+S  Y +LYG 
Sbjct: 1064 FLNFETKLRFTNFGQYKDSDKKRSEQRRYIMMNDSPYHRCPFLLPLFYQDSDTYQKLYGA 1123

Query: 1310 ITXXXXXXXXXXXXQAETIAFIIDDFLGPFG--INSTELLGSISTSTPIHXXXXXXXXXX 1367
            I               +TI +II+D +G +   + +T     +   TP            
Sbjct: 1124 IAPSSSIPTLPLPTLPDTIDYIIEDIVGEYATLLEATNPFKDLFAETPSTVEPLRASFTE 1183

Query: 1368 ---XXVIHPIESMQSHLVPSQSVTHGNYIIDISYITLDINPLFFTYASNFLDEFYSENII 1424
                    P+E          +    NY+ID+SYI LDI+PL F +  + L++FYSE+++
Sbjct: 1184 DDDEEAADPLEFKPVAFTEEINHERDNYVIDVSYILLDIDPLLFVFTKSLLEQFYSEDMV 1243

Query: 1425 ETIDGIEMAIVNRLGTKSEELDSVTNIKLQIKYLDFFFGQRNTEGLELYVDQIDLEVSQK 1484
            + +D IE+ IV RL    E + S++NI + + YL+  + +   EG ELY+D+I+ ++S+K
Sbjct: 1244 QVLDDIEIGIVKRLSNLQEGIVSISNIDIHVAYLNLIWQETGEEGFELYLDRINYQMSEK 1303

Query: 1485 TFQKKSTVVLDEIAILSRFLSLRASINEKKVLEDFDERPPALSLALEGWEGWSSTASSQV 1544
            + +K  T    E+A+L++  ++RA++N+KK  E  ++RPPALSL LEG+E WSST   QV
Sbjct: 1304 SLEKNRTSKSLEVAVLAKVKTVRATVNQKKNPELSEDRPPALSLGLEGFEVWSSTEDRQV 1363

Query: 1545 NSLNISSTDITVDESQIEWLIDYLNRLVVFVHELVNSLDSIQKKSNGIQKKLVSDLTLAS 1604
            NSLN++S+DIT+DESQ+EWL +Y +     + E+  S++SIQ   +  + +L+S LT AS
Sbjct: 1364 NSLNLTSSDITIDESQMEWLFEYCSDQGNLIQEVFTSVNSIQNTRSSTKTELISKLTAAS 1423

Query: 1605 EYYQISHDPYVITKPAYVMRVSKGHVRQNRSWRIVTRLRHIYTYLPDDWEIHVQEEMRGK 1664
            EYYQISHDPYVITKPA++MR+SKGHVR+NRSW+I+TRLRHI TYLPDDW+ ++ + ++ +
Sbjct: 1424 EYYQISHDPYVITKPAFIMRLSKGHVRENRSWKIITRLRHILTYLPDDWQTNIDKVLKER 1483

Query: 1665 DMNDVSDSSDIFLTVFSNWRNWEVSDVARSYIYKKIFLSNDETTSEKKLQTTVKLNLNSI 1724
              +   D+ +IF++VFS WRNWE SDVARSYIY K+FL++        ++  +K  + S 
Sbjct: 1484 KYSFAKDAKNIFMSVFSTWRNWEFSDVARSYIYGKLFLADHAKHKGNSIKKLLKCTMGSF 1543

Query: 1725 FFTIYSTGYAIDHNIILTKAVILLELTTE-TAVSPPIEKSILNMTGSLGSIKGEFSDKFL 1783
            + T+Y  GY ++HN ++  A ++++LT   T++S   E++I  +TG +GS+KG+FSDK L
Sbjct: 1544 YLTVYGEGYEVEHNFVVADANLVVDLTPPVTSLSSNREETI-EITGKVGSVKGKFSDKLL 1602

Query: 1784 RLLELIPDFSKEEDIKSLTEN--SSIVSEKSPYFTIHLFLLFENGGLQLTMGDTTLSNNV 1841
            +L +LIP       + ++TE+  S   +E S  F ++  LL +   +Q+ M  T + +  
Sbjct: 1603 KLQDLIP------LVVAVTEDDKSDPKAELSKQFKMNTVLLVDKSEIQVVMDKTKVMSRT 1656

Query: 1842 TDGKISAXXXXXXXXXXXXXXGAYYMKKSEMCLKHNKDIIAEFQLHHLGLISTGIYTPIC 1901
              G++S                  + +KSE+ LKH   I+ E QL    +++T       
Sbjct: 1657 VGGRVSLLWENLKDSTSQAGSLVIFSQKSEVWLKHGSTILGEAQLCDFSILATTEAWSHK 1716

Query: 1902 PVILINLRSADLHFKSLASTEKIVKTIEDITEYSVHLYKHYDLR-KYTTKPTKVDQKPEK 1960
            P IL+N + ADLHF+++++TE++V  I +I E  + + +    + K   K   V  +   
Sbjct: 1717 PTILVNNQCADLHFRAMSTTEQMVNAITEIKESVLKVKEQIKFKPKSKNKSQFVGSRINT 1776

Query: 1961 INFDVRVACNLSKVSAELTLISPFYLRYETKQLDLYFNQNGDGEILLSLWDTDIFVTSHH 2020
            +     ++C  S VS+E+  +SPFY+R+E KQLD+YFN+ G  EILLS+WDTD F+TSH 
Sbjct: 1777 V-----LSCYFSNVSSEIMPLSPFYIRHEAKQLDIYFNKFGSNEILLSIWDTDFFMTSHQ 1831

Query: 2021 TKEQYFRFSYDDIQINCNPMSEXXXXXXXXXXXXXXXXTFSEPRRIFASFLQDERITIES 2080
            TKEQY RFS+ DI+I      E                TFSEPRRI  SFLQDE++  + 
Sbjct: 1832 TKEQYLRFSFGDIEIKGGFSKEAYSLINVDISISMIKLTFSEPRRIVNSFLQDEKLASQG 1891

Query: 2081 FQELKKLKKIFF-SNAKNVKKLNNDVPKEDTPTK---WALELNINYFGILLPIASTFFVL 2136
               L  L  +F  ++  N KK        +TP K   W L+ NI+YFGIL+P+AST+FV 
Sbjct: 1892 INLLSSLNSLFLTTDPMNAKK--------ETPAKMINWTLDTNISYFGILVPVASTYFVF 1943

Query: 2137 ELHMLLGSLTNTTEEIQEVNNQISGQISLENILFLINDRSLPLRLSKLVDFSIRISTLQK 2196
            ELHMLL SLTNT   +     +++GQ+S+ENILFLI +RSLP+ LSKL+DFSI++STLQ+
Sbjct: 1944 ELHMLLLSLTNTNNGLLPEQTRLTGQLSIENILFLIKERSLPIGLSKLLDFSIKVSTLQR 2003

Query: 2197 TTSSYESLQIESSHFRMCFSPESLVFVLWGVKQLQNELEYYKDHKTKRQWNLXXXXXXXX 2256
            T  + +S Q+ESSHFR+C SP+SL+ ++WG  +L + ++YY        WN+        
Sbjct: 2004 TADTEQSFQVESSHFRVCLSPDSLLRLIWGAYKLLDMVQYYSKRHAPNIWNI-RMFTGKS 2062

Query: 2257 XXXXXXPLNYFRSIHILSYNFCIGWMLPENQKDIPGWMFGYDRLFSAYEKNYGKLTLIEG 2316
                  P+N FRSIHILSY FCIGW+      D PG MFGY+RLFSAYEK++GK T+++ 
Sbjct: 2063 DKPKEIPIN-FRSIHILSYKFCIGWLFQYGAGDDPGLMFGYNRLFSAYEKDFGKFTIVDA 2121

Query: 2317 YMSVTNSNSSNDFFSQGEEKNRHNRSFLPSMQILYWLKEFNSKKDLFIRLHGDALDVDIL 2376
            + SV+N N+S+ FFS+G EK ++NRSFLP+MQI YW K     KD F R HG+ALDV+ L
Sbjct: 2122 FFSVSNGNTSSTFFSEGNEKEKYNRSFLPNMQISYWFKRCGELKDWFFRFHGEALDVNFL 2181

Query: 2377 SNFVNIIELIFKSYQIFEDFRKSKI----VQNIEKQKHHEHIKSENATEFVPTFLSDINS 2432
             +F+++I+   +S + F++ +K+ +      N+E         +ENA+  +  FL +I S
Sbjct: 2182 PSFMDVIDSTLQSIRAFQELKKNILDMPHESNMENSSPDAAPNTENASNSLAPFLDNIRS 2241

Query: 2433 INCEFKYEGGTLRVFSVDDVEIDSTPSLELNAPKVSIYLNYKHFDDSPKPHWLRCVIDIH 2492
            +NC FKY+GG  RV++ DD+E  S PS EL +P V+I   YKH +   KPH +R +I + 
Sbjct: 2242 VNCNFKYDGGVFRVYTYDDIEAKSEPSFELKSPVVTINCTYKHDESKAKPHRIRTLITVD 2301

Query: 2493 SSHNILYSKCAPFVIEFVESIQEILENRPV-EPKQSVSKIATPNRTYKRILAPFDIAFRI 2551
             +HN LY+ CAP ++EF ES+Q +++     E K + +K +T N  YKR+L  FD+A ++
Sbjct: 2302 PTHNTLYAGCAPLLMEFSESLQNMIKKHSTGEKKPNFTKPSTQNVDYKRLLDQFDVAVKL 2361

Query: 2552 KAAKQMLSFSCEPSAKVQANVGLDSFLFGISTGGSSVEDPLSLTLCINKISTSVQHIFSK 2611
             +AKQ LS SCEP AKVQA+VG +SFLF ++T     E PL  +L + +   S++HIFS+
Sbjct: 2362 TSAKQQLSLSCEPKAKVQADVGFESFLFSMTTNEFDSEQPLGFSLTLEQTKASIKHIFSR 2421

Query: 2612 EASASFSLNFIDLTFIFTQP---TLYCVGLISDIDIFFNMKQQQNLLLFLDIWHLSESIG 2668
            E S SF + F+DLT +FT P   ++Y   L+SD+ +FFN+KQ QNL LFLDIW  S  + 
Sbjct: 2422 EVSTSFEVGFMDLTLLFTHPDVISMYGTSLVSDVSVFFNVKQLQNLYLFLDIWRFSSILH 2481

Query: 2669 IRPNXXXXXXXXXXGHTQIPETPQPGKIIPWNFNIIFTNVNADIHLGPALGIVSAKLEKT 2728
             RP                      G  IPW F +IFTN++ D+ LGP+LG++S + ++T
Sbjct: 2482 TRPTQRPNNKEVNMSTLSSNSNVDVGTEIPWCFTLIFTNLSGDVDLGPSLGVISLRSQRT 2541

Query: 2729 WFISDRYLDKRQILQLFTDGMVLKSRGRLSGMLDISNAGWRLEVNYADNELNYNSPIVAI 2788
            W  +D Y +KRQ+L  FTDG+ L S GRLSG+ +++NA W  EV +         P+V+ 
Sbjct: 2542 WLATDHYDEKRQLLHAFTDGISLTSEGRLSGLFEVANASWVSEVKWPLENSKNTHPLVST 2601

Query: 2789 GIDIGCVALKTAFDYHMFMISKVNNIHFRLHSERDPEGKLPDXXXXXXXCEEISICSTTL 2848
             ++I  VA+K AFDYHMF+I  +NNI F LH+E+D +G LPD        +EI++ ST L
Sbjct: 2602 SLNIDDVAVKAAFDYHMFLIGTINNIRFHLHNEKDSKGILPDLLQVSFSSDEITLSSTAL 2661

Query: 2849 VASNILDIYNTIIRTRQDTKNSYFETLMESNNQDTRTNIPYSDILKSLNLLRTDVQIDVS 2908
            VA+NILDIYNTI+R RQD K SY ETL +SN  +++  I Y DIL+SL LLRTD+ +++S
Sbjct: 2662 VAANILDIYNTIVRMRQDNKISYMETLRDSNPSESKQPILYKDILRSLKLLRTDLSVNIS 2721

Query: 2909 KLQLQISPISLFDFEVLVINIDNMSARSETTSTDKLKTRLELQVCNASVALSTAKEELDE 2968
             L++QISPISLFD EVLV+ ID +S RSET S  KLKT L+LQV + S ALST+KEELDE
Sbjct: 2722 SLKVQISPISLFDVEVLVVRIDKVSIRSETHSGKKLKTDLQLQVLDVSAALSTSKEELDE 2781

Query: 2969 ESVNKISVADYMTYASKIKGGTILIIPKLLVGMTTWQKVTSNTIEYTFTCKFDGKVSVRW 3028
            E    I++ DYM YASKI GGTI+ IPKL V MTT Q+  +N +EY F C F  K+SVRW
Sbjct: 2782 EIGASIAIDDYMHYASKIVGGTIIDIPKLAVHMTTLQEEKTNNLEYLFACSFSDKISVRW 2841

Query: 3029 NLGPVNFIKEMWATHVKSLAVRQARXXXXXXXXXXXXXXXXXXXXXXPAQPKFTYVALVE 3088
            NLGP+NFIKEMW THVK+LAVR+++                       +  KF Y+AL E
Sbjct: 2842 NLGPINFIKEMWTTHVKALAVRRSQTANISFGQTEEELEESIKREENAS--KFNYIALEE 2899

Query: 3089 PSIEMPQIKDLEDATPPMEWFGLNRKKFPSFTHQTAVIVVQKLVHAVEKEYAKII 3143
            P IE+PQI+DL +ATPPMEWFG+NRK+ P FTHQTAVI VQKLV+  EK+Y KI+
Sbjct: 2900 PQIEVPQIRDLGEATPPMEWFGVNRKRLPKFTHQTAVIPVQKLVYLAEKQYVKIL 2954

 Score =  171 bits (433), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 82/172 (47%), Positives = 116/172 (67%), Gaps = 9/172 (5%)

Query: 9   SVSLSREKYFSWVFLVTWILTCILCLLMFFYIDRVFAYSLTFILDWLLWRPYKVKIHCEX 68
            V L+ +K FSWVFLV WILT I CL   FY+ R++AY ++FIL+WLLW+  K+KI+ E 
Sbjct: 9   GVPLTHQKDFSWVFLVDWILTVIACLTTIFYMGRIYAYLVSFILEWLLWKRAKIKINVET 68

Query: 69  XXXXXXXXXXXFKNLCIITENSTISILEGKIIWQYWLLNTRVSAYELHQQQKEHGYITPG 128
                      FK+L +I ++ TISILEG + W+YWLLN R +  EL + +K        
Sbjct: 69  LRISLLGGRIYFKHLSVIHKDYTISILEGSLTWKYWLLNCRKA--ELIENEK-------N 119

Query: 129 SGFKNIQLPCKFLFQCEGAEIFVYNKTSAYENIIDSFSPDEKIKYKEFLHKH 180
           S  KNI+LPCKFL +CEG E F+YN+T AY+N+I+  S DE+ K++++L++H
Sbjct: 120 SSGKNIELPCKFLLECEGLEYFIYNRTLAYDNVINLLSKDERDKFEKYLNEH 171

 Score =  149 bits (376), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 78/190 (41%), Positives = 119/190 (62%), Gaps = 13/190 (6%)

Query: 298 LNFYPFGLKLTKGSIIFGNKFTPSLLIISYKSAEGIVDVLPATNPRVDLYKMKMKLDFQN 357
           L+F+P  LKL +GS++ GNKFTPS++I+SY++ EGI+DVLP    R+DLY+ K  L+ +N
Sbjct: 221 LSFFPIELKLNRGSLLLGNKFTPSVMILSYENGEGIIDVLPPKE-RLDLYRNKTHLELKN 279

Query: 358 FEIEVKPNISYEDDSKPKAFYCDSMLSRLWTKFSTLFDIMPNPLSRYIHFSRLHKNSLFL 417
           FEI +K NI Y+D    K       +S+LW  F  +  ++  P+       R  K +   
Sbjct: 280 FEISIKQNIGYDDAIGLKFKLDTGKVSKLWKTFVRVLRVVTKPV-----IPRRGKKAGPS 334

Query: 418 EDNIFEDEDFEKKWKGLSLYKDAALNRGNPE-EHIEFDFLNHEYARYCSIVKAPRLIFTN 476
           +D  F+      KWKGLSLYK +A +    + + IEFDF +HEYA++ SI+K P++  + 
Sbjct: 335 DDAFFQ------KWKGLSLYKASAGDAKTSDLDDIEFDFTSHEYAKFTSILKCPKVTLSY 388

Query: 477 EYDIPGIVPY 486
           + D+PG+VP+
Sbjct: 389 DVDVPGVVPH 398

>Skud_12.155 Chr12 complement(290039..298918) [8880 bp, 2959 aa] {ON}
            YLR087C (REAL)
          Length = 2959

 Score = 2316 bits (6001), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1172/2578 (45%), Positives = 1652/2578 (64%), Gaps = 61/2578 (2%)

Query: 590  NISAPPESNMEFQLFDASINYGPWAHRNIMNIQRIFSPIVSRTPELQPDPEPGFLRRYTM 649
            N  APP+  ++ Q+   SI YGPWA R + ++QR+ SP+VSRT +      PG  R YT+
Sbjct: 415  NNGAPPDFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRTSKPVKKLPPGSRRIYTL 474

Query: 650  TKISVSIMEDSSWRVPTREPSKDQDFLKRYMKTNDSSRSFGWFDLNFSRNSEATFCISSI 709
             +++V IMED++WR+PTRE SKD +FL+ Y +T++  R FGW DL F +++ A F +   
Sbjct: 475  FRMNVLIMEDTTWRIPTRETSKDAEFLQHYKETSEEYRPFGWMDLRFCKDTYANFNVVLC 534

Query: 710  PDVNGYANKLNLDFKDLEVRSSVNHDIFFRSKSYRVDSDIGYPLGWNDEVTWSFVFDSYQ 769
            P V G+ N  ++ F + E+RSSVNHDI  +SK + +D DIGYPLGWN +  W     S Q
Sbjct: 535  PTVEGFQNNFHVHFVETEIRSSVNHDILLKSKVFNLDGDIGYPLGWNSKAIWIINMKSQQ 594

Query: 770  LETFFLREHLVLIADTFSDFSSGEPTPYEFFRPSIYKVDWNFHGYSAYLNVNDHNIINNP 829
            LE F LREH+ L+ADT SDFS+GEPTPYE FRP +YKV+W   GYS YLNVNDHNI+NNP
Sbjct: 595  LEAFLLREHITLVADTLSDFSAGEPTPYELFRPFVYKVNWEMEGYSIYLNVNDHNIVNNP 654

Query: 830  LDFNENCYISVHGDDAHIGVEIPRLGITATYTDIIFQISTPMFRXXXXXXXXXXXXEFMR 889
            LDFNENCY+S+HGD  +I + +PR  I  TYTDI ++ISTPMFR            EFM+
Sbjct: 655  LDFNENCYLSLHGDRLYIDITVPRESILGTYTDISYEISTPMFRMMLNTPPWNTLNEFMK 714

Query: 890  NKEIGRGYDFTAEGSYIIYSDLDIDNVDSLTIECSTRRMTLLTYGFVIGYLLNVQMNYFG 949
            +KE+GR YDFT +GSY++YS+LDIDNVD+L IEC++    L  YGFV+ YL NV+MNYFG
Sbjct: 715  HKEVGRAYDFTVKGSYLLYSELDIDNVDTLVIECTSNSTVLHCYGFVMRYLTNVKMNYFG 774

Query: 950  EFSHFITAEEYTDIVRGND-NDIV--STLADFXXXXXXXXXXXXXXXQHNPDNSSKSNII 1006
            EF +F+T+EEYT ++   +  +I+  S++ D                     NSS  N  
Sbjct: 775  EFFNFVTSEEYTGVLGAREVGEIITKSSVLDL-----------ASTLDSGYQNSSLKN-- 821

Query: 1007 DPLYNPPLRKDDIKRKVNETDIWFTFSVWEGALLLPEVLYNSDPCIALSFKELIIDFRNC 1066
            +     P+++ D+KR  NETDIWFTFSVW GAL+LPE +Y+ DPCIAL F EL++DFR+C
Sbjct: 822  ESEDKDPVKRSDLKRTTNETDIWFTFSVWNGALILPETIYSLDPCIALHFTELVVDFRSC 881

Query: 1067 DYYLDLLATLNGTSFKRCIRKNQNDIFELVHNNAIKNLEEHGSVSNISIHGHRMYGAPPT 1126
            +YY+D++A LNGTS KR + K  N++F+ +  N   N +EHG++S+++IHGHRM+G PPT
Sbjct: 882  NYYMDIMAVLNGTSIKRHVSKPINEVFDFIRRNNGANEQEHGTLSDLTIHGHRMFGLPPT 941

Query: 1127 SPSYFSDWAVDVNNLSINSDIYFIRGFISYITKVGFEFSNLQNILLYDESVLDNMTSVTV 1186
             P+YF  W +++ +L+I+SDI FI+GF +   K+GF +++L+NILLYD   +D+MTS+TV
Sbjct: 942  EPTYFCQWDINLGDLTIDSDIEFIKGFFNSFYKIGFGYNDLENILLYDTETVDDMTSLTV 1001

Query: 1187 HGTGIDILVADKSTSAQVLLNMDGITFNRINFANDRYSSRIDLQVPGLHFAFFDNGSSMD 1246
            H   I I   D    +Q ++  + + F  I+F N+RYS RID+++P L  +         
Sbjct: 1002 HAERIKISFNDPVMKSQSVVTAESLLFTLIDFENERYSQRIDVKIPKLIISLSCVMGDGV 1061

Query: 1247 KTCLFEFKTKINFTNFTQMKDGELHSKKQQEFIALNDSAFHRCSFLLLPHIQESLLYHEL 1306
             T   +F+TK+ FTNF Q KD +    +Q+ +I  +DS +HRC FLL    Q+S  Y +L
Sbjct: 1062 DTSFLKFETKLRFTNFEQYKDIDKKRSEQRRYITAHDSPYHRCPFLLPLFYQDSDTYQKL 1121

Query: 1307 YGGITXXXXXXXXXXXXQAETIAFIIDDFLGPFG--INSTELLGSISTSTPIHXXXXXXX 1364
            YG I               +TI FII+D +G +   + +T     I   TP         
Sbjct: 1122 YGAIAPSSSIPTLPLPTLPDTIDFIIEDIVGEYATLLETTNPFKDIFAETPSTVEPSRAS 1181

Query: 1365 XXX---XXVIHPIESMQSHLVPSQSVTHGNYIIDISYITLDINPLFFTYASNFLDEFYSE 1421
                       P+E         ++   GNY+ID+SYI LD++PL F +  + L EFYSE
Sbjct: 1182 STEDDNDERADPLEFKPIAFTEGRNHQRGNYVIDVSYILLDVDPLLFVFTKSLLKEFYSE 1241

Query: 1422 NIIETIDGIEMAIVNRLGTKSEELDSVTNIKLQIKYLDFFFGQRNTEGLELYVDQIDLEV 1481
            ++++ +D IE+ IV +L    E + S++NI + I Y++  + +   EG ELY+D+ID ++
Sbjct: 1242 DMVQVLDDIEIGIVKQLSNLQEGITSISNIDVHIAYMNLIWQETGEEGFELYLDRIDYQM 1301

Query: 1482 SQKTFQKKSTVVLDEIAILSRFLSLRASINEKKVLEDFDERPPALSLALEGWEGWSSTAS 1541
            S+K+ +K  T  L E+A L+R  ++R ++N+K+  +  ++RPPALSL LEG+E WSST  
Sbjct: 1302 SEKSLEKNRTSKLLEVATLARIKTVRVTVNQKRNPDLSEDRPPALSLGLEGFEVWSSTED 1361

Query: 1542 SQVNSLNISSTDITVDESQIEWLIDYLNRLVVFVHELVNSLDSIQKKSNGIQKKLVSDLT 1601
             QVNSLN++S+DIT+DESQ+EWL +Y +     + E +NS  SIQ      + +L+S LT
Sbjct: 1362 RQVNSLNLTSSDITIDESQMEWLFEYCSDQGNLIQEALNSFHSIQSTRISSKTELISKLT 1421

Query: 1602 LASEYYQISHDPYVITKPAYVMRVSKGHVRQNRSWRIVTRLRHIYTYLPDDWEIHVQEEM 1661
             ASEYYQISHDPYVITKPA++MR+SKGHVR+NRSW+I+TRLRHI TYLPDDW+ ++++ +
Sbjct: 1422 AASEYYQISHDPYVITKPAFIMRLSKGHVRENRSWKIITRLRHILTYLPDDWQDNIEKVL 1481

Query: 1662 RGKDMNDVSDSSDIFLTVFSNWRNWEVSDVARSYIYKKIFLSNDETTSEKKLQTTVKLNL 1721
            + +      D+ +IF++VFS WRNWE SDVARSYIY K+F  ++    +  ++  +K  +
Sbjct: 1482 KERKYTSAKDAKNIFMSVFSTWRNWEFSDVARSYIYGKLFSVDNAEHKQNLMKKLLKCTM 1541

Query: 1722 NSIFFTIYSTGYAIDHNIILTKAVILLELTTETAVSPPIEKSILN------MTGSLGSIK 1775
             S + T+Y  GY ++HN ++  A ++++LT      PP+    LN      +TG +GS+K
Sbjct: 1542 GSFYLTVYGEGYEVEHNFVIADANLVVDLT------PPVTSLSLNREETIEITGRVGSVK 1595

Query: 1776 GEFSDKFLRLLELIPDFSKEEDIKSLTENSSIVSEKSPYFTIHLFLLFENGGLQLTMGDT 1835
            G+FSD+ L+L +LIP  +         + S   +E S  F ++  LL +   +QL M  T
Sbjct: 1596 GKFSDRLLKLQDLIPLVAAVGG----GDKSDAKAELSKQFKMNTVLLVDKSEIQLVMDQT 1651

Query: 1836 TLSNNVTDGKISAXXXXXXXXXXXXXXGAYYMKKSEMCLKHNKDIIAEFQLHHLGLISTG 1895
             L +    G++S                  + +KSE+ LKH   I+ E QL    +++T 
Sbjct: 1652 KLMSRTVGGRVSLLWENLKDSTSQAGSLVIFSQKSEVWLKHASIILCEAQLRDFSILATT 1711

Query: 1896 IYTPICPVILINLRSADLHFKSLASTEKIVKTIEDITEYSVHLYKHYDLRKYTTKPTKVD 1955
                  P ILIN + ADLHF+++++TE+ V  I +I E    + K  D  K+  K  K  
Sbjct: 1712 EAWSHKPTILINNQCADLHFRAMSTTEQTVTVITEIRE---SVLKIKDRIKFKPKSKKRS 1768

Query: 1956 Q-KPEKINFDVRVACNLSKVSAELTLISPFYLRYETKQLDLYFNQNGDGEILLSLWDTDI 2014
            Q    KIN  + ++C  S VS+E+  +SPFY+R+E KQLD+YFN+ G  E+LLS+WDTD 
Sbjct: 1769 QFVGPKIN--IVLSCYFSNVSSEIMPLSPFYIRHEAKQLDIYFNKFGSNEVLLSIWDTDF 1826

Query: 2015 FVTSHHTKEQYFRFSYDDIQINCNPMSEXXXXXXXXXXXXXXXXTFSEPRRIFASFLQDE 2074
            F+TSH TKEQY RFS+ DI+I      E                TFSEPRRI  SFLQDE
Sbjct: 1827 FMTSHQTKEQYLRFSFGDIEIKGGISKEDYSLINVDISISMIKLTFSEPRRIVNSFLQDE 1886

Query: 2075 RITIESFQELKKLKKIFFSNAKNVKKLNNDVPKEDTPTKWALELNINYFGILLPIASTFF 2134
            ++  +    L  LK + F++    KK      +      W L+ +I YFGIL+P+AST+F
Sbjct: 1887 KLASQGINLLSSLKSLLFTSGLPKKKKKKAPARM---INWTLDTSITYFGILVPVASTYF 1943

Query: 2135 VLELHMLLGSLTNTTEEIQEVNNQISGQISLENILFLINDRSLPLRLSKLVDFSIRISTL 2194
            V ELHMLL SLTNT   +     +++GQ S+ENILFLI +RSLP+ LSKL+DFSI++STL
Sbjct: 1944 VFELHMLLLSLTNTNNGMLPEEAKVTGQFSIENILFLIKERSLPIGLSKLLDFSIKVSTL 2003

Query: 2195 QKTTSSYESLQIESSHFRMCFSPESLVFVLWGVKQLQNELEYYKDHKTKRQWNLXXXXXX 2254
            Q+T  + +S Q+ESSHFR+C SP+SL+ ++WG  +L +   YY        W++      
Sbjct: 2004 QRTVDTEQSFQVESSHFRVCLSPDSLLRLMWGAHKLLDLGHYYSRRHAPNIWDI-KMFTG 2062

Query: 2255 XXXXXXXXPLNYFRSIHILSYNFCIGWMLPENQKDIPGWMFGYDRLFSAYEKNYGKLTLI 2314
                    P+N FRSIHILSY FCIGW+        PG M GY+RLFSAYEK++GK T++
Sbjct: 2063 KSDKPKEIPIN-FRSIHILSYKFCIGWLFQYGAGSDPGLMLGYNRLFSAYEKDFGKFTVV 2121

Query: 2315 EGYMSVTNSNSSNDFFSQGEEKNRHNRSFLPSMQILYWLKEFNSKKDLFIRLHGDALDVD 2374
            + + SV N N S+ FFS+G EK+++NRSFLP+MQI YW K     KD F R HG+ALDV+
Sbjct: 2122 DAFFSVANGNKSSTFFSEGNEKDKYNRSFLPNMQISYWFKRCGELKDWFFRFHGEALDVN 2181

Query: 2375 ILSNFVNIIELIFKSYQIFEDFRKSKIVQNIEKQKHHEH------IKSENATEFVPTFLS 2428
             + +F+++I+   +S + F++ +K+  + ++ +  H E          E+A+  +  FL 
Sbjct: 2182 FVPSFMDVIDSTLQSVRAFQELKKN--ILDVSEDSHMEDDNPYATSSMESASNSLAPFLD 2239

Query: 2429 DINSINCEFKYEGGTLRVFSVDDVEIDSTPSLELNAPKVSIYLNYKHFDDSPKPHWLRCV 2488
            +I S+N  FKY+GG  RV++ DD+E  S PS E+ +P V+I   YKH ++  KPH +R +
Sbjct: 2240 NIRSVNSNFKYDGGVFRVYTYDDIEAKSEPSFEIKSPVVTINCTYKHNENEAKPHRIRIL 2299

Query: 2489 IDIHSSHNILYSKCAPFVIEFVESIQEILENRPVEPKQSVSKIATPNRTYKRILAPFDIA 2548
            I +  + N LY+ CAP ++EF ES+Q++++    + K S +K ++ N  YKR+L  FD+A
Sbjct: 2300 IAVDPTLNTLYAGCAPLLMEFSESLQKMIKKHSTDDKPSFTKPSSQNVDYKRLLDQFDVA 2359

Query: 2549 FRIKAAKQMLSFSCEPSAKVQANVGLDSFLFGISTGGSSVEDPLSLTLCINKISTSVQHI 2608
             ++ +AKQ LS SCEP AKVQA+VG +SFLF ++T     E PL  +L + +   S++HI
Sbjct: 2360 VKLTSAKQQLSLSCEPKAKVQADVGFESFLFSMTTNEFDSEQPLEFSLTLQQTKASIRHI 2419

Query: 2609 FSKEASASFSLNFIDLTFIFTQP---TLYCVGLISDIDIFFNMKQQQNLLLFLDIWHLSE 2665
            FS+E S SF + F+DLT +FT P   ++Y   L+SD+ +FFN+KQ QNL LFLDIW  S 
Sbjct: 2420 FSREVSTSFEVGFMDLTLLFTHPDVISMYGTSLVSDLSVFFNVKQLQNLYLFLDIWRFSS 2479

Query: 2666 SIGIRPNXXXXXXXXXXGHTQIPETPQPGKIIPWNFNIIFTNVNADIHLGPALGIVSAKL 2725
             +  RP                      G  IPW F +IFTNV+ D+ LGP+LG++S + 
Sbjct: 2480 ILHTRPVQGSISKEIDMSSLTSTNYVDVGAEIPWCFTLIFTNVSGDVDLGPSLGVISLRT 2539

Query: 2726 EKTWFISDRYLDKRQILQLFTDGMVLKSRGRLSGMLDISNAGWRLEVNYADNELNYNSPI 2785
            ++TW  +D Y +KRQ+L  FTDG+ L S GRLSG+ +++NA W  EV ++  +   + P+
Sbjct: 2540 QRTWLATDHYSEKRQLLHAFTDGVSLTSEGRLSGLFEVANASWISEVKWSLEKSKNSHPL 2599

Query: 2786 VAIGIDIGCVALKTAFDYHMFMISKVNNIHFRLHSERDPEGKLPDXXXXXXXCEEISICS 2845
            V+  ++I  VA+K AFDYHMF+I  +NNI F+LH+E+D +G LPD        +EI++ S
Sbjct: 2600 VSTSLNIDDVAVKAAFDYHMFLIGTINNIQFQLHNEKDAKGILPDLLQVSFSSDEITLSS 2659

Query: 2846 TTLVASNILDIYNTIIRTRQDTKNSYFETLMESNNQDTRTNIPYSDILKSLNLLRTDVQI 2905
            T LVA+NILDIYNTI+R RQD K SY ETL +SN  +++  I Y DIL+SL LLRTD+ +
Sbjct: 2660 TALVAANILDIYNTIVRMRQDNKISYMETLRDSNPGESKQPILYKDILRSLKLLRTDLSL 2719

Query: 2906 DVSKLQLQISPISLFDFEVLVINIDNMSARSETTSTDKLKTRLELQVCNASVALSTAKEE 2965
            ++S L++QISPISLFD EVLV+ I N+S RSET S  KLKT L+LQV + S ALST+KEE
Sbjct: 2720 NISSLKVQISPISLFDVEVLVVRIKNVSIRSETHSGKKLKTDLQLQVLDVSAALSTSKEE 2779

Query: 2966 LDEESVNKISVADYMTYASKIKGGTILIIPKLLVGMTTWQKVTSNTIEYTFTCKFDGKVS 3025
            LDEE    I++ DY+ YASKI GGTI+ IPKL V MTT Q+  +N IEY F C F  K+S
Sbjct: 2780 LDEEIGASIAIDDYIHYASKIVGGTIIDIPKLAVHMTTLQEEKTNNIEYLFACSFSDKIS 2839

Query: 3026 VRWNLGPVNFIKEMWATHVKSLAVRQARXXXXXXXXXXXXXXXXXXXXXXPAQPKFTYVA 3085
            V+WNLGPVNFIKEMW THVK+LAVRQ++                       +  KF Y+A
Sbjct: 2840 VKWNLGPVNFIKEMWTTHVKALAVRQSQIANVSFGQTEEELEESIKTKETTS--KFNYIA 2897

Query: 3086 LVEPSIEMPQIKDLEDATPPMEWFGLNRKKFPSFTHQTAVIVVQKLVHAVEKEYAKII 3143
            L EP I++PQI+DL DATPPMEWFG+NRK+FP FTHQTAVI VQKLV+  EK+Y KI+
Sbjct: 2898 LEEPQIQVPQIRDLGDATPPMEWFGVNRKRFPKFTHQTAVIPVQKLVYLAEKQYVKIL 2955

 Score =  171 bits (433), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 80/172 (46%), Positives = 117/172 (68%), Gaps = 9/172 (5%)

Query: 9   SVSLSREKYFSWVFLVTWILTCILCLLMFFYIDRVFAYSLTFILDWLLWRPYKVKIHCEX 68
            V L+ +K FSWVFLV WILT ++CL M FY+ R++AY +TFIL+WLLW+   +KI+ E 
Sbjct: 9   GVPLTHQKDFSWVFLVDWILTVVICLTMIFYMGRIYAYLVTFILEWLLWKRANIKINVET 68

Query: 69  XXXXXXXXXXXFKNLCIITENSTISILEGKIIWQYWLLNTRVSAYELHQQQKEHGYITPG 128
                      FK+L +I ++ TIS+LEG + W+YWLLN R +  EL +  K+       
Sbjct: 69  LRVSLLGGRIHFKHLSVIHKDYTISVLEGSLTWKYWLLNCRKA--ELIENNKD------- 119

Query: 129 SGFKNIQLPCKFLFQCEGAEIFVYNKTSAYENIIDSFSPDEKIKYKEFLHKH 180
           S  KN++LPCKF  +CEG EIF+YN+T AY+N+I+  S DE+ K++++L++H
Sbjct: 120 SLSKNVKLPCKFSLECEGLEIFIYNRTVAYDNVINLLSKDERDKFEKYLNEH 171

 Score =  146 bits (369), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 80/191 (41%), Positives = 116/191 (60%), Gaps = 14/191 (7%)

Query: 298 LNFYPFGLKLTKGSIIFGNKFTPSLLIISYKSAEGIVDVLPATNPRVDLYKMKMKLDFQN 357
           L F P  LK  +GS++ GNKFTPS++I+SY++ EG++DVLP    R+DLY+ K +++F+N
Sbjct: 221 LKFLPIELKFNRGSLLLGNKFTPSVMILSYENGEGVIDVLPPKE-RLDLYRNKTQMEFKN 279

Query: 358 FEIEVKPNISYEDDSKPKAFYCDSMLSRLWTKFSTLFDIMPNPLSRYIHFSRLHKNSLFL 417
           FEI +K NI Y+D    K       +S+LW  F  +  I+  P+      S+ +K     
Sbjct: 280 FEISIKQNIGYDDAIGLKFKLDTGKVSKLWKTFVRVLRIVTKPI-----ISKKNK----- 329

Query: 418 EDNIFEDEDFEKKWKGLSLYKDAALNRGNPE--EHIEFDFLNHEYARYCSIVKAPRLIFT 475
           +     D+ F +KWKGLSLYK AA     P   + IEFDF NHEYA++ SI+K P+L   
Sbjct: 330 KKTGPSDDSFFQKWKGLSLYK-AAPGDAKPSDLDDIEFDFTNHEYAKFTSILKCPKLTIA 388

Query: 476 NEYDIPGIVPY 486
            + D+ G VP+
Sbjct: 389 YDVDVSGFVPH 399

>NCAS0B05010 Chr2 complement(922165..931023) [8859 bp, 2952 aa] {ON}
            Anc_8.260 YLR087C
          Length = 2952

 Score = 2310 bits (5986), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1170/2574 (45%), Positives = 1656/2574 (64%), Gaps = 57/2574 (2%)

Query: 590  NISAPPESNMEFQLFDASINYGPWAHRNIMNIQRIFSPIVSRTPELQPDPEPGFLRRYTM 649
            N  APP+ +++ Q+F  S+ +GPWA R   ++ ++ SP+VSRT +      PG  R YT 
Sbjct: 419  NSGAPPDYSLDIQIFGGSVCFGPWAQRQADHLWKLLSPVVSRTAKPVKRLTPGCRRIYTY 478

Query: 650  TKISVSIMEDSSWRVPTREPSKDQDFLKRYMKTNDSSRSFGWFDLNFSRNSEATFCISSI 709
             ++ V+IM+D++WR+PTRE SKD +FL+ Y +TN   R FGW DL FS+ +      +  
Sbjct: 479  GQVLVTIMDDATWRIPTRESSKDFEFLQHYRETNGEYRPFGWIDLKFSKETTVNTTFALC 538

Query: 710  PDVNGYANKLNLDFKDLEVRSSVNHDIFFRSKSYRVDSDIGYPLGWNDEVTWSFVFDSYQ 769
            P V+G+ N + +   + E RSSVNHDI  + K +  D D  +PLGWNDE TW+   +S Q
Sbjct: 539  PTVDGFKNNIKIHLTENETRSSVNHDILLKCKYFDFDIDTSFPLGWNDEATWTINLNSSQ 598

Query: 770  LETFFLREHLVLIADTFSDFSSGEPTPYEFFRPSIYKVDWNFHGYSAYLNVNDHNIINNP 829
            +E F LREH+ LIADT +DFSSGEPTPYE FRP IY ++W   GYS YLNVNDHNI+NNP
Sbjct: 599  MEAFILREHITLIADTLTDFSSGEPTPYELFRPFIYSINWKIDGYSLYLNVNDHNIVNNP 658

Query: 830  LDFNENCYISVHGDDAHIGVEIPRLGITATYTDIIFQISTPMFRXXXXXXXXXXXXEFMR 889
            LDFNENCY+S HGD+  +   IP+  ITA +TDI + I TPMFR            EFM+
Sbjct: 659  LDFNENCYLSFHGDELSLDFLIPKTSITARHTDISYTIKTPMFRLLLNTPPWNTLNEFMK 718

Query: 890  NKEIGRGYDFTAEGSYIIYSDLDIDNVDSLTIECSTRRMTLLTYGFVIGYLLNVQMNYFG 949
            +KE+GR YDF   GSY+IYSDLDIDNVD++ ++C+++  TL  YGFV+ YL+NV+MNYFG
Sbjct: 719  HKEVGRSYDFKVVGSYLIYSDLDIDNVDTIMMDCTSKGTTLQCYGFVVRYLINVKMNYFG 778

Query: 950  EFSHFITAEEYTDIVRGNDNDIVSTLADFXXXXXXXXXXXXXXXQHNPDNSSKSNIIDPL 1009
            +F HF+T+EEYT  +R N++D+                      Q N D   +  +    
Sbjct: 779  DFFHFVTSEEYTGAIRANEDDMQYASE---SDDDRSSISSFDTMQGN-DAPGRRRL---- 830

Query: 1010 YNPPLRKDDIKRKVNETDIWFTFSVWEGALLLPEVLYNSDPCIALSFKELIIDFRNCDYY 1069
             +  L++ D+KR  NETD+WFTF+VWEGALLLPE +YN DPC+ L F EL+ID R+C+YY
Sbjct: 831  -HTELQRSDLKRTTNETDLWFTFTVWEGALLLPETIYNCDPCVGLHFGELVIDLRSCNYY 889

Query: 1070 LDLLATLNGTSFKRCIRKNQNDIFELVHNNAIKNLEEHGSVSNISIHGHRMYGAPPTSPS 1129
            +DLLA +N  S KR + K+ ++IFE +H N  +    HGS+S+++IHGHRMYG PP  P+
Sbjct: 890  MDLLANMNDVSIKRYVSKHPHEIFEAIHKNNGEEYHTHGSLSSLTIHGHRMYGLPPMEPT 949

Query: 1130 YFSDWAVDVNNLSINSDIYFIRGFISYITKVGFEFSNLQNILLYDESVLDNMTSVTVHGT 1189
            YF  W  D+  L I SDI F+RGF S  T++GF + +L+NILLY++   D+MTSVTV+  
Sbjct: 950  YFCQWDFDLGTLDIASDIEFLRGFFSSFTRIGFGYVDLENILLYEKETYDDMTSVTVNLE 1009

Query: 1190 GIDILVADKSTSAQVLLNMDGITFNRINFANDRYSSRIDLQVPGLHFAFFDNGSSMDKTC 1249
             + +++ +   +     +++ + F  I+F N++YS+R+DL +P L F+ F          
Sbjct: 1010 KLSVMLQEPKLNMYASFDLNNLYFTFIDFENEKYSTRLDLIIPTLEFSLFIKEEDGTTKK 1069

Query: 1250 LFEFKTKINFTNFTQMKDGELHSKKQQEFIALNDSAFHRCSFLLLPHIQESLLYHELYGG 1309
            LF  +TK+  TNF Q +D + H K Q+E+I L+D+ +HRCSF+L    Q++  Y EL+G 
Sbjct: 1070 LFTLETKVKITNFVQSQDFDEHRKTQREYIKLHDAPYHRCSFILPQEYQDAEQYQELFGA 1129

Query: 1310 ITXXXXXXXXXXXXQAETIAFIIDDFLGPFGINSTELLGSISTSTPIHX-------XXXX 1362
            I                T  FII+D LG F     +LL    TS+P              
Sbjct: 1130 IAPSSSLPPLPVPLIPSTTDFIIEDLLGEF----QDLL---ETSSPFRMPFSDQDYATDV 1182

Query: 1363 XXXXXXXVIHPIE-SMQSHLVPSQSVTHGNYIIDISYITLDINPLFFTYASNFLDEFYSE 1421
                    I P+E +  S  + +      ++IID+S+I+++I P        FL  F +E
Sbjct: 1183 SDDETEEDIDPLEFNTPSEAIQNDKCERDSFIIDVSFISIEICPDILDSIGTFLMLFSTE 1242

Query: 1422 NIIETIDGIEMAIVNRLGTKSEELDSVTNIKLQIKYLDFFFGQRNTEGLELYVDQIDLEV 1481
            NI++ ID IE+A VNRL    E    +TN+K+ I YLD F+G R   G+ +Y+D+ID  +
Sbjct: 1243 NIVQIIDDIEIATVNRLSNLREGAFKLTNVKINILYLDLFWGSRTDTGVGIYLDRIDFAM 1302

Query: 1482 SQKTFQKKSTVVLDEIAILSRFLSLRASINEKKVLEDFDERPPALSLALEGWEGWSSTAS 1541
             +KT ++     L E+ +L++  S+R ++N+       +ERPPALSL +EGWE WSST  
Sbjct: 1303 CEKTVEENKEKKLIELTVLNKIRSVRGTVNQTAANSKNEERPPALSLVIEGWEIWSSTVE 1362

Query: 1542 SQVNSLNISSTDITVDESQIEWLIDYLNRLVVFVHELVNSLDSIQKKSNGIQKKLVSDLT 1601
             QVNSLNI STDITVDE+Q+EWL  Y +   + + +++ + D+IQK+    +K+L+S LT
Sbjct: 1363 DQVNSLNILSTDITVDEAQLEWLFGYFDNQGLQIQDMIKTSDTIQKRKIESRKELISSLT 1422

Query: 1602 LASEYYQISHDPYVITKPAYVMRVSKGHVRQNRSWRIVTRLRHIYTYLPDDWEIHVQEEM 1661
             ASEYYQISHDPYVITKPA++ R+S+GHVR+NRSW+I+TRLRHI TYLP+DW   +   +
Sbjct: 1423 AASEYYQISHDPYVITKPAFITRLSRGHVRENRSWKIITRLRHILTYLPEDWHSTINRSL 1482

Query: 1662 -RGKDMNDVSDSSDIFLTVFSNWRNWEVSDVARSYIYKKIFL---SNDETTSEKKLQTTV 1717
             + K      D+  IF++VFSNWRNWE SD+ARSYIY+K+FL   SN E  + KK   ++
Sbjct: 1483 TQSKTAATTQDAKGIFISVFSNWRNWEFSDIARSYIYRKLFLNQHSNQEIHTTKK---SI 1539

Query: 1718 KLNLNSIFFTIYSTGYAIDHNIILTKAVILLELTTETAVSPPIEKSILNMTGSLGSIKGE 1777
             + + S F T+YS GY ++HN I+T+  +LLE  + T+ S    ++I N+TG+LG+ KG+
Sbjct: 1540 TIKIASFFVTVYSAGYEVEHNFIITRTNLLLETNSPTSDSSLSRETIFNITGTLGTAKGK 1599

Query: 1778 FSDKFLRLLELIPDFSKEEDIKSLTENSSIVSEKSPYFTIHLFLLFENGGLQLTMGDTTL 1837
             SDK + +  L+P     +  KS  E    V      F ++  +L E G LQ+ +G+T L
Sbjct: 1600 LSDKIIMIKNLLPSLKITDGGKS-KETFDFVKS----FKLNTLILCERGELQIDIGNTRL 1654

Query: 1838 SNNVTDGKISAXXXXXXXXXXXXXXGAYYMKKSEMCLKHNKDIIAEFQLHHLGLISTGIY 1897
             + V   ++S                A Y +++E+ LKH    +AE Q+    LI T   
Sbjct: 1655 VSRVFGARLSMLWESPKDLTSQAVSLAVYTQRAEIHLKHINATLAEIQIRDFSLIVTTES 1714

Query: 1898 TPICPVILINLRSADLHFKSLASTEKIVKTIEDITEYSVHLYKHYDLRKYTT--KPTKVD 1955
                P IL+N + +DLH  ++ +T+ +V +I++I E ++H  +  DL   T   K TKV+
Sbjct: 1715 WSYKPTILVNSQCSDLHLMAMTATDILVASIKEIME-NIHRIEQ-DLLAGTRAEKITKVE 1772

Query: 1956 QKPEKINFDVRVACNLSKVSAELTLISPFYLRYETKQLDLYFNQNGDGEILLSLWDTDIF 2015
                K   +  + C  + +S EL  ISPF++R+E KQLD+YFN+ G  EILLS+WD DI+
Sbjct: 1773 SHGPKPKVNTILTCFFTNISFELMPISPFFIRHEAKQLDIYFNRFGSNEILLSVWDADIY 1832

Query: 2016 VTSHHTKEQYFRFSYDDIQINCNPMSEXXXXXXXXXXXXXXXXTFSEPRRIFASFLQDER 2075
            +TSH TK+QYFRFS+ D+Q+  N M                  T S+ +++  SFLQDE+
Sbjct: 1833 LTSHLTKQQYFRFSFGDLQLKGN-MVNDPYHINLYLSASILKLTVSDVQKLIPSFLQDEK 1891

Query: 2076 ITIESFQELKKLKKIFFSNAKNVKKLNNDVPKEDTPTKWALELNINYFGILLPIASTFFV 2135
            I  ES ++   L    F  +KN K   +   K++    W+++ NINYFG+L PI S +F+
Sbjct: 1892 ILTESIEDFITLD--LFGLSKNQK---SKPEKDNNKFSWSIDTNINYFGLLAPIGSAYFL 1946

Query: 2136 LELHMLLGSLTNTTEEIQEVNNQISGQISLENILFLINDRSLPLRLSKLVDFSIRISTLQ 2195
             EL MLL SLT    +I    + ISGQ S+EN+LF I +R+LP+RLSKL+DFSI++S LQ
Sbjct: 1947 FELRMLLASLTKMGSDIPN-QSDISGQFSVENVLFFIKERALPVRLSKLLDFSIKVSALQ 2005

Query: 2196 KTTSSYESLQIESSHFRMCFSPESLVFVLWGVKQLQNELEYYKDHKTKRQWNLXXXXXXX 2255
            K  ++  + QIESSHFR+C SPESLV +LW   Q+   ++YYKDH    +W+L       
Sbjct: 2006 KKKNTSNTYQIESSHFRVCLSPESLVRLLWATNQVSTSIQYYKDHHVDNKWDLRSKLNNI 2065

Query: 2256 XXXXXXXPLNYFRSIHILSYNFCIGWMLPENQKDIPGWMFGYDRLFSAYEKNYGKLTLIE 2315
                   PLN   S HILSYNFC+GW+   + K  PG + GY+RLFSAYEKN GKLTL++
Sbjct: 2066 PKAPDL-PLN-VPSFHILSYNFCVGWLFSVDSKSEPGLILGYNRLFSAYEKNLGKLTLVD 2123

Query: 2316 GYMSVTNSNSSNDFFSQGEEKNRHNRSFLPSMQILYWLKEFNSKKDLFIRLHGDALDVDI 2375
             + S+ N NSS++FFS+G+EK+++NRS+LP+MQI YW K+  + +DLF+R HG+ALDV  
Sbjct: 2124 VFFSIANGNSSDNFFSEGKEKDKYNRSYLPNMQISYWFKDAGTMRDLFVRFHGEALDVTF 2183

Query: 2376 LSNFVNIIELIFKSYQIFEDFRKSKIVQNIEKQKHHEHIKSENATEFVPTFLSDINSINC 2435
            LS+++++IE    S Q F++ +K  I    +KQK ++    E  T  +  FL++I SI+C
Sbjct: 2184 LSSYLDVIESALTSVQTFQELKKDLIPGLPKKQKVNDDKTLELNT--LSPFLANIRSISC 2241

Query: 2436 EFKYEGGTLRVFSVDDVEIDSTPSLELNAPKVSIYLNYKHFDDSPKPHWLRCVIDIHSSH 2495
            +FKY+GG  ++FS++D E  S PS E+N+P V I LNYKH ++  K HW+R +I I+S+H
Sbjct: 2242 QFKYDGGVFKIFSLEDAETQSEPSFEVNSPNVVIDLNYKHLENRTKQHWIRSLIKINSTH 2301

Query: 2496 NILYSKCAPFVIEFVESIQEILENRPVEPKQSVSKIATPNRTYKRILAPFDIAFRIKAAK 2555
            NILY+KCAP + +F E IQ +++      + ++SK ++ N  YKR+L  FDIA +I +AK
Sbjct: 2302 NILYAKCAPLLSDFFERIQGMVKKHSSSEESTLSKPSSQNLDYKRLLDSFDIALKITSAK 2361

Query: 2556 QMLSFSCEPSAKVQANVGLDSFLFGISTGGSSVEDPLSLTLCINKISTSVQHIFSKEASA 2615
            Q LS SCEP AKVQA++G  SF+F ++T      +PLS +L + K   S++HIFS+E S 
Sbjct: 2362 QQLSLSCEPKAKVQADIGFQSFIFTVTTNDLDAAEPLSFSLSVEKTEASIKHIFSRETST 2421

Query: 2616 SFSLNFIDLTFIFTQP---TLYCVGLISDIDIFFNMKQQQNLLLFLDIWHLSESIGIRPN 2672
            S  ++F+D+T +FT P    ++   LIS+I++FFN+KQ QNL LFLDIW LS+ +  +P 
Sbjct: 2422 SIGVDFVDVTLMFTHPDVINVHGTALISNINLFFNVKQLQNLYLFLDIWRLSDLLKSKP- 2480

Query: 2673 XXXXXXXXXXGHTQIPETPQPGKIIPWNFNIIFTNVNADIHLGPALGIVSAKLEKTWFIS 2732
                          I +   P  IIPW F +IFTNV  D+ LGP+LG++S +L++TWF +
Sbjct: 2481 ANDIVKAKTDSSLSIAQLSDPESIIPWCFTLIFTNVKGDVDLGPSLGVISVQLKRTWFAT 2540

Query: 2733 DRYLDKRQILQLFTDGMVLKSRGRLSGMLDISNAGWRLEVNYADNELNYNSPIVAIGIDI 2792
            D Y + R++L  FTDG  L S+GRLSG+ ++  A W  EVN+  +      P+V+I ++I
Sbjct: 2541 DHYKNMRKVLHAFTDGTSLSSKGRLSGIFELKGASWISEVNWPTDTTINAHPLVSITMNI 2600

Query: 2793 GCVALKTAFDYHMFMISKVNNIHFRLHSERDPEGKLPDXXXXXXXCEEISICSTTLVASN 2852
              ++ K AFDYHMF+I  +NN    LHSE+D  G +PD       CE I++CST LVA+N
Sbjct: 2601 DEISTKAAFDYHMFLIGAINNTRVHLHSEKDVNGVMPDLLKVTFLCESITLCSTALVAAN 2660

Query: 2853 ILDIYNTIIRTRQDTKNSYFETLMESNNQDTRTNIPYSDILKSLNLLRTDVQIDVSKLQL 2912
            ILDIYNT +R RQD K SY ETL ESN  +++  I Y+DIL+SLNLL+TDV +D+  L +
Sbjct: 2661 ILDIYNTAMRMRQDNKISYIETLRESNEAESKPPINYTDILRSLNLLQTDVSVDIYTLNI 2720

Query: 2913 QISPISLFDFEVLVINIDNMSARSETTSTDKLKTRLELQVCNASVALSTAKEELDEESVN 2972
            QISPI+LFD EVLVI I+++SARSET S  KL T LE+QV +ASV+LST+KEE+DE +V+
Sbjct: 2721 QISPITLFDVEVLVITIESISARSETHSGKKLMTELEMQVYDASVSLSTSKEEMDEATVS 2780

Query: 2973 KISVADYMTYASKIKGGTILIIPKLLVGMTTWQKVTSNTIEYTFTCKFDGKVSVRWNLGP 3032
            KISV +Y+ YASKI GGTI+ IPKLLV MTT+Q+  S+ +EY +TC FD K+SVRWNLGP
Sbjct: 2781 KISVKNYLQYASKIVGGTIIEIPKLLVSMTTFQEEKSDILEYLYTCVFDDKLSVRWNLGP 2840

Query: 3033 VNFIKEMWATHVKSLAVRQARXXXXXXXXXXXXXXXXXXXXXXPAQPKFTYVALVEPSIE 3092
            +NFIKEMW TH++++AVR+++                       +  +F YVAL  P I+
Sbjct: 2841 INFIKEMWTTHIRAIAVRRSQVVGVLDGQSEEDVEKRIKEEENFS--RFKYVALEPPRID 2898

Query: 3093 MPQIKDLEDATPPMEWFGLNRKKFPSFTHQTAVIVVQKLVHAVEKEYAKIIGHS 3146
            MPQI+DL DATPPMEWFG+NRK+FP+FTHQTAV +VQKLV++ E+EYA I+G S
Sbjct: 2899 MPQIRDLGDATPPMEWFGVNRKRFPAFTHQTAVFLVQKLVYSAEREYANILGSS 2952

 Score =  170 bits (431), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 83/175 (47%), Positives = 114/175 (65%), Gaps = 3/175 (1%)

Query: 6   KFVSVSLSREKYFSWVFLVTWILTCILCLLMFFYIDRVFAYSLTFILDWLLWRPYKVKIH 65
           +F  V L+R++ FSW+FLVTWILT IL L   FY+ R  AY +TFIL+WLLW+  KVK++
Sbjct: 6   QFQGVPLTRQRNFSWIFLVTWILTVILSLSFIFYLGRTIAYIITFILEWLLWKHAKVKVN 65

Query: 66  CEXXXXXXXXXXXXFKNLCIITENSTISILEGKIIWQYWLLNTRVSAYELHQQQKEHGYI 125
            +            FKN+ II ++STISILEG I W+YWL NTR   +   Q+       
Sbjct: 66  IQSLRISLLGGRIFFKNVTIIHKDSTISILEGNITWRYWLFNTRKPEF---QEASVDETQ 122

Query: 126 TPGSGFKNIQLPCKFLFQCEGAEIFVYNKTSAYENIIDSFSPDEKIKYKEFLHKH 180
           T  +  KN QLPC+F+   EG EIF+YNKT AY+NII  FS +E+ ++++FL++ 
Sbjct: 123 TKPTSIKNWQLPCRFVVNLEGLEIFLYNKTVAYDNIIQMFSKEERFQFEKFLNEQ 177

 Score =  145 bits (367), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 80/191 (41%), Positives = 116/191 (60%), Gaps = 14/191 (7%)

Query: 298 LNFYPFGLKLTKGSIIFGNKFTPSLLIISYKSAEGIVDVLPATNPRVDLYKMKMKLDFQN 357
           L F P    +T+GS+I GNKFTPSLLI+S  SA+ ++D       ++DLYK K+  +  N
Sbjct: 225 LRFLPIQFLVTRGSLILGNKFTPSLLIVSADSADALMD-FAQPKEKLDLYKFKLSAELIN 283

Query: 358 FEIEVKPNISYEDDSKPKAFYCDSMLSRLWTKFSTLFDIMPNPLSRYIHFSRLHKNSLFL 417
            E  +K NI +++D   K       +S +W  F+ +  I+  PL R+ H  R  KN    
Sbjct: 284 TEATLKQNIGFDEDVSMKFKLDRGKVSEVWNHFTRMLGILYKPL-RFTHMHR-RKN---- 337

Query: 418 EDNIFEDED-FEKKWKGLSLYKDAALN-RGNPEEHIEFDFLNHEYARYCSIVKAPRLIFT 475
                E ED F+ KW+GL+LYK   L  R N  + IEFDF NHEYA++ SI+K+P++ FT
Sbjct: 338 -----EHEDKFQAKWRGLALYKGTGLGERRNDIDDIEFDFANHEYAKFSSILKSPKVTFT 392

Query: 476 NEYDIPGIVPY 486
           +++D+PGIVP+
Sbjct: 393 SQHDMPGIVPH 403

>NDAI0B01980 Chr2 complement(483519..492398) [8880 bp, 2959 aa] {ON}
            Anc_8.260 YLR087C
          Length = 2959

 Score = 2273 bits (5889), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1148/2575 (44%), Positives = 1638/2575 (63%), Gaps = 54/2575 (2%)

Query: 590  NISAPPESNMEFQLFDASINYGPWAHRNIMNIQRIFSPIVSRTPELQPDPEPGFLRRYTM 649
            N  APPE ++E Q+   SI +GPWA R + ++ R+ SPI SR  +      PG  R YT 
Sbjct: 417  NSGAPPEFSLEIQISGGSICFGPWAQRQLNSLIRLLSPIASRNAKPTKRLTPGCTRIYTQ 476

Query: 650  TKISVSIMEDSSWRVPTREPSKDQDFLKRYMKTNDSSRSFGWFDLNFSRNSEATFCISSI 709
             K ++S  E+++WR+PTRE SKD +FL+ Y +TN+  R FGW DL FS+++     ++  
Sbjct: 477  FKTTISTTEETTWRIPTRESSKDPEFLQHYRETNEEYRPFGWIDLKFSKDTYICSTVAQC 536

Query: 710  PDVNGYANKLNLDFKDLEVRSSVNHDIFFRSKSYRVDSDIGYPLGWNDEVTWSFVFDSYQ 769
            P   G+ N L++   D E+RSSVNHDI  + KS+    DIG+PLGWN+E TW+   +S Q
Sbjct: 537  PTKEGFKNTLDIHLGDNEIRSSVNHDILLKCKSFNFVMDIGFPLGWNEEATWTIDLESTQ 596

Query: 770  LETFFLREHLVLIADTFSDFSSGEPTPYEFFRPSIYKVDWNFHGYSAYLNVNDHNIINNP 829
            LE F LREH+ LIADT +DFSSGEPTPYE FRP +Y+++W  +GYS YLNVNDHNI+NNP
Sbjct: 597  LEAFILREHITLIADTLTDFSSGEPTPYELFRPFVYRINWKINGYSLYLNVNDHNIVNNP 656

Query: 830  LDFNENCYISVHGDDAHIGVEIPRLGITATYTDIIFQISTPMFRXXXXXXXXXXXXEFMR 889
            LDFNENCY+S HGD   I + +P+  ++A +T++ + I TPMFR            EFM+
Sbjct: 657  LDFNENCYLSFHGDILQIDLVVPKREVSAGFTEVSYTIYTPMFRLVLNTPPWNTLNEFMK 716

Query: 890  NKEIGRGYDFTAEGSYIIYSDLDIDNVDSLTIECSTRRMTLLTYGFVIGYLLNVQMNYFG 949
            NKE+GR +DF   GSY+IYS+LDIDNVD++ IECS++   L  YGFVI YL NV+MNYFG
Sbjct: 717  NKEVGRSHDFKITGSYLIYSELDIDNVDTIIIECSSQSTVLQCYGFVIRYLTNVKMNYFG 776

Query: 950  EFSHFITAEEYTDIVRGNDNDIVSTLADFXXXXXXXXXXXXXXXQHNPDNSSKSNIIDPL 1009
            +F HF+T+EEYT  +R N+  + +   D                + +     ++      
Sbjct: 777  DFFHFVTSEEYTGEIRANE--VQNQFTDRQLYEDKASLSSYESIETSSVRKEQTG----- 829

Query: 1010 YNPPLRKDDIKRKVNETDIWFTFSVWEGALLLPEVLYNSDPCIALSFKELIIDFRNCDYY 1069
             +  +++ D+KR  NETD+WFTF+VWEGA+LLPE +YN DPCI L F EL+IDFR+C+YY
Sbjct: 830  -DSKIKRSDLKRATNETDLWFTFTVWEGAILLPETIYNCDPCIGLHFGELLIDFRSCNYY 888

Query: 1070 LDLLATLNGTSFKRCIRKNQNDIFELVHNNAIKNLEEHGSVSNISIHGHRMYGAPPTSPS 1129
            +DLLA++N  S +R I K QN+I+E V  +     +++GS+S++ IH HRMYG PP  P+
Sbjct: 889  MDLLASMNDISLRRYIGKQQNEIYESVRQDNGCGNKKYGSLSDMVIHAHRMYGLPPLEPT 948

Query: 1130 YFSDWAVDVNNLSINSDIYFIRGFISYITKVGFEFSNLQNILLYDESVLDNMTSVTVHGT 1189
            YF  W   +  L +N DI F+ GFI+   K+ F   +L+NILLY++ V+D+MTS+TV   
Sbjct: 949  YFCQWDFSLGTLDLNCDISFLEGFITSFNKISFGLVDLENILLYEKEVIDDMTSLTVDVK 1008

Query: 1190 GIDILVADKSTSAQVLLNMDGITFNRINFANDRYSSRIDLQVPGLH-FAFFDNGSSMDKT 1248
             I I++ +      +L   + + F+ INF N++Y +R+DL++P  + F +  NG+  +K 
Sbjct: 1009 KISIMIRESEMDTFLLCTAEELYFSNINFENEKYCTRLDLRIPIFNLFMYTMNGAKKEK- 1067

Query: 1249 CLFEFKTKINFTNFTQMKDGELHSKKQQEFIALNDSAFHRCSFLLLPHIQESLLYHELYG 1308
             LFEF+TK+N +NF +  D   H  KQQE+I L+D+ +HRC+F+L P +Q+S +Y +L+G
Sbjct: 1068 -LFEFETKVNLSNFEKPNDIATHKSKQQEYITLHDAPYHRCAFILPPSLQDSEIYQDLFG 1126

Query: 1309 GITXXXXXXXXXXXXQAETIAFIIDDFLGPF-----GINSTELLGSISTSTPIHXXXXXX 1363
             I                TI +I+DD LG F       N   +  S +TS  +       
Sbjct: 1127 SIAPSSSLPPLPIPLLPATIDYIVDDLLGCFPEILESENPFRIPFSPATSPKLGNPFEGS 1186

Query: 1364 XXXXXXVIHPIESMQSHLVPSQSVTHGNYIIDISYITLDINPLFFTYASNFLDEFYSENI 1423
                   + P+E        S++    N++IDISY +L INP  ++Y  N  + F S++I
Sbjct: 1187 DTESDEELDPLEFKTETSGDSETFASDNFVIDISYCSLSINPRLWSYLDNCREHFCSQDI 1246

Query: 1424 IETIDGIEMAIVNRLGTKSEELDSVTNIKLQIKYLDFFFGQRNTEGLELYVDQIDLEVSQ 1483
            ++ +D IE+ IVN L    E +++  NIKLQI YLD F+G R   G+ LY+D+IDLE+ Q
Sbjct: 1247 VQILDDIEIGIVNHLSDLQEGIETARNIKLQILYLDLFWGDRQNAGISLYLDRIDLEMCQ 1306

Query: 1484 KTFQKKSTVVLDEIAILSRFLSLRASINEKKVLEDFDERPPALSLALEGWEGWSSTASSQ 1543
            K  ++ +   + E+  L++  S+RA+INE   +   DERPPALSL +EG E WS   ++Q
Sbjct: 1307 KMLEENNETKITEVTFLNKIRSVRATINEASSVGKADERPPALSLVIEGSEIWSCITNAQ 1366

Query: 1544 VNSLNISSTDITVDESQIEWLIDYLNRLVVFVHELVNSLDSIQKKSNGIQKKLVSDLTLA 1603
            VNSLNI S DIT+DE+QI+WL  Y+++ +    E+ ++L SIQ+  +  +K+LVS L +A
Sbjct: 1367 VNSLNILSADITIDEAQIDWLFQYIDKQLTLSQEIASALQSIQESRSTTRKQLVSKLAVA 1426

Query: 1604 SEYYQISHDPYVITKPAYVMRVSKGHVRQNRSWRIVTRLRHIYTYLPDDWEIHVQEEMRG 1663
            SEYYQISHDPYVITKPA++ R+S+GHVR+NRSW+I+TRLRHI TYLP DW + V +EMR 
Sbjct: 1427 SEYYQISHDPYVITKPAFITRLSRGHVRENRSWKIITRLRHILTYLPIDW-LRVIDEMRN 1485

Query: 1664 -KDMNDVSDSSDIFLTVFSNWRNWEVSDVARSYIYKKIFLSNDETTSEKKLQTTVKLNLN 1722
             +D + + D  + F++VFSNWRNWE SD+ARSYIY+ +F        E  ++ ++KL L 
Sbjct: 1486 QQDSHTLPDPGNAFISVFSNWRNWEFSDIARSYIYRNMFSEGHSKKQENSMENSIKLKLA 1545

Query: 1723 SIFFTIYSTGYAIDHNIILTKAVILLELTTETAVSPPIEKSILNMTGSLGSIKGEFSDKF 1782
            S+FFT+YSTGY ++HN ILT+  +++E     + S  I++ I+N+TGSLG+IKG+ S K 
Sbjct: 1546 SLFFTVYSTGYEVEHNFILTRTNVVVETLPAISDSSIIQEKIINVTGSLGTIKGKTSHKL 1605

Query: 1783 LRLLELIPDFSKEEDIKSLTENSSIVSEKSPY---FTIHLFLLFENGGLQLTMGDTTLSN 1839
            + L +L+P+ S ++++K  T          P+   F +++ LLFE   LQ  +G + + +
Sbjct: 1606 INLKKLLPELSMKKNLKPST----------PFLRCFKLNMLLLFERSELQFVLGASKVMS 1655

Query: 1840 NVTDGKISAXXXXXXXXXXXXXXGAYYMKKSEMCLKHNKDIIAEFQLHHLGLISTGIYTP 1899
             V  GK+S                  Y ++SEM +KH+  I+AE Q+    +I T     
Sbjct: 1656 RVFGGKLSMLWESPKDLASKAISMTVYAQRSEMWMKHHNIILAESQMREFSIIITAESWS 1715

Query: 1900 ICPVILINLRSADLHFKSLASTEKIVKTIEDITEYSVHLYKHYDLRKYTTKPTKVDQKP- 1958
              P +L+NL+  D+HF+++ +T+ + K++ +I E    L K +      +   ++ Q P 
Sbjct: 1716 YKPTVLVNLQCTDIHFRAMTATDVLAKSVGEIIENIKELEKLF-YSDSDSGIQQISQYPV 1774

Query: 1959 --EKINFDVRVACNLSKVSAELTLISPFYLRYETKQLDLYFNQNGDGEILLSLWDTDIFV 2016
              +KIN  + + C  + V+ E+  +SPF  R+  KQLD+YFN+ G  +++LS+WDTD+F+
Sbjct: 1775 MEQKIN--MVLTCYFTNVNLEIMPLSPFSFRHNAKQLDIYFNRLGSNDLVLSVWDTDLFL 1832

Query: 2017 TSHHTKEQYFRFSYDDIQINCNPMSEXXXXXXXXXXXXXXXXTFSEPRRIFASFLQDERI 2076
             SH TKE+YFRFS+ +IQ+  N +                  T  + RR+  SFLQDE+I
Sbjct: 1833 ISHLTKEEYFRFSFGNIQLKGNILENPNYTINIDVSASIVKLTLGDIRRLIPSFLQDEKI 1892

Query: 2077 TIESFQELKKLKKIFFSNAKNVKKLNNDVPKEDTPTKWALELNINYFGILLPIASTFFVL 2136
             IES ++   LK   F      KK      K      W+LE NINYFG+L+PI+ST+F+L
Sbjct: 1893 LIESLEQFSSLK--LFQR----KKPAPSTEKSGRTVTWSLESNINYFGLLVPISSTYFIL 1946

Query: 2137 ELHMLLGSLTNTTEEIQEVNNQISGQISLENILFLINDRSLPLRLSKLVDFSIRISTLQK 2196
            ELHMLL SL N  + I    N +SGQ S++N+ FL+ ++SLP  LSK++DFSI++STLQK
Sbjct: 1947 ELHMLLMSL-NKIQGISSKYNGLSGQFSIDNVCFLLKEKSLPADLSKILDFSIKVSTLQK 2005

Query: 2197 TTSSYESLQIESSHFRMCFSPESLVFVLWGVKQLQNELEYYKDHKTKRQWNLXXXXXXXX 2256
               +  S QIES HFR+C SP SL  +LW   Q    + YYK+H T   W          
Sbjct: 2006 LKVTPRSFQIESPHFRVCLSPGSLAHMLWRGNQALTNIRYYKEH-TSVAWEKVINFKNTN 2064

Query: 2257 XXXXXXPLNYFRSIHILSYNFCIGWMLPENQKDIPGWMFGYDRLFSAYEKNYGKLTLIEG 2316
                      F S H+LSYNFC+GW+      + PG + GY RLFSAYEKN+GKLTLI+ 
Sbjct: 2065 NSAEVQA--DFPSFHVLSYNFCVGWLFSPEFDNEPGLIIGYSRLFSAYEKNFGKLTLIDA 2122

Query: 2317 YMSVTNSNSSNDFFSQGEEKNRHNRSFLPSMQILYWLKEFNSKKDLFIRLHGDALDVDIL 2376
            Y SV N  +S+ FFS+G EK+R+NRS+LP+MQI YWLK     +D+++R HG+ALDV+ L
Sbjct: 2123 YFSVANGKTSDTFFSKGHEKDRYNRSYLPNMQISYWLKNEGLLRDVYLRFHGEALDVNFL 2182

Query: 2377 SNFVNIIELIFKSYQIFEDFRKSKIVQNIEKQKHHEHIKSENATEFVPTFLSDINSINCE 2436
            ++F+++IE   +S Q F++ ++  +      ++  +    E   +  P F + I SINC+
Sbjct: 2183 ASFIDVIESSLESIQKFQELKRDLVGTASNIKEQTQSTTQEPIGDISP-FFTGIRSINCQ 2241

Query: 2437 FKYEGGTLRVFSVDDVEIDSTPSLELNAPKVSIYLNYKHFDDSPK-PHWLRCVIDIHSSH 2495
            F+Y+GG  +VFS  +      PS E+ +P V I +NYK+ +   + P W+R +I I+S+H
Sbjct: 2242 FQYDGGVFKVFSSAEASNHLKPSFEIKSPNVIIDMNYKYNEKKTQTPTWIRTLITINSTH 2301

Query: 2496 NILYSKCAPFVIEFVESIQEILENRPVEPKQSVSKIATPNRTYKRILAPFDIAFRIKAAK 2555
            N L++KCAP + EF E IQ++++    + + S + I+  N  YKR+L  FD+A  + +AK
Sbjct: 2302 NTLFAKCAPLIAEFSEGIQKMVKRHSSDREPSGTNISKQNIDYKRMLDSFDVAVEVISAK 2361

Query: 2556 QMLSFSCEPSAKVQANVGLDSFLFGISTGGSSVEDPLSLTLCINKISTSVQHIFSKEASA 2615
            Q+LS  CEP AKVQA++G  SF F ++T     E+PL   L + K   S++HIFS+EAS 
Sbjct: 2362 QLLSLCCEPRAKVQADIGFQSFTFTVTTNDYDPEEPLIFALSVEKTEASIKHIFSREAST 2421

Query: 2616 SFSLNFIDLTFIFTQP---TLYCVGLISDIDIFFNMKQQQNLLLFLDIWHLSESIGIRPN 2672
            SF ++FIDLT +FT P    +   GLISD+ +FFN+KQ QNL LFLDIW LS  +  +P 
Sbjct: 2422 SFGVDFIDLTVMFTHPNSINILGTGLISDVHVFFNVKQLQNLYLFLDIWKLSNLLNSKPM 2481

Query: 2673 XXXXXXXXXXGHTQIPETPQPGKIIPWNFNIIFTNVNADIHLGPALGIVSAKLEKTWFIS 2732
                            ++      IPW F +IF+N+N D+ LGP LG++S   ++TWF +
Sbjct: 2482 NEVVKSRTDLKSLSSVQSKDTDSTIPWCFTLIFSNINGDVDLGPTLGVLSLHFKRTWFAT 2541

Query: 2733 DRYLDKRQILQLFTDGMVLKSRGRLSGMLDISNAGWRLEVNYADNELNYNSPIVAIGIDI 2792
            D Y   R++L  +T G+ L S+GRLSG+L++  A W  EVN+   E   + P+V+I ++I
Sbjct: 2542 DHYKSTRKVLHAYTKGITLTSKGRLSGILELDGASWISEVNWPIYENINDYPLVSISLNI 2601

Query: 2793 GCVALKTAFDYHMFMISKVNNIHFRLHSERDPEGKLPDXXXXXXXCEEISICSTTLVASN 2852
              V  K AFDYHMF++  +NNI   +HSE+D  G  PD       CE I +CST LVA+N
Sbjct: 2602 DRVETKVAFDYHMFLVGAINNIDVHIHSEKDINGIKPDLLKVNVICEAIKLCSTALVAAN 2661

Query: 2853 ILDIYNTIIRTRQDTKNSYFETLMESNNQDTRTNIPYSDILKSLNLLRTDVQIDVSKLQL 2912
            ILDIYNT++R RQD K SY ETL ESN  + R  + Y DIL+SLNL++TDV +D+  L +
Sbjct: 2662 ILDIYNTVMRLRQDNKISYIETLKESNTSEPRQALDYKDILRSLNLIQTDVSVDIYTLNI 2721

Query: 2913 QISPISLFDFEVLVINIDNMSARSETTSTDKLKTRLELQVCNASVALSTAKEELDEESVN 2972
            QISPISLFD E+LV+NI+N+SARSET + +KLKT LE+QV +ASVALST+KEELDE+ + 
Sbjct: 2722 QISPISLFDAEILVVNIENISARSETHAGNKLKTELEMQVYDASVALSTSKEELDEDIIA 2781

Query: 2973 KISVADYMTYASKIKGGTILIIPKLLVGMTTWQKVTSNTIEYTFTCKFDGKVSVRWNLGP 3032
             ISV DYM YA +I GG I+  P+LL+ MTT+QK  S+ +EY +TC F  K+SVRWNLGP
Sbjct: 2782 TISVEDYMHYAGRISGGVIIEAPRLLIAMTTYQKEKSDILEYLYTCSFGDKISVRWNLGP 2841

Query: 3033 VNFIKEMWATHVKSLAVRQARXXXXXXXXXXXXXXXXXXXXXXPAQPKFTYVALVEPSIE 3092
            VNFIKEMWATHV+++AVR+++                       +  +F YV L EP I+
Sbjct: 2842 VNFIKEMWATHVRAMAVRRSQIDVTFGPVSEEDVGKRIKKEEEFS--RFQYVPLEEPRID 2899

Query: 3093 MPQIKDLEDATPPMEWFGLNRKKFPSFTHQTAVIVVQKLVHAVEKEYAKIIGHSE 3147
            MPQI+DL DATPP+EWFGLNRK+FP+FTHQTAVI+VQKLVH  EKEY  I+GHS+
Sbjct: 2900 MPQIRDLGDATPPLEWFGLNRKRFPAFTHQTAVILVQKLVHTAEKEYGSILGHSQ 2954

 Score =  150 bits (379), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 71/175 (40%), Positives = 108/175 (61%), Gaps = 7/175 (4%)

Query: 6   KFVSVSLSREKYFSWVFLVTWILTCILCLLMFFYIDRVFAYSLTFILDWLLWRPYKVKIH 65
           +F  + L+++K FSWVFLV WIL  I+ L + FY+ R  AY ++FIL+W LW+   VKI+
Sbjct: 6   QFQRIPLTKQKDFSWVFLVDWILILIVTLFVIFYLSRTLAYGISFILEWFLWKRSNVKIN 65

Query: 66  CEXXXXXXXXXXXXFKNLCIITENSTISILEGKIIWQYWLLNTRVSAYELHQQQKEHGYI 125
            E            FKN+ II ++ TIS LE  + W+YWLLN R S Y+  +       +
Sbjct: 66  IESIRISPLGGRVFFKNVVIIHQDYTISFLEANVTWRYWLLNVRKSGYDTPE-------L 118

Query: 126 TPGSGFKNIQLPCKFLFQCEGAEIFVYNKTSAYENIIDSFSPDEKIKYKEFLHKH 180
              +   +++LPC+F  + EG EIFVYN+  AY+NII  FS +E+ ++++FL++ 
Sbjct: 119 PDKASANSVKLPCRFFLEFEGLEIFVYNRGVAYDNIIGQFSKEERNQFEKFLNEQ 173

 Score =  128 bits (321), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 72/190 (37%), Positives = 113/190 (59%), Gaps = 12/190 (6%)

Query: 298 LNFYPFGLKLTKGSIIFGNKFTPSLLIISYKSAEGIVDVLPATNPRVDLYKMKMKLDFQN 357
           L+F P   K++ GS+I GNKFTPSL+I S  S  G++DV   +  ++DLYK++  LDF+ 
Sbjct: 223 LDFLPIDFKVSHGSLIIGNKFTPSLMIGSCSSCTGMIDVCQPSE-KLDLYKLRFLLDFKT 281

Query: 358 FEIEVKPNISYEDDSKPKAFYCDSMLSRLWTKFSTLFDIMPNPLSRYIHFSRLHKNSLFL 417
           F I++K NI + ++   K     + +S++W +F+ +       L+ Y H    H  S   
Sbjct: 282 FAIDIKQNIGFNEEFSMKFKIDRNRVSKMWQQFNKVL------LTCYSHMKLSHLRS--- 332

Query: 418 EDNIFEDEDFEKKWKGLSLYKDAALNRGNPEEHIEFDFL-NHEYARYCSIVKAPRLIFTN 476
            + + E++ F +KW+GLSLY+     + N + +       NHEYA++ SIV+ P+ IFT 
Sbjct: 333 -NKVSEEDPFYEKWRGLSLYRGTIFGKSNDDINDIDFDFANHEYAKFSSIVRTPQAIFTF 391

Query: 477 EYDIPGIVPY 486
           E DIPGIVP+
Sbjct: 392 ECDIPGIVPH 401

>TDEL0F03870 Chr6 complement(713797..722625) [8829 bp, 2942 aa] {ON}
            Anc_8.260 YLR087C
          Length = 2942

 Score = 2233 bits (5787), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1145/2580 (44%), Positives = 1610/2580 (62%), Gaps = 79/2580 (3%)

Query: 590  NISAPPESNMEFQLFDASINYGPWAHRNIMNIQRIFSPIVSRTPELQPDPEPGFLRRYTM 649
            N  APPE  ++ Q +  +I YGPWA R I ++ R+ SP V+R+        PG  R YT+
Sbjct: 416  NNGAPPEFGIDLQFYGVTICYGPWAQREIQHLLRMISPTVARSSVPIKTLSPGSRRIYTV 475

Query: 650  TKISVSIMEDSSWRVPTREPSKDQDFLKRYMKTNDSSRSFGWFDLNFSRNSEATFCISSI 709
             K +  +++ SSWR+PTRE SKDQ+FLK++  T++  R FGW DL F+ +S  +      
Sbjct: 476  FKTTFRVLDGSSWRIPTRERSKDQEFLKKFKATSEEYRPFGWLDLKFAMDSYGSVTTVLC 535

Query: 710  PDVNGYANKLNLDFKDLEVRSSVNHDIFFRSKSYRVDSDIGYPLGWNDEVTWSFVFDSYQ 769
            P   G+ NK+ + F ++E  SSVNHD+  +   + V  D+GYPLGWN   TW+    S Q
Sbjct: 536  PKEEGFPNKMYIHFAEMEATSSVNHDVMLKCNCFDVAGDVGYPLGWNSSATWTINLHSTQ 595

Query: 770  LETFFLREHLVLIADTFSDFSSGEPTPYEFFRPSIYKVDWNFHGYSAYLNVNDHNIINNP 829
            LETF LREH+ L+AD F+DFSSGEPTPYE FRP IY+++W   GYS YLNVNDHNI+NNP
Sbjct: 596  LETFLLREHVTLVADIFTDFSSGEPTPYELFRPFIYQINWIIDGYSIYLNVNDHNIVNNP 655

Query: 830  LDFNENCYISVHGDDAHIGVEIPRLGITATYTDIIFQISTPMFRXXXXXXXXXXXXEFMR 889
            LDFNENCY+S+HG++  I V  P   IT  Y D+ ++ISTPMFR            EFM+
Sbjct: 656  LDFNENCYLSLHGEELLIDVTAPNDSITGAYMDVPYKISTPMFRLLLNTPPWNTLNEFMK 715

Query: 890  NKEIGRGYDFTAEGSYIIYSDLDIDNVDSLTIECSTRRMTLLTYGFVIGYLLNVQMNYFG 949
            NKE+GR Y F   G Y +YS+LDIDNVD+L++EC++   TL  YGFV+ YL+NV+MNYFG
Sbjct: 716  NKEVGRSYSFAVCGLYTVYSELDIDNVDTLSVECTSTGTTLHCYGFVMRYLMNVKMNYFG 775

Query: 950  EFSHFITAEEYTDIVRGNDNDIVSTLADFXXXXXXXXXXXXXXXQHNPDNSS--KSNIID 1007
            +F HFIT+EEYT ++R  + + V    +                + N  N S     + D
Sbjct: 776  DFFHFITSEEYTGVIRAKEKESVGKTEE-------------ESLRDNSTNLSTDSGGLSD 822

Query: 1008 PLY----NPPLRKDDIKRKVNETDIWFTFSVWEGALLLPEVLYNSDPCIALSFKELIIDF 1063
            P      +PP+ + D+KR  NETDIWFTFSVWEGAL+LPE +YN DPC+AL F ELI+D 
Sbjct: 823  PYVRLRADPPVSRSDVKRTTNETDIWFTFSVWEGALVLPETIYNCDPCVALHFGELIVDL 882

Query: 1064 RNCDYYLDLLATLNGTSFKRCIRKNQNDIFELVHNNAIKNLEEHGSVSNISIHGHRMYGA 1123
            R+C+YY+DLLAT++ TS KR + +  +++FE +  +  +  +EHGS++ ++IHGHRMYG 
Sbjct: 883  RSCNYYMDLLATMSSTSIKRYVSRQSHELFESIRRDNGRTEKEHGSLAALTIHGHRMYGL 942

Query: 1124 PPTSPSYFSDWAVDVNNLSINSDIYFIRGFISYITKVGFEFSNLQNILLYDESVLDNMTS 1183
            PP  P+YF  W +D++ L+INSD  F +GF +    +GF ++NL+N LLYD    D+MTS
Sbjct: 943  PPIEPTYFCQWGIDLDGLTINSDAEFAKGFFTLFAGIGFGYTNLENTLLYDVETPDDMTS 1002

Query: 1184 VTVHGTGIDILVADKSTSAQVLLNMDGITFNRINFANDRYSSRIDLQVPGLHFAFFDNGS 1243
            VTV    ++++V + S+ A V  ++  +TF  I+F N+RYS RIDL+VP L      +  
Sbjct: 1003 VTVRVRDMNVVVENDSSRAVV--DVPNLTFTSIDFENERYSQRIDLKVPSLSILLLTSED 1060

Query: 1244 SMDKTCLFEFKTKINFTNFTQMKDGELHSKKQQEFIALNDSAFHRCSFLLLPHIQESLLY 1303
              +   L +  TK+  T+F Q +D   H  KQ+++I LNDS F+RCSFLL  ++QES LY
Sbjct: 1061 DSEPIRLMDLTTKVYLTDFIQKRDFAKHRSKQRDYITLNDSPFYRCSFLLPCYLQESPLY 1120

Query: 1304 HELYGGITXXXXXXXXXXXXQAETIAFIIDDFLGPFGINSTELLGSISTSTPIHXXXXXX 1363
              L G I+             AETI FII+D LG F      L     T   +       
Sbjct: 1121 KSLLGSISPSSSLPPLPMPLLAETIDFIIEDLLGEFAAG---LKCDYDTQRTVDDPDSPS 1177

Query: 1364 XXXXXXVIHP---------IESMQSHLVPSQSVTHGNYIIDISYITLDINPLFFTYASNF 1414
                    H             +   L P+    + N IID+ ++ +D++PL  +Y    
Sbjct: 1178 ESFDTSQEHEGPDDVRYDRFAQLPKILSPNPLEQYDNVIIDVKFLAVDLDPLICSYVDGL 1237

Query: 1415 LDEFYSENIIETIDGIEMAIVNRLGTKSEELDSVTNIKLQIKYLDFFFGQRNTEGLELYV 1474
            L EF+  N ++ ID IEM+IV RLG        V N+KL +  ++FF+G +N + ++LY 
Sbjct: 1238 LGEFWKVNTVDIIDEIEMSIVKRLGQLWNN-TCVLNLKLYVVDINFFWGDKNAKVVDLYF 1296

Query: 1475 DQIDLEVSQKTFQKKSTVVLDEIAILSRFLSLRASINEKKVLEDFDERPPALSLALEGWE 1534
            D++D ++ Q+T       ++ E   LS+  S+RA++ ++ + E  +ERPPALSLA+EGWE
Sbjct: 1297 DKLDFDLGQRTRDLDGETIVSEKITLSKLRSVRATVFDRSITEGVEERPPALSLAVEGWE 1356

Query: 1535 GWSSTASSQVNSLNISSTDITVDESQIEWLIDYLNRLVVFVHELVNSLDSIQKKSNGIQK 1594
             +S      V S+++ STDITVDESQ+EWL  Y+      +  ++ S   + +   G ++
Sbjct: 1357 AYSWMREKIVGSVSLLSTDITVDESQLEWLSVYIAEQRDLIKNMLTSFTKLHEYWQGTRR 1416

Query: 1595 KLVSDLTLASEYYQISHDPYVITKPAYVMRVSKGHVRQNRSWRIVTRLRHIYTYLPDDWE 1654
             L+ D+T ASE+YQISH+PYVITKPA++MR+S GHVR+N SWRI+TRLRHI TYLP++W 
Sbjct: 1417 DLLRDITTASEHYQISHEPYVITKPAFIMRLSNGHVRENPSWRIITRLRHILTYLPNEWR 1476

Query: 1655 IHVQEEMRGKDMNDVSDSSDIFLTVFSNWRNWEVSDVARSYIYKKIFLSNDETTSEKKLQ 1714
             +         ++   DS+D   +V S+WR WE+SD+ RSYIY+ IFLS+   T  + L+
Sbjct: 1477 NN-----SAIQVSPTVDSTDA--SVASHWRRWEISDITRSYIYRTIFLSDQSKTQCQSLK 1529

Query: 1715 TTVKLNLNSIFFTIYSTGYAIDHNIILTKAVILLELTTETAVSPPIEK----SILNMTGS 1770
              +K++ +S FFTIYS GY + HN ++T+A I+ E      +S   +     +++N+T S
Sbjct: 1530 KMLKVDFHSFFFTIYSEGYRVAHNFVITRANIVGEEIPAAELSKVQQALDYDNVMNLTVS 1589

Query: 1771 LGSIKGEFSDKFLRLLELIPDFSKEEDIKSLTENSSIVSEKSPYFTIHLFLLFENGGLQL 1830
            LG+IKGE +D+ L+L  +   FSK +        +SI   KS  + +++ L F+   LQ 
Sbjct: 1590 LGAIKGELNDQLLKLRNI---FSKAQTPALKRSKTSINISKS--YKVNVLLAFDRSELQF 1644

Query: 1831 TMGDTTLSNNVTDGKISAXXXXXXXXXXXXXXGAYYMKKSEMCLKHNKDIIAEFQLHHLG 1890
             +G T L+N + +GK +                 ++ K+SE  LKH   ++AE     L 
Sbjct: 1645 VLGQTRLTNRILNGKAALLLEKLKNSAAPALSFVFFAKRSESWLKHADLVLAEALSRELS 1704

Query: 1891 LISTGIYTPICPVILINLRSADLHFKSLASTEKIVKTIEDITEYSVHLYKHYDLRKYTTK 1950
            L  T       P + IN++ ++ H +++ STE +V +I+ I E    L +H+ + K T  
Sbjct: 1705 LTMTAELWSYMPSLSINIQCSNSHIRAMTSTELLVNSIKQIMESISELKRHFAMEKTTPN 1764

Query: 1951 PTKVDQKPEKINFDVRVACNLSKVSAELTLISPFYLRYETKQLDLYFNQNGDGEILLSLW 2010
                         +  +  + S V+AEL  ++PF +R+E KQL LY N+    EIL+S+W
Sbjct: 1765 VQGTSTNLSIPLQNTALTVSFSDVTAELMPLTPFVVRHEMKQLGLYLNRVQSNEILISIW 1824

Query: 2011 DTDIFVTSHHTKEQYFRFSYDDIQINCNPMSEXXXXXXXXXXXXXXXXTFSEPRRIFASF 2070
            D +I + SH T EQYF F+  D+Q+ CN  +E                T SEPRRI +SF
Sbjct: 1825 DANIILKSHQTTEQYFNFALGDLQVKCNLPTESSAILNVGLSTSLMKLTLSEPRRILSSF 1884

Query: 2071 LQDERITIESFQELKKLKKIFFSNAKNVKKLNNDVPKEDTPTKWALELNINYFGILLPIA 2130
            LQDE++  ES   +K L ++F   A+N          + +  +W+L+ N+NYFGIL+P+A
Sbjct: 1885 LQDEKLIGESLGYIKGLLQLFSPLARN--------KTQSSALRWSLDANLNYFGILVPMA 1936

Query: 2131 STFFVLELHMLLGSLTNTTEEIQEVNNQISGQISLENILFLINDRSLPLRLSKLVDFSIR 2190
            STFFV E+HMLL ++ N ++   E ++ ++GQ+S+EN L LI + SLP  LSKL+DFSIR
Sbjct: 1937 STFFVFEIHMLLAAMNNASDGQDEGDHHVTGQVSIENCLLLIKEPSLPADLSKLLDFSIR 1996

Query: 2191 ISTLQKTTSSYESLQIESSHFRMCFSPESLVFVLWGVKQLQNELEYYKDHKTKRQWNLXX 2250
            + + QK  +S +S QIESSHFR+C SP SLV VLWG  QLQ+ LEY++ H+ K+   +  
Sbjct: 1997 VMSSQKVPNSPQSYQIESSHFRVCLSPGSLVQVLWGTHQLQSLLEYFRKHR-KQDKAISP 2055

Query: 2251 XXXXXXXXXXXXPLNYFRSIHILSYNFCIGWMLPENQKDIPGWMFGYDRLFSAYEKNYGK 2310
                         ++ FRSIHILSYN CIGWM         G + G+DRLFSAYEK+YGK
Sbjct: 2056 FSLFDGSASADRQID-FRSIHILSYNLCIGWMFQLGDDVKTGLIIGFDRLFSAYEKHYGK 2114

Query: 2311 LTLIEGYMSVTNSNSSNDFFSQGEEKNRHNRSFLPSMQILYWLKEFNSKKDLFIRLHGDA 2370
            LTLI+GY SV N  S++ F+SQG EK R+NRSFL ++QI YWLKE +S KDLFIR++G+A
Sbjct: 2115 LTLIDGYFSVANGQSTDTFYSQGSEKQRYNRSFLSNVQITYWLKEIDSMKDLFIRVNGEA 2174

Query: 2371 LDVDILSNFVNIIELIFKSYQIFEDFRKSKIVQNIEKQKHHEHIKSENATEFVPTFLSDI 2430
            L+V +LSN  +IIE    S Q F+  +K ++ +     ++  ++  EN +  +  FLS I
Sbjct: 2175 LEVSLLSNSFDIIESTLASIQKFQTLKKERMHKRDSGPRNKLNL--ENTSNNISPFLSHI 2232

Query: 2431 NSINCEFKYEGGTLRVFSVDDVEIDSTPSLELNAPKVSIYLNYKHFDDSPKPHWLRCVID 2490
             +I+C+FKY GG L+++S+DD+     PSLE+ +P V I L Y H +   +PH +RC++ 
Sbjct: 2233 RTIDCQFKYVGGVLKIYSLDDLNRAEGPSLEIKSPGVVIALKYNHNEAERRPHRIRCLVS 2292

Query: 2491 IHSSHNILYSKCAPFVIEFVESIQEILENR-----PVEPKQSVSKIATPNRTYKRILAPF 2545
            I  +HNILYS+C P + + VE+ Q +++       P+E  QS+         YK +L  F
Sbjct: 2293 IDPTHNILYSQCVPILNDIVEASQRMVQKHSPDETPLESSQSID--------YKSLLDSF 2344

Query: 2546 DIAFRIKAAKQMLSFSCEPSAKVQANVGLDSFLFGISTGGSSVEDPLSLTLCINKISTSV 2605
            DIAF++ + +Q LS SCEP AKVQA+VG DSF FG++T      +P  ++L + KI +SV
Sbjct: 2345 DIAFKVTSGRQQLSLSCEPRAKVQADVGFDSFTFGVTTNDLVDGNPTGVSLSVEKIQSSV 2404

Query: 2606 QHIFSKEASASFSLNFIDLTFIFTQPTLYCVGLISDIDIFFNMKQQQNLLLFLDIWHLSE 2665
            +HIFS+E SASFS++F+D T IFT P ++ V L+SDI++FFNMKQ QNL LFLDIW L+ 
Sbjct: 2405 RHIFSRETSASFSVDFVDFTSIFTHPDVFGVALVSDINVFFNMKQLQNLNLFLDIWQLNG 2464

Query: 2666 SIGIRPNXXXXXXXXXXGHTQIPETPQPGKIIPWNFNIIFTNVNADIHLGPALGIVSAKL 2725
             +  +                + +       I W+F +IFTNV  D+ LGP+LG++S +L
Sbjct: 2465 KLNNKGRAKDDDRKKQTKSMTLSKRTSTPTSICWSFTLIFTNVKGDVDLGPSLGVLSLRL 2524

Query: 2726 EKTWFISDRYLDKRQILQLFTDGMVLKSRGRLSGMLDISNAGWRLEVNYADNELNYNSPI 2785
             +TWF +D Y  +R++L  F D + +KS GRLSG+ D+ NA W  EVNY        S  
Sbjct: 2525 SRTWFATDHYGAQRRVLHAFADELSIKSEGRLSGVFDLKNATWISEVNYPAAGSIKGSSE 2584

Query: 2786 VAIGIDIGCVALKTAFDYHMFMISKVNNIHFRLHSERDPEGKLPDXXXXXXXCEEISICS 2845
            +++ + +G VA+KTAFDYHMF+I  ++ + F L SE D  G LPD       C+E+  C+
Sbjct: 2585 MSLSLSVGRVAIKTAFDYHMFLIGTIDEMKFHLRSESDLYGILPDLLVVALSCKEMDFCA 2644

Query: 2846 TTLVASNILDIYNTIIRTRQDTKNSYFETLMESNNQDTRTNIPYSDILKSLNLLRTDVQI 2905
            T L A+NILDIYNTI R RQD + SY ETL ESN+ + R  + Y DIL+SLNLLRTD+  
Sbjct: 2645 TALTAANILDIYNTITRMRQDNRISYIETLRESNSTEARVTLLYDDILQSLNLLRTDLSF 2704

Query: 2906 DVSKLQLQISPISLFDFEVLVINIDNMSARSETTSTDKLKTRLELQVCNASVALSTAKEE 2965
            D++  + QISPISLFD EVLV+NIDN+SARSET S +KLKT L LQV NA V+LST+KEE
Sbjct: 2705 DITTFKAQISPISLFDVEVLVLNIDNVSARSETQSGEKLKTELHLQVSNAKVSLSTSKEE 2764

Query: 2966 LDEESVNKISVADYMTYASKIKGGTILIIPKLLVGMTTWQKVTSNTIEYTFTCKFDGKVS 3025
            LDEE V KIS+ DYM YASKI GGTI+ +P+LLV MTTWQK  S+ IEY FTC+F  +V+
Sbjct: 2765 LDEERVAKISIEDYMLYASKISGGTIVKVPRLLVSMTTWQKPKSDLIEYLFTCRFFDRVA 2824

Query: 3026 VRWNLGPVNFIKEMWATHVKSLAVRQARXXXXXXXXXXXXXXXXXXXXXXPAQPKFTYVA 3085
            V+WNLGP+NFIKEMW+TH+KSLAVRQ +                        + K  YV 
Sbjct: 2825 VKWNLGPINFIKEMWSTHIKSLAVRQTQSNKTMSEKDKQADLDPEEEI----KAKLQYVP 2880

Query: 3086 LVEPSIEMPQIKDLEDATPPMEWFGLNRKKFPSFTHQTAVIVVQKLVHAVEKEYAKIIGH 3145
            L EP IEMPQIKDL DATPPMEWFG++RK+ P+ THQ A++++QKLVHA EKEYAK+ G 
Sbjct: 2881 LDEPYIEMPQIKDLGDATPPMEWFGVHRKRLPAATHQLAIVLIQKLVHAAEKEYAKVQGR 2940

 Score =  179 bits (454), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 84/182 (46%), Positives = 120/182 (65%), Gaps = 2/182 (1%)

Query: 1   MVDEPKFVSVSLSREKYFSWVFLVTWILTCILCLLMFFYIDRVFAYSLTFILDWLLWRPY 60
           M  + +F  VSLS E+ FSWVFLV W+L C++ L + FY+ R+FAY++T +L+W LW+ +
Sbjct: 1   MEGQSQFERVSLSNERNFSWVFLVDWVLLCVVTLTVIFYLGRLFAYAITLVLEWFLWKHW 60

Query: 61  KVKIHCEXXXXXXXXXXXXFKNLCIITENSTISILEGKIIWQYWLLNTRVSAYELHQQQK 120
           KVKI  E            F+NLCII ++ TISIL+G + W+Y LL TR S YE    QK
Sbjct: 61  KVKISVESLRIAPLSGSILFRNLCIIGKDQTISILKGSLRWRYRLLATRRSQYEEASSQK 120

Query: 121 EHGYITPG--SGFKNIQLPCKFLFQCEGAEIFVYNKTSAYENIIDSFSPDEKIKYKEFLH 178
           +   +     +  KNI LPC+F+  CEG EIF+YN+T AYENII  FS +E++++++F+ 
Sbjct: 121 DGLGVGEEDVNSMKNITLPCRFVLFCEGFEIFIYNRTVAYENIIQMFSREERVQFEKFMS 180

Query: 179 KH 180
           K 
Sbjct: 181 KQ 182

 Score =  143 bits (360), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 78/190 (41%), Positives = 111/190 (58%), Gaps = 19/190 (10%)

Query: 298 LNFYPFGLKLTKGSIIFGNKFTPSLLIISYKSAEGIVDVLPATNPRVDLYKMKMKLDFQN 357
           + F P  L+L++GSI+ GNKFTPSLLI S  S  G+VD L     ++DLYKM  ++DF +
Sbjct: 232 MRFLPMELQLSRGSIVLGNKFTPSLLIASCTSGRGVVD-LCQPKEKLDLYKMHFQVDFID 290

Query: 358 FEIEVKPNISYEDDSKPKAFYCDSMLSRLWTKFSTLFDIMPNPLSRYIHFSRLHKNSLFL 417
            +I ++ NI Y   ++ KA + +  LSR+W  F  +  I   P      +++ H N    
Sbjct: 291 IDISIRQNIEY---NRKKATFKNGKLSRMWATFVKVLHI---PF-----YNKSHNN---- 335

Query: 418 EDNIFEDEDFEKKWKGLSLYKDAALNR-GNPEEHIEFDFLNHEYARYCSIVKAPRLIFTN 476
                E E F  KWKGL LYK    +R G   + + FDF NHEYA+  +I+K+PR + T 
Sbjct: 336 --KGTESEPFMTKWKGLGLYKGLTFDRDGEDYDEVHFDFANHEYAKVSNIIKSPRTVLTY 393

Query: 477 EYDIPGIVPY 486
            YDIPG+VP+
Sbjct: 394 SYDIPGVVPH 403

>KAFR0B02720 Chr2 complement(549702..558650) [8949 bp, 2982 aa] {ON}
            Anc_8.260 YLR087C
          Length = 2982

 Score = 2227 bits (5771), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1149/2626 (43%), Positives = 1625/2626 (61%), Gaps = 103/2626 (3%)

Query: 561  GASPDTDRNNESDASNNQQRNTYSRSTTDNISAPPESNMEFQLFDASINYGPWAHRNIMN 620
            GA P     +  D  NN               APP  +++ Q+F  SI YGPW  R +  
Sbjct: 419  GAHPTNSEIDGPDVGNN--------------GAPPTHSLDIQIFGGSICYGPWTQRQMNF 464

Query: 621  IQRIFSPIVSRTPELQPDPEPGFLRRYTMTKISVSIMEDSSWRVPTREPSKDQDFLKRYM 680
            I  + +P VSRT        PG  R YT TK+S+SIM+D++WR+ TREPSKD  FLK Y 
Sbjct: 465  IHSMLAPAVSRTESPVKRRVPGSTRIYTATKLSISIMDDTTWRIATREPSKDNIFLKHYK 524

Query: 681  KTNDSSRSFGWFDLNFSRNSEATFCISSIPDVNGYANKLNLDFKDLEVRSSVNHDIFFRS 740
            +TND  R FGW DL FS+ S A F  + +P   G+ N +N+     E+RSSVNHDI  + 
Sbjct: 525  ETNDDYRPFGWIDLRFSKESYAYFTFALVPTTEGFKNDINIHLAQNEIRSSVNHDILMKC 584

Query: 741  KSYRVDSDIGYPLGWNDEVTWSFVFDSYQLETFFLREHLVLIADTFSDFSSGEPTPYEFF 800
            K +  D D+ YPL WND  TW+   +S QLETF LREH+ LIADT +DF+SGEPTPYE F
Sbjct: 585  KFFDFDIDVSYPLVWNDRATWTIDMNSNQLETFLLREHITLIADTLTDFTSGEPTPYELF 644

Query: 801  RPSIYKVDWNFHGYSAYLNVNDHNIINNPLDFNENCYISVHGDDAHIGVEIPRLGITATY 860
            RPS   ++W    Y  YLNVNDHNI+NNPLDFNENCY+S+HGDD  I V IP   ITA +
Sbjct: 645  RPSETFINWKMDAYFIYLNVNDHNIVNNPLDFNENCYLSLHGDDLLINVTIPSEDITAQF 704

Query: 861  TDIIFQISTPMFRXXXXXXXXXXXXEFMRNKEIGRGYDFTAEGSYIIYSDLDIDNVDSLT 920
             +I + I+TPMFR            EFM+ KE+GR YDF+A+GSY++YS+LD+DNVD+++
Sbjct: 705  NEITYNITTPMFRLLLNTPPWNTLNEFMKYKEVGRSYDFSAKGSYLLYSELDVDNVDTIS 764

Query: 921  IECSTRRMTLLTYGFVIGYLLNVQMNYFGEFSHFITAEEYTDIVRG---NDNDIVSTLAD 977
            I C +R  TL  YGFVI YL NV+MNYFG+F +FIT+EEYT I R     +  I S L+D
Sbjct: 765  IICESRGTTLQCYGFVIRYLANVKMNYFGDFFNFITSEEYTGITRDEELEEELISSNLSD 824

Query: 978  FXXXXXXXXXXXXXXXQHNPDNS-----SKSNIIDPLYN-----PPLRKDDIKRKVNETD 1027
                              N DN       +S + D +         L++ D++R  NETD
Sbjct: 825  ------------------NEDNGDVYSDGESGMDDAISQEIPERTTLKRSDLRRTANETD 866

Query: 1028 IWFTFSVWEGALLLPEVLYNSDPCIALSFKELIIDFRNCDYYLDLLATLNGTSFKRCIRK 1087
            ++ TFSVW+GA++LPE +YN D C AL F ELIID R+ +YY+DLLA+L  T  +R   K
Sbjct: 867  LFLTFSVWDGAIILPETIYNCDNCTALKFGELIIDLRSSNYYMDLLASLEDTVMERYTEK 926

Query: 1088 NQNDIFELVHNNAIKNLEEHGSVSNISIHGHRMYGAPPTSPSYFSDWAVDVNNLSINSDI 1147
            +  DIF+ V ++  ++ E  G +S++SIHGHRM+G PP  P+YF  W  D+  L++NS+ 
Sbjct: 927  SPIDIFKSVLHDNRESSEAQGFLSDLSIHGHRMFGLPPNEPTYFCKWDFDIGVLNVNSEF 986

Query: 1148 YFIRGFISYITKVGFEFSNLQNILLYDESVLDNMTSVTVHGTGIDILVADKSTSAQVLLN 1207
             F++GF++  +++GF F +L+NILLY + V+++MTS+TV+   I + + ++ +   + L 
Sbjct: 987  DFLKGFLTSFSRIGFGFKDLENILLYSKEVINDMTSLTVNAQEISVNLKNEVSGIDMALK 1046

Query: 1208 MDGITFNRINFANDRYSSRIDLQVPGLHFAFFDNGSSMDKTCLFEFKTKINFTNFTQMKD 1267
               + F  I+F +  YSSR+DL +P L  + +       K  LF F TK++ T+F Q K+
Sbjct: 1047 TQHVNFTSIDFESANYSSRLDLIIPSLKMSMYGLDIDGKKARLFNFTTKVHLTDFAQKKN 1106

Query: 1268 GELHSKKQQEFIALNDSAFHRCSFLLLPHIQESLLYHELYGGITXXXXXXXXXXXXQAET 1327
             + H   Q+ +I LND+AFHR SFLL    Q+  LY+ELYG I               +T
Sbjct: 1107 FKRHRSMQRNYITLNDAAFHRTSFLLPQSFQKKELYNELYGSIVPSSSLPVLALPILPKT 1166

Query: 1328 IAFIIDDFLG--------------PFGINSTELLGSISTSTPIHXXXXXXXXXXXXVIHP 1373
            + FI++DFLG              PFG          ST+TP               + P
Sbjct: 1167 VDFILEDFLGEYVSLLDDRTIFRMPFG----------STNTPNQASTHHEED-----MDP 1211

Query: 1374 IESMQSHLVPSQSVTHGNYIIDISYITLDINPLFFTYASNFLDEFYSENIIETIDGIEMA 1433
            +E   S +   ++    N +IDI YI+++INP   TY  +     Y ENI++ ID IE+ 
Sbjct: 1212 LEFSNSTVSTEKNYQCDNLVIDIEYISVEINPSISTYIESLSSTVYEENIVQVIDDIEIE 1271

Query: 1434 IVNRLGTKSEELDSVTNIKLQIKYLDFFFGQRNTEGLELYVDQIDLEVSQKTFQKKSTVV 1493
             +  L T  E   S+TNIKL++ Y D ++G+R+  G+ELY+D++D E+SQ+  +K     
Sbjct: 1272 TIKILSTFQEGTSSITNIKLRVLYSDIYWGERDRYGIELYLDKLDFEMSQRNIEKDREKG 1331

Query: 1494 LDEIAILSRFLSLRASINEKKVLEDFDERPPALSLALEGWEGWSSTASSQVNSLNISSTD 1553
            L EI +L++  S+RASI+E+   ++  ERPPALSL +EG E WS+TA  QVNS++  STD
Sbjct: 1332 LLEITMLAKTRSIRASISEEGSTKNEKERPPALSLVVEGCELWSATAEKQVNSIDTISTD 1391

Query: 1554 ITVDESQIEWLIDYLNRLVVFVHELVNSLDSIQKKSNGIQKKLVSDLTLASEYYQISHDP 1613
            IT+DESQ+EWL  ++N     +  ++ +L+S+Q +    ++KL+S LT A+++YQISHDP
Sbjct: 1392 ITIDESQLEWLFLFVNEQNQNLQNIITTLNSVQAEHTVSRRKLISKLTAANDFYQISHDP 1451

Query: 1614 YVITKPAYVMRVSKGHVRQNRSWRIVTRLRHIYTYLPDDWEIHVQEEMRGKDMNDVSDSS 1673
            YVITKPA++ R+SKGHVR+NRSW+I+TRLRHI TY+P DWE  V+  ++ K +ND  ++ 
Sbjct: 1452 YVITKPAFITRLSKGHVRENRSWKIITRLRHILTYIPSDWESGVENYLKEKSLNDQDEAK 1511

Query: 1674 DIFLTVFSNWRNWEVSDVARSYIYKKIFLSNDETTSEKKLQTTVKLNLNSIFFTIYSTGY 1733
             +F++VFSNWRNWE SDVARSYIY ++FL+N     ++ ++  +K+NL+S F T Y+ GY
Sbjct: 1512 KVFMSVFSNWRNWEFSDVARSYIYGRLFLTNQAEKHKQSMRRIIKVNLSSFFLTSYTAGY 1571

Query: 1734 AIDHNIILTKAVILLELT---TETAVSPPIEKSILNMTGSLGSIKGEFSDKFLRLLELIP 1790
             ID N +LT A I+ E T   TE  VS    + ++N+TGS+GS+KG FSD+ LRL ELIP
Sbjct: 1572 DIDQNFVLTNANIVFEQTPPFTEAGVS---REKLINLTGSIGSVKGNFSDELLRLKELIP 1628

Query: 1791 DFSKEEDIKSLTENSSIVSEKSPY-FTIHLFLLFENGGLQLTMGDTTLSNNVTDGKISAX 1849
              +KE++   +  + S   +  P  F ++  LLFE   +QL +G++ L+N + +GK+S  
Sbjct: 1629 LLNKEQE--KMERSPSFQVDNIPKSFKLNALLLFEKTEVQLVIGESKLTNRILNGKVSLL 1686

Query: 1850 XXXXXXXXXXXXXGAYYMKKSEMCLKHNKDIIAEFQLHHLGLISTGIYTPICPVILINLR 1909
                            Y K+SE  + H    + E Q+    L +T       P +L++ +
Sbjct: 1687 LDHPKEAISPAGSIILYAKRSETLITHRNTTLVENQVRDFSLSATVESWSSKPTVLVSTQ 1746

Query: 1910 SADLHFKSLASTEKIVKTIEDITEYSVHLYKHYDLRKYTTKPTKVDQKPEKINFDVRVAC 1969
             A  H KS+A T  +V +++++ +   ++ K   +     +      K +  + ++ V C
Sbjct: 1747 CAHFHIKSMAKTATLVNSVKEMVQTVKNIDKQLSISDRLAEGENKSPKKKLKDVEIEVVC 1806

Query: 1970 NLSKVSAELTLISPFYLRYETKQLDLYFNQNGDGEILLSLWDTDIFVTSHHTKEQYFRFS 2029
             LS VS E+  ISPFY+R+ETK+ DL F Q G   +++ +WDTD F+ S  TK+QYFR S
Sbjct: 1807 QLSNVSFEIMPISPFYIRHETKKFDLKFKQFGSQNVMIDVWDTDFFLRSDLTKQQYFRIS 1866

Query: 2030 YDDIQINCNPMSEXXXXXXXXXXXXXXXXTFSEPRRIFASFLQDERITIESFQELKKLKK 2089
            + D QI  N +                  TFSEP RI +SFLQDER   ESF+ LK LK 
Sbjct: 1867 FGDFQITYNLIEGEFIIVDANVSASMIKLTFSEPNRILSSFLQDERTASESFKLLKALKP 1926

Query: 2090 IFFSNAKNVKKLNNDVPKEDTPTKWALELNINYFGILLPIASTFFVLELHMLLGSLTNTT 2149
                  +   +L     KE    +W L+ +I YFGIL+PI++T+FV E H L+ S+++  
Sbjct: 1927 FLLPQTEG--RLQPATTKE---MRWLLDTDIKYFGILVPISTTYFVFETHALVLSMSDID 1981

Query: 2150 EEIQEVNNQISGQISLENILFLINDRSLPLRLSKLVDFSIRISTLQKTTSSYESLQIESS 2209
             E     ++   Q+S+EN++FLI DR +P  LS+++DFSI  ST+QK      S Q+ES+
Sbjct: 1982 TEKYTEKDETQSQVSIENVVFLIKDRGIPSALSRMLDFSISFSTIQKMMELDTSFQVESN 2041

Query: 2210 HFRMCFSPESLVFVLWGVKQLQNELEYYKDHKTKRQWNLXXXXXXXXXXXXXXPLNYFRS 2269
            HFR+  SP SLV ++WG +Q      YYK+ +    W++                    S
Sbjct: 2042 HFRIFLSPYSLVRLVWGGQQFLGLANYYKEQRGTDLWDIKASKLKKEKKGSSSIGMNMSS 2101

Query: 2270 IHILSYNFCIGWMLPENQKDIPGWMFGYDRLFSAYEKNYGKLTLIEGYMSVTNSNSSNDF 2329
             H+LSYNFCIGWM PE     PG M G+ RLFSAYE  YGKLTL++ + SV    +S  F
Sbjct: 2102 FHVLSYNFCIGWMFPEANASAPGIMLGFSRLFSAYEGGYGKLTLVDAFFSVARGATSATF 2161

Query: 2330 FSQGEEKNRHNRSFLPSMQILYWLKEFNSKKDLFIRLHGDALDVDILSNFVNIIELIFKS 2389
            + +  E    NRS+LP+MQI YW+K+    KD+FIR HG+ALDV  L+ F+ +IE + +S
Sbjct: 2162 YPRESELESVNRSYLPNMQIAYWVKKSGLMKDVFIRFHGEALDVSFLTTFITVIESMLQS 2221

Query: 2390 YQIFEDFRKSKIVQNIEKQKHHEHIKSENATEFVPTFLSDINSINCEFKYEGGTLRVFSV 2449
            +Q+F++ + S I  N    +++    +E   + +  FLS+I S+NC+FKY+GG  +VFS 
Sbjct: 2222 FQVFQELKTSLIQPNTSTTENN----TEPKIKSLAPFLSNIKSVNCQFKYDGGVFKVFSF 2277

Query: 2450 DDVEIDSTPSLELNAPKVSIYLNYKHFDDSPKPHWLRCVIDIHSSHNILYSKCAPFVIEF 2509
            +D+E    PS EL  P V I  NYKH   S KPHW+R ++ I S+HN L++ CAP + EF
Sbjct: 2278 EDIESHLEPSFELKTPGVIIDFNYKHNIGSLKPHWIRALVAIGSTHNTLFAVCAPLIAEF 2337

Query: 2510 VESIQEILENRPVEPKQ-----SVSKIATPNRTYKRILAPFDIAFRIKAAKQMLSFSCEP 2564
            +E I E+++      K      ++SK  + N  YKR+L  FDIAF++ +++Q LS SCEP
Sbjct: 2338 LEHIHEMVKKHSSNTKHESIATNLSKAPSQNIDYKRLLDGFDIAFKLTSSEQKLSLSCEP 2397

Query: 2565 SAKVQANVGLDSFLFGISTGGSSVEDPLSLTLCINKISTSVQHIFSKEASASFSLNFIDL 2624
             AKVQA+VG DSF+ GI T      +PL+ +L I K   S++HIFSKE S SF L+ IDL
Sbjct: 2398 KAKVQADVGFDSFIIGIVTNNLDETEPLTFSLSIKKTKASIKHIFSKETSTSFGLDLIDL 2457

Query: 2625 TFIFTQP---TLYCVGLISDIDIFFNMKQQQNLLLFLDIWHLSESIGIRPNXXXXXXXXX 2681
             F+FT P    +Y  GLIS++D++FN+KQ QNL LF+DIW LS  I   P          
Sbjct: 2458 NFMFTHPDIINMYGTGLISEVDLYFNVKQLQNLYLFIDIWKLSSFIRPGPKGKSNNGKRE 2517

Query: 2682 XGHTQIPETPQPGKIIPWNFNIIFTNVNADIHLGPALGIVSAKLEKTWFISDRYLDKRQI 2741
              H  +P+       IPW+F +IFTN+N    LGP+LG++S KL++TW  SD Y DKRQ+
Sbjct: 2518 NKHLTLPQPSNLYGEIPWSFTLIFTNINGSADLGPSLGVLSLKLKRTWVASDHYQDKRQV 2577

Query: 2742 LQLFTDGMVLKSRGRLSGMLDISNAGWRLEVNYADNELNYNSPIVAIGIDIGCVALKTAF 2801
            ++ FTD +   S+GRLSG+ ++  A W  EV++   +  +N P+V + ++I  ++LK AF
Sbjct: 2578 IRAFTDYLSFVSKGRLSGIFELDGASWMSEVSWPKEKRTHNYPLVNVSVNIDNLSLKAAF 2637

Query: 2802 DYHMFMISKVNNIHFRLHSERDPEGKLPDXXXXXXXCEEISICSTTLVASNILDIYNTII 2861
            DYHMF+I  ++   F LHSE+D  G +PD       CE I+ICST LVA+NILD+YNT++
Sbjct: 2638 DYHMFLIGTISTAKFSLHSEKDIVGTMPDLLKVNFTCEMINICSTALVAANILDLYNTVM 2697

Query: 2862 RTRQDTKNSYFETLMESNNQDTRTNIP-YSDILKSLNLLRTDVQIDVSKLQLQISPISLF 2920
            R RQD K  Y ETL ES+  +TR N   Y DIL+SLNLL+TDV  ++  L+LQ+SPI+LF
Sbjct: 2698 RMRQDNKILYLETLRESDTLETRGNPDNYRDILRSLNLLQTDVSTNIHVLKLQVSPIALF 2757

Query: 2921 DFEVLVINIDNMSARSETTSTDKLKTRLELQVCNASVALSTAKEELDEESVNKISVADYM 2980
            D EVLVINI+N+SAR+ T + +KLKT LEL+V +  VALST+K E+DE++V+ ISVADYM
Sbjct: 2758 DLEVLVINIENISARAGTFAGEKLKTILELEVYDGYVALSTSKREIDEDTVSAISVADYM 2817

Query: 2981 TYASKIKGGTILIIPKLLVGMTTWQKVTSNTIEYTFTCKFDGKVSVRWNLGPVNFIKEMW 3040
             YASKI GGTI+ +PKL + MT+WQ+  S+ +EY + C F+ K++V+WNLGPVNFIKEMW
Sbjct: 2818 EYASKISGGTIIEVPKLNIAMTSWQEENSDILEYLYKCTFEDKIAVKWNLGPVNFIKEMW 2877

Query: 3041 ATHVKSLAVRQARXXXXXXXXXXXXXXXXXXXXXXPAQPKFTYVALVEPSIEMPQIKDLE 3100
             THVK+LAVR+++                       +  K  YV + EP I+MPQI+DL 
Sbjct: 2878 TTHVKALAVRRSQNVLDTDMQTDEEVQKRIKEEENIS--KLKYVPIEEPRIDMPQIRDLG 2935

Query: 3101 DATPPMEWFGLNRKKFPSFTHQTAVIVVQKLVHAVEKEYAKIIGHS 3146
            DATPP+EWFG+NRK+ P+FTHQT V+ VQKLVHA EK+YA ++ +S
Sbjct: 2936 DATPPLEWFGVNRKRLPAFTHQTVVVPVQKLVHAAEKQYASLLDNS 2981

 Score =  168 bits (426), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 81/180 (45%), Positives = 116/180 (64%), Gaps = 5/180 (2%)

Query: 1   MVDEPKFVSVSLSREKYFSWVFLVTWILTCILCLLMFFYIDRVFAYSLTFILDWLLWRPY 60
           M    +F SV +S  K FSWVFL+ WIL  +LCL + FY+ R  AY  + IL+WLLW+  
Sbjct: 1   MASSSEFQSVPISGGKNFSWVFLLDWILLVVLCLSVIFYVGRAIAYITSLILEWLLWKRA 60

Query: 61  KVKIHCEXXXXXXXXXXXXFKNLCIITENSTISILEGKIIWQYWLLNTRVSAYELHQQQK 120
            +K++ E            FKN+ II ++ TIS+L+G + W+YWLL TR  +Y  H + K
Sbjct: 61  HIKVNIESLRISLLGGRIFFKNVTIIHKDYTISLLQGTLTWRYWLLKTRKPSY--HLESK 118

Query: 121 EHGYITPGSGFKNIQLPCKFLFQCEGAEIFVYNKTSAYENIIDSFSPDEKIKYKEFLHKH 180
           +   +T     KN QLPC+F+  CEGAEIFVYN+T +Y+NII+ FS +E+IK+++FL + 
Sbjct: 119 DSNGVTMK---KNEQLPCRFVLHCEGAEIFVYNRTWSYDNIINLFSKEERIKFQKFLDEQ 175

 Score =  141 bits (355), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 80/191 (41%), Positives = 113/191 (59%), Gaps = 14/191 (7%)

Query: 298 LNFYPFGLKLTKGSIIFGNKFTPSLLIISYKSAEGIVDVLPATNPRVDLYKMKMKLDFQN 357
           L  +P  +++ + S+ FGNKFTPSL+IIS +   GI+D       ++DLYKMK+ ++  N
Sbjct: 240 LQTFPVEIEVHRASLAFGNKFTPSLVIISSEHGTGIIDYCQPKE-KLDLYKMKLAIETHN 298

Query: 358 FEIEVKPNISYEDDSKPKAFYCDSMLSRLWTKFSTLFDIMPNPLSRYIHFSRLHKNSLFL 417
           F + VKPNI Y+++   K       LSRLW +F+ +  I+  PL       R  K +   
Sbjct: 299 FAVTVKPNIGYKEEMLLKFKIDRGKLSRLWKRFTPITGIITRPLGLT---QRKKKRN--- 352

Query: 418 EDNIFEDED-FEKKWKGLSLYKDAALNRGNPE-EHIEFDFLNHEYARYCSIVKAPRLIFT 475
                E  D F +KW+GLSLYK         + + I+FDFLNHEYA++ S+VK P+ IFT
Sbjct: 353 -----EPPDLFIQKWQGLSLYKGTIFEPTTDDLDDIQFDFLNHEYAKFSSVVKCPKAIFT 407

Query: 476 NEYDIPGIVPY 486
            EYDIPG VP+
Sbjct: 408 YEYDIPGCVPH 418

>Kpol_392.7 s392 (10369..19356) [8988 bp, 2995 aa] {ON} (10369..19356)
            [8988 nt, 2996 aa]
          Length = 2995

 Score = 2151 bits (5573), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1139/2605 (43%), Positives = 1619/2605 (62%), Gaps = 90/2605 (3%)

Query: 590  NISAPPESNMEFQLFDASINYGPWAHRNIMNIQRIFSPIVSRTPELQPDPEPGFLRRYTM 649
            N  +PPE  ++ Q+  ASI YGPW +R +  + R+ SP+VS+        EPG  R +T+
Sbjct: 433  NSGSPPEFLVDLQVSKASIYYGPWTNRQVSYLIRMLSPVVSKNQIPIKKLEPGSRRIHTV 492

Query: 650  TKISVSIMEDSSWRVPTREPSKDQDFLKRYMKTNDSSRSFGWFDLNFSRNSEATFCISSI 709
             K+SV I+++SSWR+PTREPSKD++F+K+++KTND  R FGW D N ++ ++ATF  S I
Sbjct: 493  FKMSVHIIDESSWRIPTREPSKDKEFIKQFVKTNDDFRPFGWLDFNLNKGTQATFNFSLI 552

Query: 710  PDVNGYANKLNLDFKDLEVRSSVNHDIFFRSKSYRVDSDIGYPLGWNDEVTWSFVFDSYQ 769
            P ++G  N  ++ F D+EV +SVNHDI  +SK + V +DIGYPLGWN +  W F   + Q
Sbjct: 553  PTIDGLGNNFDIHFLDMEVTTSVNHDILLKSKEFDVVADIGYPLGWNSQADWKFDIIAKQ 612

Query: 770  LETFFLREHLVLIADTFSDFSSGEPTPYEFFRPSIYKVDWNFHGYSAYLNVNDHNIINNP 829
            LETF L+EH+ L +D FSDF+S +PTPYE FRP  Y ++W+  GYS YLNVND NI+NNP
Sbjct: 613  LETFLLKEHISLFSDMFSDFASEDPTPYELFRPFTYSLNWDIEGYSIYLNVNDRNIVNNP 672

Query: 830  LDFNENCYISVHGDDAHIGVEIPRLGITATYTDIIFQISTPMFRXXXXXXXXXXXXEFMR 889
            LDFNENCY+S+HGD+ HI   IP L I+  YT+I F I TPMFR            EFM+
Sbjct: 673  LDFNENCYLSLHGDELHIDSLIPNLLISQPYTEIAFNIYTPMFRLLLNTPPWNTLSEFMK 732

Query: 890  NKEIGRGYDFTAEGSYIIYSDLDIDNVDSLTIECSTRRMTLLTYGFVIGYLLNVQMNYFG 949
            +KE+GR +DF  EGSY+IYSDLDIDNVD++T+EC++R  TL  YG VI YL+NVQ NYFG
Sbjct: 733  DKEVGRAFDFGIEGSYLIYSDLDIDNVDTITMECTSRSTTLFCYGVVIRYLMNVQANYFG 792

Query: 950  EFSHFITAEEYTDIVRGNDNDIVSTLADFXXXXXXXXXXXXXXXQHNPDNSSKSNII--- 1006
            +F HFIT+EEY++I++ N+         F                    NSS  + +   
Sbjct: 793  DFVHFITSEEYSEILQKNNKRSNDEQGSFTYSTTSSV-----------QNSSSDDTVLYT 841

Query: 1007 --DPLYNPPLRKDDIKRKVNETDIWFTFSVWEGALLLPEVLYNSDPCIALSFKELIIDFR 1064
                L  P +R+ D+ R  NE DIWFTF VW+GAL+LPE LYN + C +L F EL+I FR
Sbjct: 842  KEQDLSKPHVRRADVLRTENELDIWFTFRVWDGALILPEGLYNGNLCSSLLFSELMISFR 901

Query: 1065 NCDYYLDLLATLNGTSFKRCIRKNQNDIFELV----HNNAIKNLEEHGSVSNISIHGHRM 1120
              +YY+D L  L      R +  + ++IF  V    HN  I     HG++S+++IH HRM
Sbjct: 902  GSNYYMDFLTNLYDMKINRFLNFSPDEIFRYVRDPDHNLNIV----HGTLSDVTIHAHRM 957

Query: 1121 YGAPPTSPSYFSDWAVDVNNLSINSDIYFIRGFISYITKVGFEFSNLQNILLYDESVLDN 1180
            +G PP   +YF  W++D  +L I+S+I F+  F    TK+GF +SNL+N L+Y     D+
Sbjct: 958  FGLPPNKLTYFCQWSIDFGSLIIDSNIEFLSSFFGLFTKLGFGYSNLENKLVYKVESSDD 1017

Query: 1181 MTSVTVHGTGIDILVADKSTSAQVLLNMDGITFNRINFANDRYSSRIDLQVPGLHFAFFD 1240
            MT +T++G  + ILV+D  +  Q  L +  +  N I+F N+RYS RI+L++P    + FD
Sbjct: 1018 MTLLTLYGEKVLILVSDDVSQKQASLEILKLKLNSIDFQNERYSKRINLKIPEFSISIFD 1077

Query: 1241 NGSSMDKTCLFEFKTKINFTNFTQMKDGELHSKKQQEFIALNDSAFHRCSFLLLPHIQES 1300
              +   K  L  FKTKI+FTNF   +D       Q+ +I L+DS +HRC F+L    QES
Sbjct: 1078 VRNPTIKPILLGFKTKIDFTNFVIKEDFRNSLNGQRTYITLHDSPYHRCFFILPTMYQES 1137

Query: 1301 LLYHELYGGITXXXXXXXXXXXXQAETIAFIIDDFL--------GPF-GINSTELLGSIS 1351
             LY+ELYGGIT               TI F+++DFL         PF  I S   + ++ 
Sbjct: 1138 FLYNELYGGITPSFSIPILPIPMLPNTIDFLVEDFLKEYSDLLENPFLNIRS---INNLD 1194

Query: 1352 TSTPIHXXXXXXXXXXXXVIHPIESMQSHLVPSQSVTHGNYIIDISYITLDINPLFFTYA 1411
            TS+  +            +    E    +  P     + NYI+++ YI +DINPLF  + 
Sbjct: 1195 TSSLFNEYRVDTYISEKAIFKAEEKNTVNYDPKYE--YDNYILNVEYIRVDINPLFSDFI 1252

Query: 1412 SNFLDEFYSENIIETIDGIEMAIVNRLGTKSEELDSVTNIKLQIKYLDFFFGQRNTEGLE 1471
             +   + YSEN+++ ID IEM IV RLG+  + L   TN+KL+I Y+D F+G RN+EG+E
Sbjct: 1253 DSMSTKLYSENMVDIIDEIEMIIVRRLGSPKKVLLRETNLKLKISYVDIFWGSRNSEGIE 1312

Query: 1472 LYVDQIDLEVSQKTFQKKSTVVLDEIAILSRFLSLRASINEKKVLEDFDERPPALSLALE 1531
            +Y+D++D E+ Q+ F   +   L+E  ILS+  SLR S +E +  E   ERPPALSL +E
Sbjct: 1313 IYLDKLDFEMRQRIFDDFNQRSLEERTILSKLKSLRCSFSETQYEEIEYERPPALSLTVE 1372

Query: 1532 GWEGWSSTASSQVNSLNISSTDITVDESQIEWLIDYLNRLVVFVHELVNSLDSIQKKSNG 1591
            G E WS T ++Q NS+NI STDITVD SQ  WLI YLN+ V F + L  S+D +QK+   
Sbjct: 1373 GLEVWSCTNTAQSNSINILSTDITVDGSQTSWLIKYLNKQVEFFYNLKGSVDLLQKRDVT 1432

Query: 1592 IQKKLVSDLTLASEYYQISHDPYVITKPAYVMRVSKGHVRQNRSWRIVTRLRHIYTYLPD 1651
            +QK L+S LT ASEYYQI HDPYVITKPA +MR+S  HVR+NRSWRIVTRLRHI  YLP+
Sbjct: 1433 LQKSLISKLTTASEYYQIDHDPYVITKPALIMRLSNSHVRENRSWRIVTRLRHILNYLPE 1492

Query: 1652 DWEIHVQEEMRGKDMNDVSDSSDIFLTVFSNWRNWEVSDVARSYIYKKIFLSNDETTSEK 1711
             WE      +  + +   SD  ++FL+VFSNWRNWEVSDVARSYIY+++FL + E   + 
Sbjct: 1493 GWEKSSIAFVEARHVYSDSDPKNVFLSVFSNWRNWEVSDVARSYIYRRVFLPDIE---KN 1549

Query: 1712 KLQTTVKLNLNSIFFTIYSTGYAIDHNIILTKAVILLE--LTTETAVSPPIEKS--ILNM 1767
             +  T K+ + S +FTIYS  YA+DHNI++T+  ++++  L+ E   +    K+  I ++
Sbjct: 1550 LINNTTKIGMESFYFTIYSQRYAVDHNIVVTRINVIIDQMLSDEEPKAATANKNDKIYDI 1609

Query: 1768 TGSLGSIKGEFSDKFLRLLELIPDFSKEEDIKSLTENSSIVSEKSPYFTIHLFLLFENGG 1827
            TG++G+ KGE  D+ +RL +L      E+  K  +E S+  S    +F I++ L+ E G 
Sbjct: 1610 TGTVGTFKGELGDQLIRLKKLY----SEDKAKIRSEKSTDFS-IPKFFKINIVLIVEKGE 1664

Query: 1828 LQLTMGDTTLSNNVTDGKISAXXXXXXXXXXXXXXGAYYMKKSEMCLKHNKDIIAEFQLH 1887
            L L   +T L + + +GKIS                 YY  ++E+ LKHN+ I+ +  L 
Sbjct: 1665 LTLAAANTKLISRIKNGKISGFFENARDVANASGSIVYYATRTELWLKHNELILLDAHLD 1724

Query: 1888 HLGLISTGIYTPICPVILINLRSADLHFKSLASTEKIVKTI----EDITEYSVHLYKHYD 1943
             L +          P IL+N++S+ L FK+L +T+ +V  +     +I++ +  L    +
Sbjct: 1725 DLFISVIAELLVKKPTILVNVKSSHLRFKALPNTKNLVVFLREFEREISKITGRLTDKDN 1784

Query: 1944 LRKYTTKPTKVDQKPEKINFDVRVACNLSKVSAELTLISPFYLRYETKQLDLYFNQNGDG 2003
             +++T+       K   I+FD+    N+  +S+E+ ++SPF +++  K+L + FN+ GD 
Sbjct: 1785 KKRHTSTSPIFSTKKIDISFDI----NIFDISSEIVILSPFTVKHSMKELKIVFNREGDN 1840

Query: 2004 EILLSLWDTDIFVTSHHTKEQYFRFSYDDIQINCNPMSEXXXXXXXXXXXXXXXXTFSEP 2063
            + + S+ D D+++TS+    QYFR SY DI +                       T ++P
Sbjct: 1841 DTIFSILDADLYLTSYQNGVQYFRLSYQDINLEAMLTDSKSKLITINIVTSLIKLTLADP 1900

Query: 2064 RRIFASFLQDERITIESFQELKKLKKIFFSNAKNVKKLNNDVPKEDTPTKWALELNINYF 2123
            ++I  S LQDE+   +S + +K L  +F SN + V+         D P K+ +  ++ YF
Sbjct: 1901 KKITNSLLQDEKTFEQSLESIKTLNTLFSSN-REVR-----TSAVDNPYKFMVNFDLTYF 1954

Query: 2124 GILLPIASTFFVLELHMLLGSLTNTTEEIQEVNNQISGQISLENILFLINDRSLPLRLSK 2183
            G+L P+ +++F+LELH LL + +N     Q++  +I+  ++L+N LF+I    +  ++SK
Sbjct: 1955 GLLFPVDTSYFILELHSLLATFSNVYMNPQQLKEKITCNLALQNTLFMIKSPEVNNQVSK 2014

Query: 2184 LVDFSIRISTLQKTTSSYESLQIESSHFRMCFSPESLVFVLWGVKQLQNELEYYKDHKTK 2243
            ++DFS+ +ST  K  +S  S ++ESSHFR+C +PESL+ +L GV Q  +  +YYK+H   
Sbjct: 2015 VLDFSVNLSTETKILNSKRSFEVESSHFRVCLNPESLLKILQGVFQTSSSFKYYKEHTRL 2074

Query: 2244 RQWNLXXXXXXXXXXXXXXPLNYFRSIHILSYNFCIGWMLPENQKDIPGWMFGYDRLFSA 2303
            + +                PL  + SIH LSYNFCIGW+   +Q   PG + GYDRLFSA
Sbjct: 2075 QIFKTKKKASVVSENLIGAPLIEY-SIHFLSYNFCIGWIFENSQSSYPGLIMGYDRLFSA 2133

Query: 2304 YEKNYGKLTLIEGYMSVTNSNSSNDFFSQGEEKNRHNRSFLPSMQILYWLKEFNSKKDLF 2363
            YE +YGKLT+++G+ S+ N  SS+ F+SQG EK ++NRS+LP++QILYWLKE ++ K LF
Sbjct: 2134 YEDSYGKLTVVDGFFSIANGFSSDTFYSQGNEKEKYNRSYLPNLQILYWLKEVDAMKQLF 2193

Query: 2364 IRLHGDALDVDILSNFVNIIELIFKSYQIFEDFRKSKIVQ-NIEKQKHHEHIKSENATEF 2422
            +R +G+ +DV  LSNF  II L  +S Q F+  +K  + + N+E +K    +  ++ +  
Sbjct: 2194 VRFYGETIDVRFLSNFATIINLTIESVQHFQMIKKETVREMNVEAEK---KVGEDDISTK 2250

Query: 2423 VPTFLSDINSINCEFKYEGGTLRVFSVDDVEIDSTPSLELNAPKVSIYLNYKHFDDSPKP 2482
               F S +  INC+  Y+GG   V+ V    ID+  ++E+  PKV I ++YK+  D  KP
Sbjct: 2251 FSLFFSKVQRINCQCIYDGGVFTVYPVRGNHIDTEHAIEITTPKVIIDVDYKYRIDMKKP 2310

Query: 2483 HWLRCVIDIHSSHNILYSKCAPFVIEFVESIQEILENRPVEPKQSVSKIATPNRTYKRIL 2542
            HW+R  I+I  ++N L S+ A F+ EF ES+ E++     + +    K  +P   YKRIL
Sbjct: 2311 HWIRSFINIEPTYNTLLSQFASFLTEFGESVHEMVAKFSPKEQPPAPKTVSPPIDYKRIL 2370

Query: 2543 APFDIAFRIKAAKQMLSFSCEPSAKVQANVGLDSFLFGISTGGSSVEDPLSLTLCINKIS 2602
              FD++F I A KQ +S SCEP AKV ANVG +SF+F I T      +PLS +L +N I 
Sbjct: 2371 EDFDVSFSISAGKQKVSLSCEPVAKVHANVGFESFVFSIITNDDDPTEPLSCSLTVNDIK 2430

Query: 2603 TSVQHIFSKEASASFSLNFIDLTFIFTQPTLYCVGLISDIDIFFNMKQQQNLLLFLDIWH 2662
            TS+ H FS E +ASFS++F+D+T +FT P +Y   LISD+ ++FN+KQ QNL++FLDIW+
Sbjct: 2431 TSINHEFSTEPTASFSVDFVDITTLFTHPDIYGTTLISDVSLYFNIKQLQNLMVFLDIWN 2490

Query: 2663 LSESIGIRPNXXXXXXXXXXGHTQIPETPQPGKIIPWNFNIIFTNVNADIHLGPALGIVS 2722
            L   I +RP             +   ++     IIPW+F +I T++N DIHLGP+LG +S
Sbjct: 2491 LKRLIKLRPQKSVPVKKPESRVSSSTKSSSNTTIIPWSFTVIITDINGDIHLGPSLGNLS 2550

Query: 2723 AKLEKTWFISDRYLDKRQILQLFTDGMVLKSRGRLSGMLDISNAGWRLEVNYADNELNYN 2782
             KL+K W  ++ + D+R+ L+ FTD + L S GRL G++D++N  W L V Y +NE    
Sbjct: 2551 LKLKKNWISTNHFQDRRKALRFFTDSLSLTSVGRLGGLIDVANISWILNVRYVENEKLDQ 2610

Query: 2783 SPIVAIGIDIGCVALKTAFDYHMFMISKVNNIHFRLHSERDPEGKLPDXXXXXXXCEEIS 2842
            SP+V I +++  VA+K AFDYHMF+I +V+NI F L SE+D  G LPD       C+EI 
Sbjct: 2611 SPLVDITLNVENVAVKAAFDYHMFLIGRVHNILFNLESEKDLIGNLPDLLKLHLVCDEID 2670

Query: 2843 ICSTTLVASNILDIYNTIIRTRQDTKNSYFETLMESNNQDTRTNIPYSDILKSLNLLRTD 2902
            ICST LVASNILDI NTI RTRQD++NSY ETL+ESN    +++I Y+DILKSLNLLRTD
Sbjct: 2671 ICSTALVASNILDISNTISRTRQDSRNSYIETLLESNPPPQKSSISYTDILKSLNLLRTD 2730

Query: 2903 VQIDVSKLQLQISPISLFDFEVLVINIDNMSARSETTSTDKLKTRLELQVCNASVALSTA 2962
            V I++ K+Q+QISPISLFD EV+V  ++N+SARS T S +KL T L++++  A+++LS +
Sbjct: 2731 VGIEIHKMQVQISPISLFDVEVIVTTVENVSARSVTQSGEKLMTDLQMKIYKATLSLSKS 2790

Query: 2963 KEELDEESVNKISVADYMTYASKIKGGTILIIPKLLVGMTTWQKVTSNTIEYTFTCKFDG 3022
             EELDEE+V++ISV DYM YA K+ GG IL IPKL VGMTTWQ   S  IEY F CKF  
Sbjct: 2791 NEELDEEAVSEISVDDYMIYAMKLSGGKILSIPKLFVGMTTWQLENSKIIEYLFACKFHD 2850

Query: 3023 KVSVRWNLGPVNFIKEMWATHVKSLAVRQAR---------------------XXXXXXXX 3061
            K+SVRWNLGPVNFIKE+WATHVKSLAVR+A+                             
Sbjct: 2851 KISVRWNLGPVNFIKEVWATHVKSLAVRRAQLKGDKEPQLVPGIIGEPSPLVSSEELEML 2910

Query: 3062 XXXXXXXXXXXXXXPAQPKFTYVALVEPSIEMPQIKDLEDATPPMEWFGLNRKKFPSFTH 3121
                            + KF YV L EP IEMP+IKDLEDATPP+EWFG+NRKKFP  TH
Sbjct: 2911 RSESSNADNDNNEYSEEDKFIYVPLKEPQIEMPKIKDLEDATPPLEWFGVNRKKFPRVTH 2970

Query: 3122 QTAVIVVQKLVHAVEKEYAKIIGHS 3146
            QTA+I++QK+VH  +KEYAK++G S
Sbjct: 2971 QTAIILIQKIVHVAQKEYAKVLGDS 2995

 Score =  165 bits (418), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 79/182 (43%), Positives = 113/182 (62%), Gaps = 5/182 (2%)

Query: 4   EPKFVSVSLSREKYFSWVFLVTWILTCILCLLMFFYIDRVFAYSLTFILDWLLWRPYKVK 63
           + +F S+SL REKYFSWVFL  W+LTCI  L + FY+ RVF    TFIL W +W+ YKVK
Sbjct: 4   DSQFASISLGREKYFSWVFLAYWVLTCIASLTVIFYLPRVFGAIFTFILHWSIWKKYKVK 63

Query: 64  IHCEXXXXXXXXXXXXFKNLCIITENSTISILEGKIIWQYWLLNTRVSAYELH---QQQK 120
           I+ E             KN+ II ++ T+S LE +I W+YWLLN+R   Y++      ++
Sbjct: 64  INIESIRVSFLGGTVFIKNMSIINQDFTLSFLECRIKWRYWLLNSREVEYKVQANLSSEQ 123

Query: 121 EHGYITPGSGF--KNIQLPCKFLFQCEGAEIFVYNKTSAYENIIDSFSPDEKIKYKEFLH 178
             G     S    KN +LPC  L +C+G E+FVYN+ +AYEN++  F+ +E+ K+  FL+
Sbjct: 124 SQGSDASNSMTIEKNSKLPCTILIECKGFEVFVYNRKAAYENVLRLFTKEEREKFSSFLN 183

Query: 179 KH 180
           +H
Sbjct: 184 EH 185

 Score =  137 bits (346), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 73/190 (38%), Positives = 110/190 (57%), Gaps = 9/190 (4%)

Query: 298 LNFYPFGLKLTKGSIIFGNKFTPSLLIISYKSAEGIVDVLPATNPRVDLYKMKMKLDFQN 357
            NF P  L+L  G++  GN+FTPSL++ SY++  G++DV  A N ++DLYK K+ + FQ+
Sbjct: 236 FNFLPIQLRLIHGAVTLGNRFTPSLVVASYENCNGVLDVSHA-NEKIDLYKSKVTMKFQD 294

Query: 358 FEIEVKPNISYEDDSKPKAFYCDSMLSRLWTKFSTLFDIMPNPLSRYIHFSRLHKNSLFL 417
             I VKPN++Y+ +   +       LSR+W  F  + D++PNP ++  H   + K    +
Sbjct: 295 VNISVKPNLAYDSEFTNELDIDKGKLSRIWNTFIDIMDMIPNPFTKIYH-KHMKKKEHDV 353

Query: 418 EDNIFEDEDFEKKWKGLSLYKDAALNRGN-PEEHIEFDFLNHEYARYCSIVKAPRLIFTN 476
           E        F  KW+GLSLYKD   + G    +   +DFLN EYA++ SI+K P    + 
Sbjct: 354 ESM------FVNKWRGLSLYKDNLRDAGRYGLDEASYDFLNREYAKFSSILKCPNFTLSY 407

Query: 477 EYDIPGIVPY 486
             D PGIVP+
Sbjct: 408 YLDSPGIVPH 417

>CAGL0L12210g Chr12 complement(1315265..1324210) [8946 bp, 2981 aa]
            {ON} similar to uniprot|Q12150 Saccharomyces cerevisiae
            YLR087c
          Length = 2981

 Score = 2135 bits (5531), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1118/2616 (42%), Positives = 1611/2616 (61%), Gaps = 80/2616 (3%)

Query: 561  GASPDTDRNNESDASNNQQRNTYSRSTTDNISAPPESNMEFQLFDASINYGPWAHRNIMN 620
            GA P +   +  D  NN               APP+   E  +F  ++ YGPWA R   +
Sbjct: 417  GAHPPSSYADGPDVGNNM--------------APPQYIFEINIFGGTVCYGPWAQRQTNH 462

Query: 621  IQRIFSPIVSRTPELQPDPEPGFLRRYTMTKISVSIMEDSSWRVPTREPSKDQDFLKRYM 680
            +Q + SP VSRT +     +PG  R YT+ K++++ MED +WR+PTRE SKD +FL  Y 
Sbjct: 463  LQSLLSPSVSRTAKPIKKLKPGSKRIYTVLKLTINAMEDVTWRIPTRESSKDVEFLMHYK 522

Query: 681  KTNDSSRSFGWFDLNFSRNSEATFCISSIPDVNGYANKLNLDFKDLEVRSSVNHDIFFRS 740
            +TND  R FGW D+  SR+S   F ++  P   G+ N +++   D E+RSSVNHDIF +S
Sbjct: 523  ETNDDYRPFGWIDIKVSRDSCGIFDLAMCPTSKGFKNTIDVQLVDTEIRSSVNHDIFLKS 582

Query: 741  KSYRVDSDIGYPLGWNDEVTWSFVFDSYQLETFFLREHLVLIADTFSDFSSGEPTPYEFF 800
            KS+  + DIGYPLGWN E  W+ + DS QLE F LREH+ LIADT +DFSSGEP PYE F
Sbjct: 583  KSFSFNCDIGYPLGWNAEANWTIIMDSNQLELFLLREHVTLIADTLTDFSSGEPVPYELF 642

Query: 801  RPSIYKVDWNFHGYSAYLNVNDHNIINNPLDFNENCYISVHGDDAHIGVEIPRLGITATY 860
            RP +Y + WN  GYS YLNVNDHNI+NNPLDFNENCY+S+HGDD  + V +P+  IT+ +
Sbjct: 643  RPFVYHIKWNMKGYSFYLNVNDHNIVNNPLDFNENCYLSIHGDDLTMNVMVPKKTITSRF 702

Query: 861  TDIIFQISTPMFRXXXXXXXXXXXXEFMRNKEIGRGYDFTAEGSYIIYSDLDIDNVDSLT 920
            T++ + I TPMFR            EFMRNKE+GR +DF  +GSY+IYS+LDIDNVD+LT
Sbjct: 703  TNMTYDIYTPMFRLLLNTPPWNTLNEFMRNKEVGRSHDFRLKGSYLIYSELDIDNVDTLT 762

Query: 921  IECSTRRMTLLTYGFVIGYLLNVQMNYFGEFSHFITAEEYTDIVRGND-NDIVS--TLAD 977
            +ECS+R   L  YGFVI YL+NV+MNYFGEF HF+T+EEYT   R  D  +I+S     D
Sbjct: 763  VECSSRGTALHIYGFVIRYLINVKMNYFGEFFHFVTSEEYTGNTRPTDLENIISEDRRDD 822

Query: 978  FXXXXXXXXXXXXXXXQHNPDNSSKSNIIDPLYNPPLRKDDIKRKVNETDIWFTFSVWEG 1037
                              NP    K +         L+K D+KR  NETDIWFTFSVW+G
Sbjct: 823  DFSSYESVSRISSNSSDKNPKAKKKHS---------LKKSDLKRTSNETDIWFTFSVWDG 873

Query: 1038 ALLLPEVLYNSDPCIALSFKELIIDFRNCDYYLDLLATLNGTSFKRCIRKNQNDIFELVH 1097
            AL+LPE +YN+DPCIAL F ELI+D R+C+YY+D+LAT    + KR + K  ++I+E VH
Sbjct: 874  ALILPETIYNADPCIALHFAELIVDLRSCNYYMDILATACDINLKRYVGKRADEIYEYVH 933

Query: 1098 NNAIKNLEEHGSVSNISIHGHRMYGAPPTSPSYFSDWAVDVNNLSINSDIYFIRGFISYI 1157
             N  K+ E HG++S+I IHGHRMYG PPT P+YF  W +D  +L+I+S+++F++G     
Sbjct: 934  LNNGKDHEVHGTLSDIYIHGHRMYGLPPTEPTYFCQWDMDFGHLNIDSNMFFLQGLFGAF 993

Query: 1158 TKVGFEFSNLQNILLYDESVLDNMTSVTVHGTGIDILVADKSTSAQVLLNMDGITFNRIN 1217
             K+GF + +L+NILLY+  ++D+MTS+T+    IDI + D  T+A   L ++   F  I+
Sbjct: 994  YKIGFGYKDLENILLYETEIIDDMTSLTIFINTIDIRLNDVDTTAHADLKLERFCFTLID 1053

Query: 1218 FANDRYSSRIDLQVPGLHFAFFDNGSSMDKTCLFEFKTKINFTNFTQMKDGELHSKKQQE 1277
            F N+RYS R+D+++P L F  F N    +   L  FK  +NFTNF Q +D   H K Q++
Sbjct: 1054 FENERYSKRMDIKIPSLEFNIFSNED--NDLSLLNFKVDMNFTNFVQNQDFNKHRKIQRD 1111

Query: 1278 FIALNDSAFHRCSFLLLPHIQESLLYHELYGGITXXXXXXXXXXXXQAETIAFIIDDFLG 1337
            +I LND+ +HRC+FLL    Q+S +Y+EL+G I              A+TI ++++D L 
Sbjct: 1112 YIVLNDAPYHRCAFLLPESYQKSRIYNELFGAIAPSSSLPPLPIPLTADTIEYVLEDLLE 1171

Query: 1338 PF-GINSTELLGSISTSTPIHXXXXXXXXXXXXVIHPIESMQSHLVP----SQSVTHGNY 1392
             + G+      G+                     I  I + ++H  P      +V   NY
Sbjct: 1172 DYMGL----FEGNYDIKESSVENLELSAIEATRAITGIGAERTHSNPITLSDYAVESDNY 1227

Query: 1393 IIDISYITLDINPLFFTYASNFLDEFYSENIIETIDGIEMAIVNRLGTKSEELDSVTNIK 1452
            ++ +  I +DINP  +T     L   Y ++ ++ IDGIE+ IV RL +  + + ++TN+K
Sbjct: 1228 VVKVESIVIDINPALYTTIEKLLKHIYDQDAVQIIDGIEIGIVKRLSSIHDGVTTMTNVK 1287

Query: 1453 LQIKYLDFFFGQRNTEGLELYVDQIDLEVSQKTFQKKSTVVLDEIAILSRFLSLRASINE 1512
            +QIK+ + F+G++ ++ + ++ D++D  +++KT ++ S   L E+ +L++  ++R ++ +
Sbjct: 1288 VQIKHFNLFWGEKESDNVSMFFDKMDFALTEKTLEQNSEKNLLEMTVLAKIKAVRLTVVQ 1347

Query: 1513 KKVLEDFDERPPALSLALEGWEGWSSTASSQVNSLNISSTDITVDESQIEWLIDYLNRLV 1572
            +  L    ERPPA+++ +EG+E WS+    QVNS+++SS DITVD++Q+EW   Y+ R  
Sbjct: 1348 QPGLIPTQERPPAITVGVEGFEFWSTAIEKQVNSISVSSADITVDDAQVEWFFKYIVRQK 1407

Query: 1573 VFVHELVNSLDSIQKKSNGIQKKLVSDLTLASEYYQISHDPYVITKPAYVMRVSKGHVRQ 1632
             F  +++ S + IQ      QK+L+S LT ASEYYQISHDPYVITKPA++MR+S+GHVR+
Sbjct: 1408 YFFLDMLQSYNRIQNNRIESQKELISRLTAASEYYQISHDPYVITKPAFIMRLSRGHVRE 1467

Query: 1633 NRSWRIVTRLRHIYTYLPDDWEIHVQEEMRGKDMNDVSDSSDIFLTVFSNWRNWEVSDVA 1692
            N+SW+I+TRLRHI TYLP DW ++V + +R +  +   D+  IF+++FSNWR+WE SDVA
Sbjct: 1468 NKSWKIITRLRHILTYLPKDWYLNVGQPLRDRKFDPSQDARSIFMSIFSNWRSWEFSDVA 1527

Query: 1693 RSYIYKKIFLSNDETTSEKKLQTTVKLNLNSIFFTIYSTGYAIDHNIILTKAVILLELT- 1751
            RSYIY K+FL++     ++ LQ   KLN+ + F T+YST Y +DH+I+++ A +LLELT 
Sbjct: 1528 RSYIYGKLFLNDHAEKKKQSLQKLFKLNIGNFFMTVYSTNYDVDHSIVVSNAKLLLELTP 1587

Query: 1752 --TETAVSPPIEKSILNMTGSLGSIKGEFSDKFLRLLELIPDFSKEEDIKSLTENSSIVS 1809
              TE   +    + +++++G++  IKG+ S K L+L +LIP          LTE S    
Sbjct: 1588 SSTEPKENSLQREELIDISGTVDVIKGKLSTKLLKLQKLIP---------ILTEGSEKQP 1638

Query: 1810 EKSPY------FTIHLFLLFENGGLQLTMGDTTLSNNVTDGKISAXXXXXXXXXXXXXXG 1863
             K P       F ++   +  +  +QL M  T L+ NV DG+IS                
Sbjct: 1639 VKPPQDTIPKPFKMNAAFMVNSCDIQLVMDATKLNMNVNDGRISVLWENLQDSTAQAGSV 1698

Query: 1864 AYYMKKSEMCLKHNKDIIAEFQLHHLGLISTGIYTPICPVILINLRSADLHFKSLASTEK 1923
              + K +E+ LKH   ++AE ++ +     T       P  LI+ +S+ +HF+++A TE+
Sbjct: 1699 VLFSKHTELVLKHINSVLAEGRVSNFYATFTTDTWAQRPTYLIHSKSSSIHFRTMAKTER 1758

Query: 1924 IVKTIEDITEYSVHLYKHYDL-RKYTTKPTKVDQKPEKINFDVRVACNLSKVSAELTLIS 1982
            +V+ I+DI      + +  +L R+ T  PT  D  P K N  V  +C  S VS ++  +S
Sbjct: 1759 LVEAIKDIKLKIDQISEQLELERRLTQHPTVYD--PNKSN--VIASCLFSNVSMDIMPVS 1814

Query: 1983 PFYLRYETKQLDLYFNQNGDGEILLSLWDTDIFVTSHHTKEQYFRFSYDDIQINCNPMSE 2042
            PF L+   KQ+D ++N+      L+ L DTD F+TS  TKEQY R S   +QI  N  S 
Sbjct: 1815 PFALKNSAKQIDFFYNKFDSDSWLIKLKDTDFFLTSDQTKEQYMRLSMKKLQIRVNVSSS 1874

Query: 2043 XXXXXXXXXXXXXXXXTFSEPRRIFASFLQDERITIESFQELKKLKKIFFSNAKNVKKLN 2102
                            TFSEP+ I  SFL+DER+  ES   L+ LK +F  +  + K+  
Sbjct: 1875 KPKLVDINLSTNLVKLTFSEPKNIVYSFLKDERVASESVHLLQTLKPLF--SISDDKEST 1932

Query: 2103 NDVPKEDTPTKWALELNINYFGILLPIASTFFVLELHMLLGSLTNTTEEIQEVNNQISGQ 2162
                +E T   W+L+ +I+YFGIL+P+ ST++V+E H  + S++N        N  I+G 
Sbjct: 1933 PQSYQEKTEYLWSLDSSIDYFGILIPMTSTYYVMEFHSYVSSISNANGA-PSGNLDITGH 1991

Query: 2163 ISLENILFLINDRSLPLRLSKLVDFSIRISTLQKTTSSYESLQIESSHFRMCFSPESLVF 2222
            +S+ENILFLI + SLP  LSK++D ++ +STLQ+   +  S+Q+ESSH R+C SP+SL+ 
Sbjct: 1992 MSVENILFLIKESSLPDGLSKVIDIAVNVSTLQRVDDNSRSIQVESSHARICLSPDSLLR 2051

Query: 2223 VLWGVKQLQNELEYYKDHKTKRQWNLXXXXXXXXXXXXXXPLN---YF---RSIHILSYN 2276
            +LWG  Q     E+Y  + +K  W                  N   +F    SIH LSYN
Sbjct: 2052 LLWGFNQGHKLSEHYLKYHSKSLWQSFAKSDDKQQDTNSIKSNETSFFSSINSIHFLSYN 2111

Query: 2277 FCIGWMLPENQKDIPGWMFGYDRLFSAYEKNYGKLTLIEGYMSVTNSNSSNDFFSQGEEK 2336
             C+GW+         G + GY RLFSAYE   GKLT+I+ Y +    N+S+ F+ +   K
Sbjct: 2112 LCVGWLFEYELGPPKGLITGYSRLFSAYENCMGKLTVIDSYFAAAQGNTSSTFYPETNVK 2171

Query: 2337 NRHNRSFLPSMQILYWLKEFNSKKDLFIRLHGDALDVDILSNFVNIIELIFKSYQIFEDF 2396
               NR +LP+MQIL+W K     KD+++R  G+ LDV  LS+F+  IE    S ++F+  
Sbjct: 2172 ELFNRFYLPNMQILFWWKVIEGMKDVYVRFTGETLDVKYLSDFMLTIESTLHSIKMFQKL 2231

Query: 2397 RKSKIVQNIEKQKHHEHIKSENATEFVPTFLSDINSINCEFKYEGGTLRVFSVDDVEIDS 2456
            +K  IV+  +++    HIK +         L +I S+NC FKY+GGT  VF++ D  ++ 
Sbjct: 2232 KKELIVETPKREV--VHIKEDKPVNSSNNILKNIKSVNCHFKYDGGTYSVFNISDGSLNP 2289

Query: 2457 TPSLELNAPKVSIYLNYKHFDDSPKPHWLRCVIDIHSSHNILYSKCAPFVIEFVESIQEI 2516
            TP++E+ +P +S+ + YKH   + K H +RC+++I  +HN+LY+ CAP V  FVE ++ I
Sbjct: 2290 TPAIEIKSPVISVDVLYKHEKQNTKHHSIRCLVNIDPTHNVLYATCAPLVKNFVEDVRSI 2349

Query: 2517 LENRPVEPKQS-VSKIATPNRTYKRILAPFDIAFRIKAAKQMLSFSCEPSAKVQANVGLD 2575
                  E K S  +  +  N  Y+++L  +D+A  + +AKQ LS SCEP AKVQA+VG +
Sbjct: 2350 FGRYESENKHSETTPTSVQNIDYEKLLEDYDLAITVTSAKQQLSLSCEPKAKVQADVGFE 2409

Query: 2576 SFLFGISTGGSSVEDPLSLTLCINKISTSVQHIFSKEASASFSLNFIDLTFIFTQP---T 2632
            +    ++T    +++PL+ +  I     S++H+FS+E S SF + ++DLT +FT      
Sbjct: 2410 ALTVSMTTNPFDIDEPLAFSFSIKDTKASIKHLFSRETSTSFGVGYLDLTLLFTHTNRIN 2469

Query: 2633 LYCVGLISDIDIFFNMKQQQNLLLFLDIWHLSESIGIRPNXXXXXXXXXXGHTQIPETP- 2691
             Y   LISDID++FN+KQ QNL LFLDIW LSE +   P              +  + P 
Sbjct: 2470 TYGTSLISDIDLYFNVKQLQNLYLFLDIWQLSELLN--PVTSSQEQVIRKDKKKSVDKPI 2527

Query: 2692 QPGKIIPWNFNIIFTNVNADIHLGPALGIVSAKLEKTWFISDRYLDKRQILQLFTDGMVL 2751
                 +PW F +IFTNV  DI LGP+LG++S +L +TW  +D +  KRQIL  F D ++L
Sbjct: 2528 HNESQLPWCFTLIFTNVKGDIDLGPSLGLISLRLSRTWLATDHFSGKRQILHAFVDDLLL 2587

Query: 2752 KSRGRLSGMLDISNAGWRLEVNYADNELNYNSPIVAIGIDIGCVALKTAFDYHMFMISKV 2811
             S GRLSG+++I  A W  EV +  +    N P+VA+ ++   + +K AFDYHMF+I  V
Sbjct: 2588 ISEGRLSGVVNIDGASWVSEVIWLQDSKRDNIPLVALSLNTDKIEIKAAFDYHMFLIGTV 2647

Query: 2812 NNIHFRLHSERDPEGKLPDXXXXXXXCEEISICSTTLVASNILDIYNTIIRTRQDTKNSY 2871
            NNI F+LHSERD  G  PD       CEEI +CST LVA+NILDIYNTIIR RQDTK SY
Sbjct: 2648 NNILFQLHSERDMVGVAPDLLKVSFSCEEIKLCSTALVAANILDIYNTIIRMRQDTKISY 2707

Query: 2872 FETLMESNNQDTRTNIPYSDILKSLNLLRTDVQIDVSKLQLQISPISLFDFEVLVINIDN 2931
             ETL +SN +  +  + Y DILKSL LLRTD+ + +  LQLQISPISLFD EV+VIN+ +
Sbjct: 2708 IETLKDSNMETNKQTLAYRDILKSLQLLRTDLTVSICSLQLQISPISLFDVEVVVINVVS 2767

Query: 2932 MSARSETTSTDKLKTRLELQVCNASVALSTAKEELDEESVNKISVADYMTYASKIKGGTI 2991
            +SARSET S  KL T L ++V +A+++LSTAK+ELDE++++KI+VADYMTYASKI+GGTI
Sbjct: 2768 VSARSETHSEAKLTTSLNMEVYDATLSLSTAKQELDEDALSKITVADYMTYASKIRGGTI 2827

Query: 2992 LIIPKLLVGMTTWQKVTSNTIEYTFTCKFDGKVSVRWNLGPVNFIKEMWATHVKSLAVRQ 3051
            + IP++ V MTTWQ+  S+ +EY ++CKF  KV+VRWNLGPVNF+KEMW THVK++AVR+
Sbjct: 2828 IEIPRMGVQMTTWQEEKSDILEYLYSCKFHDKVAVRWNLGPVNFMKEMWTTHVKAIAVRR 2887

Query: 3052 ARXXXXXXXXXXXXXXXXXXXXXXPAQPKFTYVALVEPSIEMPQIKDLEDATPPMEWFGL 3111
            ++                          K  YV + EP I+MPQIKDL DATPP+EWFG+
Sbjct: 2888 SQVLTGSFNVSEKDVEKRIKEEENIT--KLNYVPVEEPQIDMPQIKDLGDATPPVEWFGV 2945

Query: 3112 NRKKFPSFTHQTAVIVVQKLVHAVEKEYAKIIGHSE 3147
            NRK+FP+FTHQTAV+ VQ LV+  +K+YAK +G S+
Sbjct: 2946 NRKRFPAFTHQTAVVPVQNLVYLAQKQYAKTLGRSK 2981

 Score =  162 bits (411), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 81/182 (44%), Positives = 110/182 (60%), Gaps = 11/182 (6%)

Query: 7   FVSVSLSREKYFSWVFLVTWILTCILCLLMFFYIDRVFAYSLTFILDWLLWRPYKVKIHC 66
           F   SL  ++ FSWVFLV WILT IL L   FY+ R FAY +TFIL+WLLW+  KVK+  
Sbjct: 10  FRGESLGFKRNFSWVFLVDWILTVILTLATLFYLSRAFAYGVTFILEWLLWKQAKVKVSI 69

Query: 67  EXXXXXXXXXXXXFKNLCIITENSTISILEGKIIWQYWLLNTRVSAYEL----HQQQKEH 122
                        FKNL II ++ TI+ILEG I W+YWL+ TR S Y +    H      
Sbjct: 70  GALRISLLAGRVFFKNLTIIDKDRTITILEGSITWRYWLIRTRKSEYRVAQMAHASAGSS 129

Query: 123 GYITPGSGF-------KNIQLPCKFLFQCEGAEIFVYNKTSAYENIIDSFSPDEKIKYKE 175
           G     + F       K ++LPC+FLF+CEG E+F+YN+T AY+NI++  S  E+ K+++
Sbjct: 130 GNSEDDTKFDIANYMEKQLKLPCRFLFECEGFEMFIYNRTYAYDNIVNVLSKVEREKFEK 189

Query: 176 FL 177
           F+
Sbjct: 190 FM 191

 Score =  134 bits (336), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 74/190 (38%), Positives = 113/190 (59%), Gaps = 16/190 (8%)

Query: 298 LNFYPFGLKLTKGSIIFGNKFTPSLLIISYKSAEGIVDVLPATNPRVDLYKMKMKLDFQN 357
           L   P    L KGSI+ GNKFTP +LI+S++SA  + DV  A + ++DLY+MK ++  +N
Sbjct: 242 LEALPIEALLNKGSILIGNKFTPCVLILSFESAVALQDVGEAPS-KLDLYRMKYEVRLKN 300

Query: 358 FEIEVKPNISYEDDSKPKAFYCD-SMLSRLWTKFSTLFDIMPNPLSRYIHFSRLHKNSLF 416
            EI +K NI Y D+ K + F  D   LSRLW +F+ +F ++P P        + H N   
Sbjct: 301 LEIMMKQNIDY-DNEKSRNFEFDKGKLSRLWHRFTRIFKLVPFPFKSNRRKEQPHDN--- 356

Query: 417 LEDNIFEDEDFEKKWKGLSLYKDAALNRGNPEEHIEFDFLNHEYARYCSIVKAPRLIFTN 476
                     F +KWKGLS+Y++      +  + IEFD  +HEYA++ S++K+PR+   +
Sbjct: 357 ----------FMQKWKGLSMYRNDMFGEFDEFDDIEFDISSHEYAKFTSLLKSPRVTIHH 406

Query: 477 EYDIPGIVPY 486
           +YD+PG VP+
Sbjct: 407 DYDMPGWVPH 416

>KNAG0G02030 Chr7 complement(453579..462575) [8997 bp, 2998 aa] {ON}
            Anc_8.260 YLR087C
          Length = 2998

 Score = 2109 bits (5464), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1099/2600 (42%), Positives = 1582/2600 (60%), Gaps = 75/2600 (2%)

Query: 590  NISAPPESNMEFQLFDASINYGPWAHRNIMNIQRIFSPIVSRTPELQPDPEPGFLRRYTM 649
            N  APP   +E QLF  S+ YGPWA R +  IQ + +P +SR  +     +PG  R YT+
Sbjct: 432  NNGAPPTFGLEIQLFGGSLCYGPWAQRQVAFIQSLLAPQISRDQKPVKPLQPGERRMYTL 491

Query: 650  TKISVSIMEDSSWRVPTREPSKDQDFLKRYMKTNDSSRSFGWFDLNFSRNSEATFCISSI 709
             K+ + + ED +WR+PTRE SKD +FL+ Y  TN+  R FGW DL FS++S A+F  +  
Sbjct: 492  FKLGIVVNEDITWRIPTRESSKDAEFLRHYKNTNEDYRPFGWLDLKFSKDSYASFNFALC 551

Query: 710  PDVNGYANKLNLDFKDLEVRSSVNHDIFFRSKSYRVDSDIGYPLGWNDEVTWSFVFDSYQ 769
               +G  N + +   D E+RSSVNHDIF +SKS   D ++G+PLGWN++  W+    S Q
Sbjct: 552  STADGSQNTMKIHLGDSEIRSSVNHDIFIKSKSLDFDLNLGFPLGWNEKAKWTINVASSQ 611

Query: 770  LETFFLREHLVLIADTFSDFSSGEPTPYEFFRPSIYKVDWNFHGYSAYLNVNDHNIINNP 829
            LETF LREH+ LIADT SDFS+GEPTPYE FRP +Y ++W   GYS YLNVNDHNI+NNP
Sbjct: 612  LETFLLREHITLIADTMSDFSTGEPTPYELFRPFLYTINWKLDGYSIYLNVNDHNIVNNP 671

Query: 830  LDFNENCYISVHGDDAHIGVEIPRLGITATYTDIIFQISTPMFRXXXXXXXXXXXXEFMR 889
            LDFNENCY+S HGD  ++ + +P+  I A  TDI + I TPMFR            EFM+
Sbjct: 672  LDFNENCYLSFHGDILNVDITVPKDRIDARATDISYNIYTPMFRLMLNAPPWNTLNEFMK 731

Query: 890  NKEIGRGYDFTAEGSYIIYSDLDIDNVDSLTIECSTRRMTLLTYGFVIGYLLNVQMNYFG 949
            +KE+GR YDF   G+Y+IY++LD+DNVD +TI CS++   L  YGFVI YL+N++MNYFG
Sbjct: 732  HKEVGRAYDFRTTGNYLIYNELDVDNVDMITIICSSKSTVLHCYGFVIRYLMNIKMNYFG 791

Query: 950  EFSHFITAEEYTDIVRGNDNDIVSTLADFXXXXXXXXXXXXXXXQHNPDNSSKSNIIDPL 1009
            +F HF+T+EEYT+ +        S    +                    +  K+N  D  
Sbjct: 792  DFFHFVTSEEYTEKISSKGYGEGSLFEKYSDDASTFV-----------SDFDKNNEEDDK 840

Query: 1010 YNPPLRKDDIKRKVNETDIWFTFSVWEGALLLPEVLYNSDPCIALSFKELIIDFRNCDYY 1069
               P    D++RK NETD+W TF++WEGALLLPE +YN DPCIAL F EL ID R+ +YY
Sbjct: 841  VKVPRGPADVRRKTNETDLWLTFNIWEGALLLPETIYNCDPCIALHFGELAIDVRSTNYY 900

Query: 1070 LDLLATLNGTSFKRCIRKNQNDIFELVHNNAIKNLEEHGSVSNISIHGHRMYGAPPTSPS 1129
            +DLLA+L+    ++      N+IFE V     ++++ H  +SNI+IHGHRMYG PPT P+
Sbjct: 901  MDLLASLDDIILRQYSNVQPNEIFENVRQCNGRDVKGHSYISNINIHGHRMYGLPPTEPT 960

Query: 1130 YFSDWAVDVNNLSINSDIYFIRGFISYITKVGFEFSNLQNILLYDESVLDNMTSVTVHGT 1189
            YF  W  D+  + + S++ F++G ++   K+GF F +L+N+LLY++ V+D+MT+VTV+  
Sbjct: 961  YFCKWDFDLGTIKLESEVDFMKGLVTSFQKIGFGFDDLENVLLYEKEVVDDMTAVTVNVK 1020

Query: 1190 GIDILVADKSTSAQVLLNMDGITFNRINFANDRYSSRIDLQVPGLHFAFFD-NGSSMDKT 1248
               I++ +    ++  L ++ + F  I+F N++YS+R+D+++P L  + +  N  +  + 
Sbjct: 1021 DFKIIIHNPELHSRAELILNNMQFCNIDFENEKYSTRMDIRIPLLKLSLYGYNYEASKEL 1080

Query: 1249 CLFEFKTKINFTNFTQMKDGELHSKKQQEFIALNDSAFHRCSFLLLPHIQESLLYHELYG 1308
              F F+TKINFTNF   K+   H   Q+++I +ND+ FHRC F+L    Q S++Y +LYG
Sbjct: 1081 SFFNFETKINFTNFCNYKNCVQHRALQRDYITMNDAPFHRCGFILPASYQNSVIYQKLYG 1140

Query: 1309 GITXXXXXXXXXXXXQAETIAFIIDDFLGPFGINSTELLGSISTSTPIHXXXXXXXXXXX 1368
             I               ET  FII DFL  +   S  ++ ++      +           
Sbjct: 1141 SIVPSSSLPPLPLPLLEETFEFIIQDFLHEYNTTSDCIILNLPYPDSTNLNSDSFNSYPD 1200

Query: 1369 XVIHPIESMQSHLVPSQSVTHGNYIIDISYITLDINPLFFTYASNFLDEFYSENIIETID 1428
               H +        P       NY+ID  YI++ I+P  F Y    L+ FY ++  + ID
Sbjct: 1201 TAPHTLSDTIIRKSPLPEDERDNYVIDFRYISISIDPELFFYIEKLLNHFYGDDDTQVID 1260

Query: 1429 GIEMAIVNRLGTKSEELDSVTNIKLQIKYLDFFFGQRNTEGLELYVDQIDLEVSQKTFQK 1488
             IE+ +V RL    E + S+ N K++I + D F+GQR+T G+ELY+D +D E+++K+ +K
Sbjct: 1261 SIEIGLVKRLSNFQEGISSINNFKIRILFFDVFWGQRDTGGIELYLDTLDFEMNEKSIEK 1320

Query: 1489 KSTVVLDEIAILSRFLSLRASINEKKVLEDFDERPPALSLALEGWEGWSSTASSQVNSLN 1548
                 L E+  L +  S+RAS+N K      + +PPALSL +EG + WS+TA   +NS+ 
Sbjct: 1321 NREKSLTEVTTLMKLNSIRASVNAKYSRGKTEGQPPALSLMVEGVKFWSTTAKKVINSII 1380

Query: 1549 ISSTDITVDESQIEWLIDYLNRLVVFVHELVNSLDSIQKKSNGIQKKLVSDLTLASEYYQ 1608
            ++S D T+DE+Q+ WL ++       +  +V + + +QK     +K+L+S LT+ASEYYQ
Sbjct: 1381 LTSIDATIDETQVVWLFNFFGDQKELIGSVVKTFEKVQKLRTQSRKELISRLTVASEYYQ 1440

Query: 1609 ISHDPYVITKPAYVMRVSKGHVRQNRSWRIVTRLRHIYTYLPDDWEIHVQEEMRGKDMND 1668
            ISHDPYVITKPA++ R+S+GHVR+NRSW+I+TRLRHI TYLPDDW   V ++++ +  N 
Sbjct: 1441 ISHDPYVITKPAFITRLSRGHVRENRSWKIITRLRHIMTYLPDDWNETVAKQLKERKYNA 1500

Query: 1669 VSDSSDIFLTVFSNWRNWEVSDVARSYIYKKIFLSNDETTSEKKLQTTVKLNLNSIFFTI 1728
              D+  IF++VFS+WRNWE SDVARSYIY K+FL+N     +K +    K    S++ T+
Sbjct: 1501 SKDAKSIFMSVFSSWRNWEFSDVARSYIYNKVFLANQAEKQQKTVNKGWKAAFVSVYITV 1560

Query: 1729 YSTGYAIDHNIILTKAVILLELTTETAVSPPIEKSILNMTGSLGSIKGEFSDKFLRLLEL 1788
            Y+ G  +DH+ I+TK+ ++ E T +T  S   ++ ++N+TG+LGSIKG+ SDK  +L  L
Sbjct: 1561 YTAGLGVDHSFIVTKSNLVFEETPDTTESGYNQEKVINVTGNLGSIKGKISDKMFKLHNL 1620

Query: 1789 IPDFSKEED--IKSLTENSSIVSEKSPYFTIHLFLLFENGGLQLTMGDTTLSNNVTDGKI 1846
            +    ++ED  +KS       +S  S  F +++ LLF++  L    G+T+L+N +  GK 
Sbjct: 1621 MNLVQQQEDPALKS-------ISSFSRSFKLNIALLFDSSDLLFVFGETSLTNTIHSGKA 1673

Query: 1847 SAXXXXXXXXXXXXXXGAYYMKKSEMCLKHNKDIIAEFQLHHLGLISTGIYTPICPVILI 1906
            S                  Y K+ E  +KH   ++ E Q+  + L +        P I+ 
Sbjct: 1674 SFLWENPKGPTKETASLVLYAKRCETSMKHRNSMLFENQITGIALSAAADSIISHPSIVA 1733

Query: 1907 NLRSADLHFKSLASTEKIVKTIED-ITEYSV--HLYKHYDLRKYTTKPTKVDQKPEKIN- 1962
            N +  D++ + +  TE IV  +++ I ++++    ++  DL K T         P KIN 
Sbjct: 1734 NFQCDDINLRVMPQTEVIVTFLQEFIAKFNLVKESFETDDLPKPTPTNDSPKPTPTKINP 1793

Query: 1963 ---FDVRVACNLSKVSAELTLISPFYLRYETKQLDLYFNQNGDGEILLSLWDTDIFVTSH 2019
                D+   C  S VS ++  I PF  R ETK+++  F+         ++WD+D+++ SH
Sbjct: 1794 FLLVDLDFTCFFSNVSLDIMPIVPFQFRQETKKMEFKFSSQRTQNFQFNIWDSDLYLGSH 1853

Query: 2020 HTKEQYFRFSYDDIQINCNPMSEXXXXXXXXXXXXXXXXTFSEPRRIFASFLQDERITIE 2079
             TK+QYFR S  +I +                       TFSEP R+  SFLQDER    
Sbjct: 1854 LTKQQYFRLSLGNIIVGYTNGRLVNTIHNLDVSASIVKLTFSEPHRMLFSFLQDEREVSR 1913

Query: 2080 SFQELKKLKKIFFSNAKNVKKLNNDVPKEDTPTKWALELNINYFGILLPIASTFFVLELH 2139
            S ++L+ L  +F S  +      N +P       W L  +I Y GIL+P+++TFFV E+H
Sbjct: 1914 SVKKLQVLGNLFSSEPE-----INTIPA-GAKIDWRLNADIKYLGILIPVSTTFFVFEMH 1967

Query: 2140 MLLGSLTNTT-EEIQEVNNQISGQISLENILFLINDRSLPLRLSKLVDFSIRISTLQKTT 2198
             LL SL +    EI    ++ SGQ+S++NILFLI DR++P  LS+++D S +IS +QK  
Sbjct: 1968 TLLASLADVDYGEIYREADEASGQVSVDNILFLIKDRTIPSTLSRIIDLSFKISAIQKIM 2027

Query: 2199 SSYESLQIESSHFRMCFSPESLVFVLWGVKQLQNELEYYKDHKTKRQWNLXXXXXXXXXX 2258
             S+ S QIES H R CFSP SLV +LWG  QL     +Y+ H +K  W+           
Sbjct: 2028 ESHHSYQIESPHLRFCFSPYSLVRILWGGHQLLALHSHYRRHHSKNLWDFLPKKEKKVEE 2087

Query: 2259 XXXXPLN---YFRSIHILSYNFCIGWMLPENQKDIPGWMFGYDRLFSAYEKNYGKLTLIE 2315
                       F S HILSYNFC+GW+   N     G + GY+RLFSAYEK  GKLTL++
Sbjct: 2088 DKTTSFFSTLTFGSCHILSYNFCVGWLFQNNGDTDAGLILGYNRLFSAYEKGCGKLTLVD 2147

Query: 2316 GYMSVTNSNSSNDFFSQGEEKNRHNRSFLPSMQILYWLKEFNSKKDLFIRLHGDALDVDI 2375
             + SV+N  +S+ F+S G E++++NRSFLP++QI+YWLK     KD+FIRLHG+ LDV+ 
Sbjct: 2148 AFFSVSNGRTSDTFYSDGNEEDKYNRSFLPNLQIIYWLKAAAEMKDVFIRLHGETLDVNF 2207

Query: 2376 LSNFVNIIELIFKSYQIFEDFRKSKIVQNIEKQKHH--------------------EHIK 2415
            LS+FV IIE   +S Q+F++ +  K++ N   Q                       +  K
Sbjct: 2208 LSSFVKIIEATLQSIQVFQELK--KVLVNPLTQSEARSEEEEEESEEHNRRETVPGKEKK 2265

Query: 2416 SENATEFVPTFLSDINSINCEFKYEGGTLRVFSVDDVEIDSTPSLELNAPKVSIYLNYKH 2475
             +   + +  FLSDI  +NC+FKY+GG  +V+S +D+E +  PS E+ +P V+I L+YK+
Sbjct: 2266 EDAPRKDIAPFLSDIRKVNCQFKYDGGIFKVYSFEDIESNLDPSFEIRSPGVTIDLDYKN 2325

Query: 2476 FDDSPKPHWLRCVIDIHSSHNILYSKCAPFVIEFVESIQEILE----NRPVEPKQSVSKI 2531
                 KPH +R +I ++S+HN+L+++CAP ++   + IQ +++     +  EPKQ VS+ 
Sbjct: 2326 NIGDVKPHLIRTLITVNSTHNVLFARCAPLLMALSQDIQHMVKKHSSKKKPEPKQRVSR- 2384

Query: 2532 ATPNRTYKRILAPFDIAFRIKAAKQMLSFSCEPSAKVQANVGLDSFLFGISTGGSSVEDP 2591
             + N  YKR+L  FDI F+I +++Q LS SCEP AKVQANVG DSF+F I T      +P
Sbjct: 2385 PSQNIDYKRLLNSFDILFKIISSEQKLSLSCEPKAKVQANVGFDSFMFAILTNDLDTSEP 2444

Query: 2592 LSLTLCINKISTSVQHIFSKEASASFSLNFIDLTFIFTQP---TLYCVGLISDIDIFFNM 2648
            LS  L +    ++++HIFS+E SASF L+ ID+TF+FT P    ++   LISD++++FN+
Sbjct: 2445 LSFALVVKNTRSAIRHIFSREPSASFGLDLIDVTFMFTHPNIINMFGACLISDVEVYFNV 2504

Query: 2649 KQQQNLLLFLDIWHLSESIGIRPNXXXXXXXXXXGHTQIPETPQP-GKIIPWNFNIIFTN 2707
            KQ QNL LFLDIW LS    +RP                P +P   G IIPW F +IF N
Sbjct: 2505 KQLQNLYLFLDIWKLSNL--LRPKPMKKPEDHHVAIDAPPSSPMDVGNIIPWCFTLIFAN 2562

Query: 2708 VNADIHLGPALGIVSAKLEKTWFISDRYLDKRQILQLFTDGMVLKSRGRLSGMLDISNAG 2767
            +N  + LGP+LG++S  + K WF SD Y  KRQ+L  + D + L ++GRLSG++++  A 
Sbjct: 2563 INGKVDLGPSLGLLSLSMRKAWFASDHYESKRQLLHAYIDQIKLTAKGRLSGIVELDGAL 2622

Query: 2768 WRLEVNYADNELNYNSPIVAIGIDIGCVALKTAFDYHMFMISKVNNIHFRLHSERDPEGK 2827
            W  EVN+   +  Y  P+VA+   I  ++LK AFDYHMF+I  V N  F LHSERD  G 
Sbjct: 2623 WAAEVNWPKYDDPY--PLVALSFVISNISLKVAFDYHMFLIGTVLNTVFHLHSERDTSGF 2680

Query: 2828 LPDXXXXXXXCEEISICSTTLVASNILDIYNTIIRTRQDTKNSYFETLMESNNQDTRTNI 2887
            +PD       CE+I +CST LVA+N+LD+YNTI+R RQDT  SY ETL ESN  DT+  +
Sbjct: 2681 MPDLLKVMLTCEQIDMCSTALVAANLLDLYNTIMRMRQDTNVSYLETLRESNTTDTKETV 2740

Query: 2888 PYSDILKSLNLLRTDVQIDVSKLQLQISPISLFDFEVLVINIDNMSARSETTSTDKLKTR 2947
             Y DILK LNL++TDV +D++ L +QISPISLFD EVLV+NI N+ A  +T + +KL+T 
Sbjct: 2741 DYKDILKVLNLIQTDVVVDINTLNVQISPISLFDVEVLVVNIANVCANVKTHAGEKLETY 2800

Query: 2948 LELQVCNASVALSTAKEELDEESVNKISVADYMTYASKIKGGTILIIPKLLVGMTTWQKV 3007
            L LQ+ NA  +LS++K E+DE+ V+KISV DYM YASKI GGTI  IPKL + M T+QK 
Sbjct: 2801 LHLQLYNAHGSLSSSKGEMDEDMVSKISVEDYMVYASKIVGGTIFDIPKLEISMHTFQKS 2860

Query: 3008 TSNTIEYTFTCKFDGKVSVRWNLGPVNFIKEMWATHVKSLAVRQARXXXXXXXXXXXXXX 3067
             S+ +EY +   F  K++VRWNLGPVNFIKEMW TH+K+LAVR+++              
Sbjct: 2861 NSDILEYGYRSTFGDKIAVRWNLGPVNFIKEMWTTHIKALAVRRSQSLVGTTGDEEGDVE 2920

Query: 3068 XXXXXXXXPAQPKFTYVALVEPSIEMPQIKDLEDATPPMEWFGLNRKKFPSFTHQTAVIV 3127
                     +  K TY+A+ EP I+ PQIKDL DATP +EWFGLNRKKFP FTHQT ++ 
Sbjct: 2921 KRMRDEETLS--KLTYIAIEEPQIDTPQIKDLGDATPSLEWFGLNRKKFPIFTHQTVIVP 2978

Query: 3128 VQKLVHAVEKEYAKIIGHSE 3147
            VQKL+H+ EKEYA I+GHS+
Sbjct: 2979 VQKLIHSAEKEYANIVGHSQ 2998

 Score =  155 bits (392), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 74/177 (41%), Positives = 113/177 (63%), Gaps = 7/177 (3%)

Query: 6   KFVSVSLSREKYFSWVFLVTWILTCILCLLMFFYIDRVFAYSLTFILDWLLWRPYKVKIH 65
           +F S+SL + K FSWVFLV WILT IL + + FY+ R  A+ ++FI +WLLW+ Y++K++
Sbjct: 7   QFNSISLDKGKDFSWVFLVDWILTLILSITVLFYVGRAIAWFISFIAEWLLWKRYRLKVN 66

Query: 66  CEXXXXXXXXXXXXFKNLCIITENSTISILEGKIIWQYWLLNTRVSAY--ELHQQQKEHG 123
            E            FKNL II ++ TIS L G+I W+YWL   R+  +  EL+ +  +  
Sbjct: 67  IESLRVSLLGGRIFFKNLTIIDKDYTISFLIGQISWRYWLFRPRIPQFLTELNAEDDDGA 126

Query: 124 YITPGSGFKNIQLPCKFLFQCEGAEIFVYNKTSAYENIIDSFSPDEKIKYKEFLHKH 180
            +      +N +L C+ L +CEG E+F+YN+T AY+N I  FS +E+ K++EFL++H
Sbjct: 127 SLQ-----RNEKLACRLLLECEGVELFLYNRTVAYDNTIKMFSKEERAKFEEFLNEH 178

 Score =  134 bits (337), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 76/190 (40%), Positives = 107/190 (56%), Gaps = 12/190 (6%)

Query: 298 LNFYPFGLKLTKGSIIFGNKFTPSLLIISYKSAEGIVDVLPATNPRVDLYKMKMKLDFQN 357
           LN+ P  +K++  S + GNKFTPSLLI+S  SAEG++D       ++D+YK K+ +D +N
Sbjct: 238 LNYLPLQIKVSHASYVVGNKFTPSLLIVSADSAEGVMDYCQPKE-KLDIYKTKLTMDAKN 296

Query: 358 FEIEVKPNISYEDDSKPKAFYCDSMLSRLWTKFSTLFDIMPNPLSRYIHFSRLHKNSLFL 417
             + +K NI Y ++   K       LS+LW  F      +  PL      SR  KN   +
Sbjct: 297 VSVSLKQNIGYNEEVLLKFKLTTGKLSKLWDNFVKATAFVRKPLG----LSRKKKNRPSV 352

Query: 418 EDNIFEDEDFEKKWKGLSLYKDAAL-NRGNPEEHIEFDFLNHEYARYCSIVKAPRLIFTN 476
             N      F +KW+GLSLYK+    +  N  + IEFD   HEYA++ SI+K PR I T 
Sbjct: 353 TAN------FHQKWRGLSLYKNYMFEDVQNDLDDIEFDLAGHEYAKFTSIIKCPRAILTY 406

Query: 477 EYDIPGIVPY 486
           E+DIPG VP+
Sbjct: 407 EFDIPGFVPH 416

>ZYRO0C01694g Chr3 (121250..130270) [9021 bp, 3006 aa] {ON} similar to
            uniprot|Q12150 Saccharomyces cerevisiae YLR087C CSF1
            Protein required for fermentation at low temperature
          Length = 3006

 Score = 2048 bits (5307), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1073/2600 (41%), Positives = 1582/2600 (60%), Gaps = 86/2600 (3%)

Query: 590  NISAPPESNMEFQLFDASINYGPWAHRNIMNIQRIFSPIVSRTPELQPDPEPGFLRRYTM 649
            N  APPE  ++ QL+ A+I YGPWA R +  ++ + SP+VSRTP+      PG  R YT+
Sbjct: 442  NSGAPPEFGVDIQLYGANICYGPWAERQLSYLRALLSPVVSRTPKPIKTLTPGSQRIYTI 501

Query: 650  TKISVSIMEDSSWRVPTREPSKDQDFLKRYMKTNDSSRSFGWFDLNFSRNSEATFCISSI 709
             K S+SIME+S+WR+PTRE SKDQ+FL+ Y++T +  R FGW DL F ++S         
Sbjct: 502  FKTSISIMEESTWRIPTREKSKDQEFLRHYVETKEEFRPFGWIDLKFMKDSYGILDTVIC 561

Query: 710  PDVNGYANKLNLDFKDLEVRSSVNHDIFFRSKSYRVDSDIGYPLGWNDEVTWSFVFDSYQ 769
            P   G  N +N  F ++E+R+SVNH++  R+KS+  ++D+GYPLGWND+  W+    S Q
Sbjct: 562  PTEEGSPNNVNFHFSNMEIRTSVNHELLLRAKSFDFEADMGYPLGWNDQANWNINLSSTQ 621

Query: 770  LETFFLREHLVLIADTFSDFSSGEPTPYEFFRPSIYKVDWNFHGYSAYLNVNDHNIINNP 829
            LE F LREH+ LI+D F+DFSSG+PTPYE FRP IY+++WN  GYS YLNVNDHNI+NNP
Sbjct: 622  LEIFILREHITLISDVFADFSSGDPTPYELFRPFIYRINWNLDGYSIYLNVNDHNIVNNP 681

Query: 830  LDFNENCYISVHGDDAHIGVEIPRLGITATYTDIIFQISTPMFRXXXXXXXXXXXXEFMR 889
            LDFNENCY+S+HGD     V+IPR  +    T+I + ISTPMFR            EFM+
Sbjct: 682  LDFNENCYLSLHGDHLIFDVKIPRQTVANRCTEITYHISTPMFRLLLNTPPWNTLNEFMK 741

Query: 890  NKEIGRGYDFTAEGSYIIYSDLDIDNVDSLTIECSTRRMTLLTYGFVIGYLLNVQMNYFG 949
            NKE+GR Y+F   G Y ++S+LDIDNVD++++ECS+   TL  YGFV+ YL+NV+MNYFG
Sbjct: 742  NKEVGRSYNFQVNGLYTVFSELDIDNVDTISVECSSFGTTLHCYGFVVRYLMNVKMNYFG 801

Query: 950  EFSHFITAEEYTDIVRGNDNDIVSTLADFXXXXXXXXXXXXXXXQHNPDNSSKSNIIDPL 1009
            +FSHF+TAEEYT+     +      L D                + NP+    +  I   
Sbjct: 802  DFSHFVTAEEYTN-ANHTEEPKNENLGDEHSGFNISSTEDVETDRTNPEGRPANKGI--- 857

Query: 1010 YNPPLRKDDIKRKVNETDIWFTFSVWEGALLLPEVLYNSDPCIALSFKELIIDFRNCDYY 1069
              P  ++ ++KR  NE DIWF FSVWEGAL+LPE +YNSDPCIAL F EL +D R+ +YY
Sbjct: 858  --PMPKRSELKRTENEMDIWFVFSVWEGALILPETIYNSDPCIALHFNELEVDLRSTNYY 915

Query: 1070 LDLLATLNGTSFKRCIRKNQNDIFELVHNNAIKNLEEHGSVSNISIHGHRMYGAPPTSPS 1129
            +DLLAT+N T  KR + ++ +D+FE V  +  +  + HG +S+++IHGHRMYG PPT P+
Sbjct: 916  MDLLATMNNTELKRYVSRHPHDLFECVRKDNGRQEKSHGYLSSLTIHGHRMYGLPPTEPT 975

Query: 1130 YFSDWAVDVNNLSINSDIYFIRGFISYITKVGFEFSNLQNILLYDESVLDNMTSVTVHGT 1189
            YF  W VD++ L INSD+ F +GF++  +K+GF F NL+NILLY+ + L +MTSVTV   
Sbjct: 976  YFCQWGVDIDRLEINSDLEFAKGFLTCFSKIGFGFKNLENILLYETNTLFDMTSVTVRVK 1035

Query: 1190 GIDILVADKSTSAQVLLNMDGITFNRINFANDRYSSRIDLQVPGLHFAFFD-NGSSMDKT 1248
             +  ++ D  TS++ +L+   ITF  I+F N+ YS R+D + P ++F  F+ + +  +  
Sbjct: 1036 ELKFMMNDADTSSRSVLHAKKITFTAIDFENEAYSQRVDFKFPDINFLIFELDENQKEGR 1095

Query: 1249 CLFEFKTKINFTNFTQMKDGELHSKKQQEFIALNDSAFHRCSFLLLPHIQESLLYHELYG 1308
             L   KT++NFT+F Q +    H  +Q+E+I L+DSA++RCSFLL    QES+LY EL G
Sbjct: 1096 FLLHLKTQLNFTDFIQNQAFADHRYRQREYITLHDSAYYRCSFLLPCFFQESVLYKELLG 1155

Query: 1309 GITXXXXXXXXXXXXQAETIAFIIDDFLGPFG-----INSTELLGSISTSTPIHXXXXXX 1363
             I+             AETI +II+D LG +       +S+    S    TP+       
Sbjct: 1156 SISPSATLPPLPLPVLAETIDYIIEDCLGEYAPTVKPDDSSSSDTSEGQRTPLTNEDTRF 1215

Query: 1364 XXXXXXVIHPIESMQSHLVPSQSVTHGNYIIDISYITLDINPLFFTYASNFLDEFYSENI 1423
                            H  P+    + NY++D+ Y+ L++ P       N+L +FY+E+ 
Sbjct: 1216 QANSGF----FSPHMPHNPPNNRDRYNNYVLDVEYVNLEVKPSVTGVLLNYLKKFYTEDT 1271

Query: 1424 IETIDGIEMAIVNRLGTKSEELDSVTNIKLQIKYLDFFFGQRNTEGLELYVDQIDLEVSQ 1483
             + ID  E+AIV +LG        VT  +L +K L F +      G+EL ++  D ++ +
Sbjct: 1272 TDIIDKNEIAIVKKLGNLQYGASFVTTSRLHVKDLHFLYDFEEGSGVELALNSFDFDLRR 1331

Query: 1484 KTFQKKSTVVLDEIAILSRFLSLRASINEKKVLEDFDERPPALSLALEGWEGWSSTASSQ 1543
            KT + +   V+ E  + S   +LR S+ E         +P AL L++E  E WSST    
Sbjct: 1332 KTIENEDEKVILEKTMFSNIHTLRISLLEAHP-SSISMKPAALQLSIEDLELWSSTVDEN 1390

Query: 1544 VNSLNISSTDITVDESQIEWLIDYLNRLVVFVHELVNSLDSIQKKSNGIQKKLVSDLTLA 1603
            VNS+N++S   T+DESQ+E +  YL   +  + + + S   ++      QK L+ DLT A
Sbjct: 1391 VNSVNVTSFGFTLDESQLERISGYLFGQIKVLRDTITSAKELENLRKKTQKDLICDLTSA 1450

Query: 1604 SEYYQISHDPYVITKPAYVMRVSKGHVRQNRSWRIVTRLRHIYTYLPDDWEI--HVQEEM 1661
            SEYYQISHDPYVITKPA++MR+S+GHVR+NRSWRI+TRLRHI TYLP+DW    H+    
Sbjct: 1451 SEYYQISHDPYVITKPAFIMRLSEGHVRENRSWRIITRLRHILTYLPNDWRTADHLVTVQ 1510

Query: 1662 RGKDMNDVSDSSDIFLTVFSNWRNWEVSDVARSYIYKKIFLSNDETTSEKKLQTTVKLNL 1721
              ++ N      DIF++VFSNWRNW++SD+ RSYIYKKIFL  +E + +K+L+T +K+N 
Sbjct: 1511 DSENPNVPQRDEDIFVSVFSNWRNWDLSDITRSYIYKKIFLPQNEDSFKKELRTVLKINF 1570

Query: 1722 NSIFFTIYSTGYAIDHNIILTKAVILLELTTETAVSPPI----------EKSILNMTGSL 1771
             S FFT+  +GY +  + I T+  I+++      V PP           ++ ++ +T ++
Sbjct: 1571 QSFFFTVLISGYEVARSTIFTRTNIIVD------VLPPSVNTSSENLFKQEKVITLTANM 1624

Query: 1772 GSIKGEFSDKFLRLLELIPDFSKEE-----DIKSLTENSSIVSEKSPY------------ 1814
            G+IKGE+ ++  +L EL   FS+ E     ++ S++ ++SI    S              
Sbjct: 1625 GAIKGEWGEEVFKLKELFSKFSENELDDLSNLGSISRSASISGFGSQMDRLESSRASGPG 1684

Query: 1815 -----FTIHLFLLFENGGLQLTMGDTTLSNNVTDGKISAXXXXXXXXXXXXXXGAYYMKK 1869
                   I   ++FE   L   +GDT L+N + +GK S                 ++ ++
Sbjct: 1685 DRFRNLKIFATMIFERCDLHFVVGDTRLTNRIINGKNSMLLENSKENTPPALSAVFFAQR 1744

Query: 1870 SEMCLKHNKDIIAEFQLHHLGLISTGIYTPICPVILINLRSADLHFKSLASTEKIVKTIE 1929
             E+ LKH+ +++AE  L  L + +T     + P + +N ++ +   +++ ST  +  ++E
Sbjct: 1745 HEIWLKHSTNVLAEVLLKQLHVAATA-QLGVIPFVSLNCQATNSFIRAMPSTVVLRNSVE 1803

Query: 1930 DI---TEYSVHLYKHYDLRKYTTKPTKVDQKPEKINFDVRVACNLSKVSAELTLISPFYL 1986
             I    E  +  +K ++++  +    K  + P  I FD+R   N + +S+E+ L+SPFYL
Sbjct: 1804 KIKRQVEVLIPQFKSHEVKNSSAVTKKTPRIP--IKFDIRF--NFTDMSSEIMLLSPFYL 1859

Query: 1987 RYETKQLDLYFNQNGDGEILLSLWDTDIFVTSHHTKEQYFRFSYDDIQINCNPMSEXXXX 2046
              + KQL +Y + + + E++L   + D+++ S  + EQ+F+FS  D+Q  C    E    
Sbjct: 1860 LQDVKQLHIYASGHENMELVLGFLEYDVYLKSQLSSEQFFKFSSTDLQFKCEVADEVVPV 1919

Query: 2047 XXXXXXXXXXXXTFSEPRRIFASFLQDERITIESFQELKKLKKIFFSNAKNVKKLNNDVP 2106
                        T  EPRR   + LQDE+  +ES   ++KL     S +      N+  P
Sbjct: 1920 VEVQISTSLMKLTLCEPRRALHNLLQDEQTLVESVDHIQKLWNFLRSASGG----NDRSP 1975

Query: 2107 KEDTPTKWALELNINYFGILLPIASTFFVLELHMLLGSLTNTTEEIQEVNNQISGQISLE 2166
              +T  +WAL+ N+ YFG+L+P++S  ++ ELH L  SLTN  E+ +E +   SGQI +E
Sbjct: 1976 SRNT--RWALDANLKYFGLLVPVSSICYIFELHSLFASLTNANEQYEEYDRHFSGQIVVE 2033

Query: 2167 NILFLINDRSLPLRLSKLVDFSIRISTLQKTTSSYESLQIESSHFRMCFSPESLVFVLWG 2226
            +   L+ + SLP  LSK++DFSIR  T QK  +S +S QIESS+FR+C  PE LV +LW 
Sbjct: 2034 SCYLLVKELSLPANLSKVLDFSIRFLTSQKVPNSLQSYQIESSYFRLCLFPELLVDILWS 2093

Query: 2227 VKQLQNELEYYKDHKTKRQWNLXXXXXXXXXXXXXXPLNYFRSIHILSYNFCIGWMLPEN 2286
            V  LQ+ L ++K H T   W                 L+ FRSIHILSYNFC+GW+    
Sbjct: 2094 VHYLQSLLNHFKKHHTP--W--LPYSSNKTAKSGESTLD-FRSIHILSYNFCVGWLFEVG 2148

Query: 2287 QKDIPGWMFGYDRLFSAYEKNYGKLTLIEGYMSVTNSNSSNDFFSQGEEKNRHNRSFLPS 2346
                PG + GYDRLFSAYEK++GKLTLI+GY+SV N N+S+ F+SQ  EK+ + R++L +
Sbjct: 2149 DNSEPGLILGYDRLFSAYEKHFGKLTLIDGYLSVANGNTSDTFYSQKSEKDSYTRTYLSN 2208

Query: 2347 MQILYWLKEFNSKKDLFIRLHGDALDVDILSNFVNIIELIFKSYQIFEDFRKSKIVQNIE 2406
            MQI YWLK  N  KDLF+R HG+ +DV  LS    ++E    S + F + +K+KI Q   
Sbjct: 2209 MQIFYWLKGENLLKDLFVRFHGEVIDVRFLSTSFKLVEKTLHSIKRFNEMKKAKIKQTGS 2268

Query: 2407 KQKHHEHIKSENATEFVPTFLSDINSINCEFKYEGGTLRVFSVDDVEIDSTPSLELNAPK 2466
              K    +  E A+  +  FL+ I +IN +  + GG  +V+S  +++  + P LE+ +P 
Sbjct: 2269 STK--SKLNMEAASNTLAPFLAHIRTINSQLNFAGGVFKVYSPTELDSKAEPLLEIKSPG 2326

Query: 2467 VSIYLNYKHFDDSPKPHWLRCVIDIHSSHNILYSKCAPFVIEFVESIQEILENRPVEPKQ 2526
            V + +NY+  +   K H +R    I  +HN+L++KCAP + +F  +I+ ++ N   E K 
Sbjct: 2327 VQMAINYEFNETREKSHCIRFFTTIEPTHNMLFAKCAPLLSDFNHNIKNMIRNLSSEDKS 2386

Query: 2527 SVSKIATPNRTYKRILAPFDIAFRIKAAKQMLSFSCEPSAKVQANVGLDSFLFGISTGGS 2586
              SK  T +  YK +L P+DIAF I + KQ LSFSCEP AKVQ + G +SFLF ++T   
Sbjct: 2387 HPSKPVTDSIDYKSLLNPYDIAFEIASGKQKLSFSCEPKAKVQLDAGFNSFLFRVTTDKV 2446

Query: 2587 SVEDPLSLTLCINKISTSVQHIFSKEASASFSLNFIDLTFIFTQPTLYCVGLISDIDIFF 2646
               +P +++  ++KI +SV+HIFS+++SA+F L++ID+  +FT P +Y V L+SD++I+ 
Sbjct: 2447 DSVEPFNVSFSMDKIESSVRHIFSRDSSAAFMLDYIDIVMMFTYPNVYGVALVSDMNIYC 2506

Query: 2647 NMKQQQNLLLFLDIWHLSESIGIRPNXXXXXXXXXXGHTQIPETPQPG----KIIPWNFN 2702
            NMKQ+QNL +FLDIW LS     +P+            +  P          K+ PW+F 
Sbjct: 2507 NMKQRQNLNIFLDIWRLSNRGRTKPSENKAEDKSDAKKSLSPPFSPSSNDSRKVFPWSFT 2566

Query: 2703 IIFTNVNADIHLGPALGIVSAKLEKTWFISDRYLDKRQILQLFTDGMVLKSRGRLSGMLD 2762
            IIFTN+   + LGP+LG+++  LE+ W  +    D+++    F  G+ + S GRLSGM +
Sbjct: 2567 IIFTNMGGVVDLGPSLGVLTLGLEQVWITTKHQGDQKRTWHTFAHGITVNSEGRLSGMFE 2626

Query: 2763 ISNAGWRLEVNYADNELNYNSPIVAIGIDIGCVALKTAFDYHMFMISKVNNIHFRLHSER 2822
            +  A    E+++ + +L    P++++ + I  +++K+AFDYHMF+I  + ++   LH+E 
Sbjct: 2627 LDQASSVSEISWPEEDLLRVGPLISVSMAINRMSIKSAFDYHMFLIGSMKSVKVHLHNES 2686

Query: 2823 DPEGKLPDXXXXXXXCEEISICSTTLVASNILDIYNTIIRTRQDTKNSYFETLMESNNQD 2882
            D    LPD        E I +C+T L A+N LDIYNTI+R +QD + SY ETL ESN   
Sbjct: 2687 DTYAILPDLLQVSLEFESIVLCATALTAANALDIYNTIMRMQQDNRISYIETLKESNISA 2746

Query: 2883 TRTNIPYSDILKSLNLLRTDVQIDVSKLQLQISPISLFDFEVLVINIDNMSARSETTSTD 2942
            + T++ Y ++L SLNLLRTD+ + V +L++ ISP+SLFD EVLV+++ +++ARSET S +
Sbjct: 2747 SSTSVAYEEVLNSLNLLRTDMSVIVKELKVHISPMSLFDAEVLVVSVRDVNARSETQSGE 2806

Query: 2943 KLKTRLELQVCNASVALSTAKEELDEESVNKISVADYMTYASKIKGGTILIIPKLLVGMT 3002
            KLKT L+LQ+ + + +LS++KEELDEE+V+KI+V DYM YASK  GGTI+ +P+LLV MT
Sbjct: 2807 KLKTELQLQISDVNASLSSSKEELDEETVSKIAVDDYMLYASKFSGGTIIKLPQLLVSMT 2866

Query: 3003 TWQKVTSNTIEYTFTCKFDGKVSVRWNLGPVNFIKEMWATHVKSLAVRQARXXXXXXXXX 3062
            TWQ+ +S  +EY FTCKF  K+S++WNLGPVNFIKEMWATHV+SLAVR+ +         
Sbjct: 2867 TWQQQSSPVLEYLFTCKFFDKISMKWNLGPVNFIKEMWATHVRSLAVRRTQLGNSSPELE 2926

Query: 3063 XXXXXXXXXXXXXPAQPKFTYVALVEPSIEMPQIKDLEDATPPMEWFGLNRKKFPSFTHQ 3122
                           + KF YV L EP IEMPQIKDL DATPP+EWFG++RK  P+ THQ
Sbjct: 2927 VANESDKEDT----VKSKFIYVPLDEPYIEMPQIKDLGDATPPLEWFGVHRKNLPAATHQ 2982

Query: 3123 TAVIVVQKLVHAVEKEYAKI 3142
            TAV+++QKLVH  EKEYAK+
Sbjct: 2983 TAVLLIQKLVHTAEKEYAKL 3002

 Score =  171 bits (433), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 85/176 (48%), Positives = 117/176 (66%), Gaps = 8/176 (4%)

Query: 7   FVSVSLSREKYFSWVFLVTWILTCILCLLMFFYIDRVFAYSLTFILDWLLWRPYKVKIHC 66
           F  VSL R + FSWVFLV W+LTCI+ L + FY+ R+F + LTFIL+W++W+  KVKI+ 
Sbjct: 7   FQKVSLDRTRNFSWVFLVDWVLTCIVTLTVIFYLGRIFGFLLTFILEWVVWKRCKVKINI 66

Query: 67  EXXXXXXXXXXXXFKNLCIITENSTISILEGKIIWQYWLLNTRVSAYELH----QQQKEH 122
           E            F+NLCII  + TIS LEG I W+YWL N+R S Y+ +    +++ E+
Sbjct: 67  ESLRIAPLGGNIMFRNLCIIHRDYTISCLEGTINWRYWLFNSRKSQYQENLDNEEERLEN 126

Query: 123 GY-ITPGSGFKNIQLPCKFLFQCEGAEIFVYNKTSAYENIIDSFSPDEKIKYKEFL 177
           G      SG K+   PC+FL  CEG EIFVYNKTS+YENII  FS +E+ ++++F+
Sbjct: 127 GQEPKSNSGRKH---PCRFLLACEGLEIFVYNKTSSYENIIHMFSKEERAQFEKFV 179

 Score =  132 bits (331), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 69/193 (35%), Positives = 116/193 (60%), Gaps = 19/193 (9%)

Query: 298 LNFYPFGLKLTKGSIIFGNKFTPSLLIISYKSAEGIVDVLPATNPRVDLYKMKMKLDFQN 357
           + F P  +   + S++ GN+FTPS+L++S K+++GI+D+ P    ++DL+K+K++ +  +
Sbjct: 259 MRFLPIQISTRRFSLVLGNRFTPSILVVSAKNSKGIIDLCPPKE-KLDLFKIKLEKELYD 317

Query: 358 FEIEVKPNISYEDDSKPKAFYCDSMLSRLWTKFSTLFDIMPNPLSRYIHFSRLHKNSLFL 417
            +  VK NI ++DD      +    LS+LW KF+ +F ++P    +++            
Sbjct: 318 VDASVKQNIGFDDDISTSFKWTRGRLSKLWQKFARIF-LLPTLGPKHLQTQ--------- 367

Query: 418 EDNIFEDEDFEKKWKGLSLYKDAALNRGNPEEHIEFDFLNHEYARYCSIVKAPRLIFTNE 477
                ED  F + WKGLSLY+       +  E+++FDF NHEYAR  SI+K+ +++FT E
Sbjct: 368 -----EDITFRENWKGLSLYRQNM--EEDELENVDFDFANHEYARVISILKSAKIVFTYE 420

Query: 478 YDIPGIVPY-PED 489
           YDIPG+VP  PE+
Sbjct: 421 YDIPGLVPKEPEE 433

>TPHA0J00730 Chr10 complement(165253..174393) [9141 bp, 3046 aa] {ON}
            Anc_8.260 YLR087C
          Length = 3046

 Score = 1851 bits (4794), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1002/2596 (38%), Positives = 1508/2596 (58%), Gaps = 85/2596 (3%)

Query: 590  NISAPPESNMEFQLFDASINYGPWAHRNIMNIQRIFSPIVSRTPELQPDPEPGFLRRYTM 649
            N  +PP   ++ QL  ASI +G W +RNI++++ +  P++S+  +     +PG  R ++M
Sbjct: 499  NHESPPTFLIDLQLSHASIYFGSWVNRNIVDLRDLMFPVISKDQKPLNKLKPGLTRVHSM 558

Query: 650  TKISVSIMEDSSWRVPTREPSKDQDFLKRYMKTNDSSRSFGWFDLNFSRNSEATFCISSI 709
               SVS+++DSS R+PTREPSKD DFLK+Y++T D  R+FGW DL+F + SE    I  I
Sbjct: 559  FNFSVSVLDDSSIRLPTREPSKDSDFLKQYLETKDDFRAFGWIDLSFKKGSEFMLNIPMI 618

Query: 710  PDVNGYANKLNLDFKDLEVRSSVNHDIFFRSKSYRVDSDIGYPLGWNDEVTWSFVFDSYQ 769
            P   G+ N L   F +LEV +SVNH++ F+S S  + ++IGYPLGWND V W F  +S Q
Sbjct: 619  PTSGGFENTLFSKFSELEVTTSVNHNLLFKSNSLNIAANIGYPLGWNDPVNWIFNINSKQ 678

Query: 770  LETFFLREHLVLIADTFSDFSSGEPTPYEFFRPSIYKVDWNFHGYSAYLNVNDHNIINNP 829
            L+ F LREH+ L++D   DFS+ EPTPYE FR   Y ++    GYS Y NVND NIINNP
Sbjct: 679  LDIFLLREHITLLSDMIIDFSTQEPTPYELFRSFTYNLNLKIGGYSFYFNVNDRNIINNP 738

Query: 830  LDFNENCYISVHGDDAHIGVEIPRLGITATYTDIIFQISTPMFRXXXXXXXXXXXXEFMR 889
            LDFNENCY+S HGD     + IP + +   Y  I ++I TPMFR            EFMR
Sbjct: 739  LDFNENCYLSFHGDLFTSEITIPIISLAQQYVTISYEIFTPMFRLFLNTPSWNTLSEFMR 798

Query: 890  NKEIGRGYDFTAEGSYIIYSDLDIDNVDSLTIECSTRRMTLLTYGFVIGYLLNVQMNYFG 949
            NKEIGR +DF   G+Y+IYS+LDIDNVDSLTI+  +    L  +GFVI Y++N Q NYFG
Sbjct: 799  NKEIGRSHDFRVSGTYLIYSELDIDNVDSLTIDFESNSTVLYCFGFVIKYMMNFQANYFG 858

Query: 950  EFSHFITAEEYTDIVRGNDNDIVSTLADFXXXXXXXXXXXXXXXQHNPDNSSKSNIIDPL 1009
             F  FIT EEY++++R N ND + ++                  +      S +N ++ +
Sbjct: 859  SFIKFITTEEYSELIRNNVNDNLGSI----------NTNDLTSIEGLQKMDSITNDVEDI 908

Query: 1010 YNPPLRKDDIKRKVNETDIWFTFSVWEGALLLPEVLYNSDPCIALSFKELIIDFRNCDYY 1069
                +++ D+ R  NETDIW  F V +GAL+LPE LYN D C++LSF EL I+ R C+YY
Sbjct: 909  NQKTIKRSDLLRTENETDIWLNFKVNDGALILPEELYNGDSCVSLSFGELFINMRTCNYY 968

Query: 1070 LDLLATLNGTSFKRCIRKNQNDIFELVHNNAIKNLEEHGSVSNISIHGHRMYGAPPTSPS 1129
            +D+  TL   +  R  + + +++FE +     ++    G++S+I+IHGHRMYG PP   +
Sbjct: 969  MDVYITLYDNNLNRFEKIDPHELFEYIQTRN-RSSSVEGNISDITIHGHRMYGLPPKELT 1027

Query: 1130 YFSDWAVDVNNLSINSDIYFIRGFISYITKVGFEFSNLQNILLYDESVLDNMTSVTVHGT 1189
            YF  W++++    I+SD+ F+  FI  + K+GF  SN +N LLY+   +++MT ++V   
Sbjct: 1028 YFCQWSINIGTFLIDSDMIFLLSFIQSLNKIGFFLSNKENSLLYESDTVNDMTLLSVDVE 1087

Query: 1190 GIDILVADKSTSAQVLLNMDGITFNRINFANDRYSSRIDLQVPGLHFAFFDNGSSMDKTC 1249
             + ++++D    A+  +    I    I+F N++Y+ R+D+     +F+         K  
Sbjct: 1088 SLKVILSDPLLEARAEIGASSIIIRNIDFENEKYTKRLDVNASEFYFSLDSLKIDSGKKN 1147

Query: 1250 LFEFKTKINFTNFTQMKDGELHSKKQQEFIALNDSAFHRCSFLLLPHIQESLLYHELYGG 1309
            + + +TK+N TNF +  +   H   Q++FI L+DS +HRC FLL    QES  Y ELYG 
Sbjct: 1148 ILDVRTKLNITNFFKTDNHINHLDTQRKFIGLHDSPYHRCFFLLPEKFQESSSYKELYGS 1207

Query: 1310 ITXXXXXXXXXXXXQAETIAFIIDDFLGPF------------GINSTELLGSISTSTPIH 1357
            IT               T  FI++  L  +             IN+   L S+ T TP+ 
Sbjct: 1208 ITPSFSLPMLPIPHIYSTTNFIVEGILDDYSEFLLSDHHNQMSINAE--LNSVDT-TPLK 1264

Query: 1358 XXXXXXXXXXXXVIHPIESMQSHLVPSQSVTHGNYIIDISYITLDINP-LFFT---YASN 1413
                            I + Q+ L         N+++++ Y+T+ +NP + FT   +++ 
Sbjct: 1265 DSFDMQ----------ITNFQNILTTEDPYETDNFVVNVKYLTVTVNPDIVFTIEKFSTE 1314

Query: 1414 FLDEFYSENIIETIDGIEMAIVNRLGTKSEELDSVTNIKLQIKYLDFFFGQRNTEGLELY 1473
            F  +F   N    IDGIEMAIVNRL    E + S  N+ L ++ +D  +G R+   +  Y
Sbjct: 1315 FNKKFSMNN---QIDGIEMAIVNRLSDLKENISSKINVNLNVEKIDAAWGHRDVCFIGTY 1371

Query: 1474 VDQIDLEVSQKTFQKKSTVVLDEIAILSRFLSLRASINEKKVLEDFDERPPALSLALEGW 1533
            ++ +  E+SQ++    +  +  ++ +L +F S+R  I         D+RPP LSL LEG+
Sbjct: 1372 INMLKFELSQESTYNNNGGLQKDLTLLGKFRSVRIIIQNHSYNSFSDDRPPGLSLMLEGF 1431

Query: 1534 EGWSSTASSQVNSLNISSTDITVDESQIEWLIDYLNRLVVFVHELVNSLDSIQKKSNGIQ 1593
            E WSST + Q+ +LN++S DITVDE QI WLI Y+   ++   ++ +S+  I  +    Q
Sbjct: 1432 EAWSSTTTKQLTTLNLTSFDITVDEYQIHWLIPYVKSQILLFTKIQDSVKLIYDEQASYQ 1491

Query: 1594 KKLVSDLTLASEYYQISHDPYVITKPAYVMRVSKGHVRQNRSWRIVTRLRHIYTYLPDDW 1653
            K  ++ L  A E YQI HDPYVITKPA V+R+S  H+R+NRSWRIVT+LRHI TYLP+DW
Sbjct: 1492 KTFITSLIWAGEKYQIDHDPYVITKPATVLRLSAWHIRENRSWRIVTKLRHILTYLPEDW 1551

Query: 1654 EIHVQEEMRGKDMNDVSDSSDIFLTVFSNWRNWEVSDVARSYIYKKIFLSNDETTSEKKL 1713
            E  + EE   K      +++  FL VFSNWRNWEVSD+ +SYIY+ IF+   E  S++ L
Sbjct: 1552 EDRLDEEDLIKRSGLEKEAASTFLNVFSNWRNWEVSDIEKSYIYRMIFV---EEVSKRIL 1608

Query: 1714 QTTVKLNLNSIFFTIYSTGYAIDHNIILTKAVILLELTTETAVSPPI---EKSILNMTGS 1770
            Q ++K+ L + +FTIYS  Y+ D N ++TKA IL+    +      +   ++ I+++   
Sbjct: 1609 QNSIKVFLETFYFTIYSRNYSADQNFLITKANILINNEADQVNEVDLIRKQEEIVDVVTK 1668

Query: 1771 LGSIKGEFSDKFLRLLELIPDFSKEE-DIKSLTENSSIVSEKSPYFTIHLFLLFENGGLQ 1829
            +GSIK EF++  L+L   I    K   D KS  +  SI    + +F ++L  +F++    
Sbjct: 1669 IGSIKFEFTEAILKLKRDIEQIIKTSVDSKSEGDKLSI----TKFFKVNLSFIFDHIDFN 1724

Query: 1830 LTMGDTTLSNNVTDGKISAXXXXXXXXXXXXXXGAYYMKKSEMCLKHNKDIIAEFQLHHL 1889
                +++L + +++  I +                YY  ++ + LKH  +I+ + Q+ +L
Sbjct: 1725 GQFYNSSLKSRMSNVNILSYFENNIESSTPSGSFVYYADRTGIALKHLNNILIDCQVRNL 1784

Query: 1890 GLISTGIYTPICPVILINLRSADLHFKSLASTEKIVKTIEDITEYSVHLYKHYDLRKYTT 1949
               +T         ++IN R ++LHFKS+  TE  V  I+ I      L       + TT
Sbjct: 1785 FASTTAELHSAVNSLMINFRCSNLHFKSVPKTEIFVNAIKAIQRDVETLSAEISKAQGTT 1844

Query: 1950 KPTKVDQKP---EKINF---------DVRVACNLSKVSAELTLISPFYLRYETKQLDLYF 1997
                 +  P   EK            ++ ++   + VS+E+TL+ P YL++ET  +++ +
Sbjct: 1845 DNINTEHTPSVHEKNKMQKAKPNSKNNITLSATFTNVSSEITLLHPIYLKHETNSVNISY 1904

Query: 1998 NQNGDGEILLSLWDTDIFVTSHHTKEQYFRFSYDDIQINCNPMSEXXXXXXXXXXXXXXX 2057
            N     E+L+ + DTD+++ S HTKEQY R SYD +++                      
Sbjct: 1905 NTINIDELLVQVLDTDLYLNSSHTKEQYARLSYDKLELTTFLPDLNEKLIDLEISSSILK 1964

Query: 2058 XTFSEPRRIFASFLQDERITIESFQELKKLKKIFFSNAKNVKKLNNDVPKEDTPT----- 2112
             T S+PRR+  SFLQDE+    S   L+ L           + LN     ED+ T     
Sbjct: 1965 LTTSDPRRMLFSFLQDEKELKNSLTFLRSL-----------ESLNRKANSEDSETLFSSY 2013

Query: 2113 KWALELNINYFGILLPIASTFFVLELHMLLGSLTNTTEEIQEVNNQISGQISLENILFLI 2172
            +W +     Y G+LLPI +T++V ELH  L +++N  E    V+ +  G +S ++I+FLI
Sbjct: 2014 EWIVNFKSKYMGVLLPIQATYYVFELHDALSTVSNKEEPSSAVHKKFHGDLSFDHIIFLI 2073

Query: 2173 NDRSLPLRLSKLVDFSIRISTLQKTTSSYESLQIESSHFRMCFSPESLVFVLWGVKQLQN 2232
             D+S+P + SK++DFSI++ST +   +   S +IESS FR+C +P SL+  +WG  QL  
Sbjct: 2074 KDQSIPHKFSKILDFSIKLSTHRTVNNFDRSFEIESSFFRVCLTPFSLIQTMWGYYQLLY 2133

Query: 2233 ELEYYKDHKTKRQWNLXXXXXXXXXXXXXXPLNYFRSIHILSYNFCIGWMLPENQKDIPG 2292
             L  Y D  T   +                 +   RS HILSYNF IGW+  ++   IPG
Sbjct: 2134 LLNSYYDQSTVNFFVFNDNNIDGATNSEKENVFSVRSFHILSYNFSIGWLYQDSDNTIPG 2193

Query: 2293 WMFGYDRLFSAYEKNYGKLTLIEGYMSVTNSNSSNDFFSQGEEKNRHNRSFLPSMQILYW 2352
             + GY+RLFS YE N+GKLTL++G+ S+ N +S + F+S G+E ++ NRS+LP++QILYW
Sbjct: 2194 LILGYNRLFSTYEDNHGKLTLVDGFFSLANGSSGDTFYSSGDESSKFNRSYLPNIQILYW 2253

Query: 2353 LKEFNSKKDLFIRLHGDALDVDILSNFVNIIELIFKSYQIFEDFRKSKIVQNIEKQKHHE 2412
            +KE    K LFI+ HG+ LDV+   NFVNIIE   +S  +F+  ++ KI   ++ +   +
Sbjct: 2254 IKEIEKMKHLFIKFHGETLDVNFFENFVNIIESTVRSIDLFQTLKREKINPLVKAKPERD 2313

Query: 2413 HIKSENATEFVPTFLSDINSINCEFKYEGGTLRVFSVDDVEIDSTPSLELNAPKVSIYLN 2472
               +   T         +  +NCEF Y+GG  R+FS   +     P+L + +PKV I L+
Sbjct: 2314 EKSNSALTNIKGPIFGKLKQVNCEFIYDGGLFRLFSNASMTNKLEPTLMIKSPKVKIMLS 2373

Query: 2473 YKHFDDSPKPHWLRCVIDIHSSHNILYSKCAPFVIEFVESIQEILENRPVEPKQSVSKIA 2532
            Y +F+   K HW+ C+IDI  + N+L S C PF+ +F+  I++I+E + V  ++++    
Sbjct: 2374 YDYFEKELKKHWINCLIDIEPTQNVLKSGCVPFLSDFISQIKDIVELQDVNMEENMDNNV 2433

Query: 2533 TPNRTYKRILAPFDIAFRIKAAKQMLSFSCEPSAKVQANVGLDSFLFGISTGGSSVEDPL 2592
                    +L  FDI F++ +  Q ++  CEP AK+  +VG  SF F I T   +  DPL
Sbjct: 2434 KDPINITSLLENFDICFKLISGTQHVTLDCEPKAKINTDVGFGSFEFSILTPHLNPIDPL 2493

Query: 2593 SLTLCINKISTSVQHIFSKEASASFSLNFIDLTFIFTQPTLYCVGLISDIDIFFNMKQQQ 2652
             ++L IN I TSV+H FS EASASF ++ +D+  IFT P ++  GL+ D+ + FN+KQ Q
Sbjct: 2494 DISLKINDIKTSVKHQFSNEASASFEVSKLDVILIFTHPEVFGTGLVDDVKLHFNLKQFQ 2553

Query: 2653 NLLLFLDIWHLSESIGIRPNXXXXXXXXXXGHTQIPETPQPGKIIPWNFNIIFTNVNADI 2712
            N+ +FLDIW +S+S   +              + I +T      +PW+F  I TN+N DI
Sbjct: 2554 NISIFLDIWDVSKSTEKKLFKKDSNTLVDAKSSPIAQTIVNSSTLPWSFVFIATNINGDI 2613

Query: 2713 HLGPALGIVSAKLEKTWFISDRYLDKRQILQLFTDGMVLKSRGRLSGMLDISNAGWRLEV 2772
            ++G  LG ++  L++TW  +D + +KRQ+L LFTD + + S GRL G ++I +  W+L+V
Sbjct: 2614 NMGSTLGNLALNLQRTWISTDHFHNKRQLLHLFTDNVKISSEGRLGGFVEIDDITWKLDV 2673

Query: 2773 NYADNELNYNSPIVAIGIDIGCVALKTAFDYHMFMISKVNNIHFRLHSERDPEGKLPDXX 2832
            NY D      SP+V +  D+G V++K AFDYHMF+IS V ++ F + SE+D +  LPD  
Sbjct: 2674 NYVDKYKFVVSPLVDLLFDVGKVSMKVAFDYHMFLISTVKDLKFHVLSEKDIDDILPDLL 2733

Query: 2833 XXXXXCEEISICSTTLVASNILDIYNTIIRTRQDTKNSYFETLMESNNQDTRTNIPYSDI 2892
                 C+EI +C+T LVASNILDIYNTI+RTRQD KNSY ETL+ESNN   +    Y DI
Sbjct: 2734 TVNLTCDEIKVCTTALVASNILDIYNTIMRTRQDNKNSYIETLLESNNNVLKRKPLYEDI 2793

Query: 2893 LKSLNLLRTDVQIDVSKLQLQISPISLFDFEVLVINIDNMSARSETTSTDKLKTRLELQV 2952
            LKSLNLL+T +  ++ +L LQISP SL+D EV++I + ++ + +ET + +K+KT LE++V
Sbjct: 2794 LKSLNLLQTSLSANIHELNLQISPSSLYDAEVIIIRVQDVFSSTETRTGEKIKTDLEMRV 2853

Query: 2953 CNASVALSTAKEELDEESVNKISVADYMTYASKIKGGTILIIPKLLVGMTTWQKVTSNTI 3012
             NA+++L++  +EL EE + ++S   Y++YAS +  G I  IP+L + MTT+Q   +  +
Sbjct: 2854 YNATLSLTSFGKELTEEDIAEMSAETYISYASTLTSGRIFEIPQLTINMTTFQNADNMIL 2913

Query: 3013 EYTFTCKFDGKVSVRWNLGPVNFIKEMWATHVKSLAVRQARXXXXXXXXXXXXXXXXXXX 3072
            +YT++C FDGKV V WNLGP+NFIKE+WATHV+SL VR  +                   
Sbjct: 2914 QYTYSCSFDGKVDVTWNLGPINFIKEVWATHVRSLEVRTVQ---FMGNHDISLENEGDTD 2970

Query: 3073 XXXPAQPKFTYVALVEPSIEMPQIKDLEDATPPMEWFGLNRKKFPSFTHQTAVIVVQKLV 3132
                      Y+AL EP IEMPQIKDL+DATPP+EWFGLNRK FPS THQ+ ++ +QKLV
Sbjct: 2971 ESVKVLSNIEYIALEEPYIEMPQIKDLKDATPPLEWFGLNRKYFPSATHQSVIVPIQKLV 3030

Query: 3133 HAVEKEYAKIIGHSEQ 3148
            +  +KEYAK++G S++
Sbjct: 3031 NVAQKEYAKVLGSSKE 3046

 Score =  120 bits (302), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 65/197 (32%), Positives = 112/197 (56%), Gaps = 14/197 (7%)

Query: 292 MYEEFQLNFYPFGLKLTKGSIIFGNKFTPSLLIISYKSAEGIVD-VLPATNPRVDLYKMK 350
           +  +  L+  P  + + KG+I  GNKFT SLL+I++  A G++D  LP  + ++D++K K
Sbjct: 299 IMRKLHLDILPLDININKGAITIGNKFTRSLLVINFTEAHGLLDYALP--DSKLDVFKNK 356

Query: 351 MKLDFQNFEIEVKPNISYEDDSKPKAFYCDSMLSRLWTKFSTLFDIMPNPLSRYIHFSRL 410
           +  +  + ++ +K NI Y  +   +  +   +L+R+W+    + +++P    +  + S  
Sbjct: 357 VTFEINDIDMSIKRNIGYNPELASRFNFRAGVLTRIWSYLQLVLNLIPTGRLKTWYESLR 416

Query: 411 HKNSLFLEDNIFEDEDFEKKWKGLSLYKDAALNRGN-PEEHIEFDFLNHEYARYCSIVKA 469
           +K          ED  F KKW GL LYKD+  +      + ++FDF NHEYA+  +  KA
Sbjct: 417 YK----------EDTTFVKKWDGLVLYKDSVKSSTKLGADDVDFDFANHEYAKVSNFFKA 466

Query: 470 PRLIFTNEYDIPGIVPY 486
           P++IF+ E DIPGIVP+
Sbjct: 467 PQIIFSIESDIPGIVPH 483

 Score =  117 bits (293), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 51/113 (45%), Positives = 73/113 (64%)

Query: 6   KFVSVSLSREKYFSWVFLVTWILTCILCLLMFFYIDRVFAYSLTFILDWLLWRPYKVKIH 65
           +F +VSLS+E+YFSWVFLV WIL  +      FY+ +++ + LTF  +WLLW+   +K+ 
Sbjct: 7   EFANVSLSQERYFSWVFLVYWILVVVATSTFVFYVAKLWGFGLTFACEWLLWKTMNIKVT 66

Query: 66  CEXXXXXXXXXXXXFKNLCIITENSTISILEGKIIWQYWLLNTRVSAYELHQQ 118
            E            FKN+C+I ++ TISILE  + W+YWLLNTR S YEL+ +
Sbjct: 67  IESIRLSFLTGTIFFKNVCLIDQDKTISILECSVTWRYWLLNTRKSEYELNAK 119

 Score = 53.5 bits (127), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 24/49 (48%), Positives = 33/49 (67%)

Query: 132 KNIQLPCKFLFQCEGAEIFVYNKTSAYENIIDSFSPDEKIKYKEFLHKH 180
           KN +L   F   C G EIF+YN+  AYE II +FS +EKI++ +FL +H
Sbjct: 180 KNKKLDSLFAINCTGFEIFLYNRKRAYETIIQNFSKEEKIQFIDFLRQH 228

>SAKL0H17072g Chr8 (1498942..1507935) [8994 bp, 2997 aa] {ON} similar
            to uniprot|Q12150 Saccharomyces cerevisiae YLR087C CSF1
            Protein required for fermentation at low temperature
          Length = 2997

 Score = 1627 bits (4213), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 946/2627 (36%), Positives = 1441/2627 (54%), Gaps = 121/2627 (4%)

Query: 590  NISAPPESNMEFQLFDASINYGPWAHRNIMNIQRIFSPIVSRTPELQPDPEPGFLRRYTM 649
            N  APPE +++F+L+ A+I YGPWAHR I  +QR+  PIVSR         PG  R YT 
Sbjct: 420  NSGAPPEFSLDFKLYGATICYGPWAHRQIQYLQRMLCPIVSRDAIPLKKLTPGSRRIYTR 479

Query: 650  TKISVSIMEDSSWRVPTREPSKDQDFLKRYMKTNDSSRSFGWFDLNFSRNSEATFCISSI 709
              +SV +MED+ WR+PTRE SKDQDFLK+Y ++ +  R FGW D+  ++ ++    +   
Sbjct: 480  FNLSVLMMEDALWRIPTRESSKDQDFLKQYRESKNKERPFGWLDIKLTKETDLFMTVGMC 539

Query: 710  PDVNGYANKLNLDFKDLEVRSSVNHDIFFRSKSYRVDSDIGYPLGWNDEVTWSFVFDSYQ 769
            P + G+ NKL       E+RSSVNHDIFF++ +  + +D+GYPLGWN E  W F F+S Q
Sbjct: 540  PTITGFENKLGFHLVKPEIRSSVNHDIFFKADAQTISADLGYPLGWNSEAQWVFQFNSKQ 599

Query: 770  LETFFLREHLVLIADTFSDFSSGEPTPYEFFRPSIYKVDWNFHGYSAYLNVNDHNIINNP 829
            + TFFLR+H+ L++D F DF SG PTPYE FRP +Y+ +W+   YS YLNVND NIINNP
Sbjct: 600  VHTFFLRDHINLLSDIFMDFGSGIPTPYELFRPFVYRFEWSIDNYSIYLNVNDANIINNP 659

Query: 830  LDFNENCYISVHGDDAHIGVEIPRLGITATYTDIIFQISTPMFRXXXXXXXXXXXXEFMR 889
            LDFNENCY+S+HGD   I   +    IT   T + + I TP F             EFM+
Sbjct: 660  LDFNENCYLSLHGDTLKIDFSVDLKTITGNSTTVNYSIRTPEFHLQLDTPSWSTLHEFMK 719

Query: 890  NKEIGRGYDFTAEGSYIIYSDLDIDNVDSLTIECSTRRMTLLTYGFVIGYLLNVQMNYFG 949
            NKE+GR YDF   GSY  +SD+D+ N+D++ IEC ++  TL   GFVI YL+N+ MNYFG
Sbjct: 720  NKEVGRSYDFCMNGSYQFHSDVDVGNMDTILIECQSKYTTLQCCGFVIRYLMNINMNYFG 779

Query: 950  EFSHFITAEEYT------------DIVRGNDNDIVSTLADFXXXXXXXXXXXXXXXQHNP 997
            +F HF T EEYT            +++  N +D  S ++                 + N 
Sbjct: 780  DFIHFKTTEEYTRELQEKLETREAEVIADNVSDESSQMSSTSFVTNDKETTEYDLHEFNE 839

Query: 998  DNSSKSNIIDPLYNPPLRKDDIKRKVNETDIWFTFSVWEGALLLPEVLYNSDPCIALSFK 1057
            D             P +++ D+KRK NE D+WFTF V +G L+ PE +Y+   CI L F 
Sbjct: 840  D-------------PKVKRADLKRKENEKDVWFTFCVEDGCLVFPENIYDCTSCIGLHFD 886

Query: 1058 ELIIDFRNCDYYLDLLATLNGTSFKRCIRKNQNDIFELVHNNAIKNLEE--HGSVSNISI 1115
             L +D R  +YY+DL A+L+ T  KR    N  +IF++V   A + L +   G +S ++I
Sbjct: 887  SLDVDLRYLNYYMDLQASLSPTYIKRHSDFNPRNIFDVVR--ACEGLVDGHQGFLSELNI 944

Query: 1116 HGHRMYGAPPTSPSYFSDWAVDVNNLSINSDIYFIRGFISYITKVGFEFSNLQNILLYDE 1175
            H HRM+G P    +YF  W   + +L I+SDI F +G I   +K+GF + + +N+L+Y+ 
Sbjct: 945  HAHRMFGLPIIEETYFCKWDFQIGSLDIDSDIDFAKGLIGAFSKIGFGYKDYENMLIYEI 1004

Query: 1176 SVLDNMTSVTVHGTGIDILVADKSTSAQVLLNMDGITFNRINFANDRYSSRIDLQVPGLH 1235
                +MTS+T+    I   V D +T+  V L++D I+ + I+F N+RYS+++  ++P + 
Sbjct: 1005 IKPIDMTSLTLVTDSISFKVTDGNTNCVVALDLDKISASMIDFENERYSNKMSAKIPNIK 1064

Query: 1236 FAFFDNGSSMDKTCLFEFKTKINFTNFTQMKDGELHSKKQQEFIALNDSAFHRCSFLLLP 1295
                +  S  +   LFE  T ++   F Q +D + H   Q+  I L+DS +HRC+FLL  
Sbjct: 1065 LLVSEKSSKNEVQGLFE--TSLDLAYFGQNRDFDNHRNLQRNHITLHDSPYHRCAFLLPM 1122

Query: 1296 HIQESLLYHELYGGITXXXXXXXXXXXXQAETIAFIIDDFLGPFGIN---STELLGSIST 1352
              Q+++LY++L+G IT               TI  I +  LG    +    ++   S  T
Sbjct: 1123 QYQKTVLYNKLFGAITPGVSIPPLTQPVIPNTIDSIFESLLGKHYQDYECCSDANYSKET 1182

Query: 1353 STPIHXXXXXXXXXXXXVIHPIESMQSHLVPSQSVT----HGNYIIDISYITLDINPLFF 1408
            +                 +  + S  S   PS  +     + ++II++    + INP   
Sbjct: 1183 AITEENSSFIQGSGSTSALKELSSY-SQNCPSYKLEPKFEYDSFIINLGKTIIAINPSSE 1241

Query: 1409 TYASNFLDEFYSENIIETIDGIEMAIVNRLGTKSEELDSVTNIKLQIKYLDFFFGQ---- 1464
                +   +F   +I + ID  E+ IV +      E  +VTN+++    + F FG     
Sbjct: 1242 KCLLSIYLQFCVGSIDDIIDANEIDIVEKFSKYFVEKSAVTNLRVLAPKICFTFGSPKGK 1301

Query: 1465 ---RNTEGLELYVDQIDLEVSQKT-FQKKSTVVLDEIAILSRFLSLRAS-----INEKKV 1515
                + + L + V+   L++ QK  F + ++  L+    ++   SL+AS     IN++++
Sbjct: 1302 FEVSDYDHLYVEVNHPSLDLCQKKIFGQTNSSKLEYTEEVTS--SLKASSINFFINQQQL 1359

Query: 1516 L-EDFDERPPALSLALEGWEGWSSTASSQVNSLNISSTDITVDESQIEWLIDYLNRLVVF 1574
              +   +  P  S+  E  E WS ++ S  NSLN  + D  V+ SQ+EWL DYL  +++ 
Sbjct: 1360 KPKTLLKARPVFSIVFEELEFWSDSSESSKNSLNARAVDFFVNHSQLEWLSDYLRAVILC 1419

Query: 1575 VHELVNSLDSIQKKSNGIQKKLVSDLTLASEYYQISHDPYVITKPAYVMRVSKGHVRQNR 1634
              +L  S    +      QK+L+    LAS  Y I HD  VITKPAY+ R+SK H+R+NR
Sbjct: 1420 ATKLFASFSKSKTLIQARQKELIFRTALASVEYNIIHDSPVITKPAYITRLSKNHIRENR 1479

Query: 1635 SWRIVTRLRHIYTYLPDDWEIHVQEEMRGKDMNDVSDSSDIFLTVFSNWRNWEVSDVARS 1694
            SWRI+TRLRHI  YLP  W    +E ++ ++     D+ D FL +FSNWR+WE SDV + 
Sbjct: 1480 SWRIITRLRHILNYLPKSWYKRTEESLKKEEFKIPDDARDQFLKIFSNWRSWEFSDVQKC 1539

Query: 1695 YIYKKIFLSNDETTSEKKLQTT---VKLNLNSIFFTIYSTGYAIDHNIILT--KAVILLE 1749
            YIYK++FLS     S KK + T    K+NL  I F++ S+ +  +  +++   K+VI  E
Sbjct: 1540 YIYKRVFLSR----SMKKNRITGADFKVNLERISFSLSSSTHEDEDFMVVKNLKSVISNE 1595

Query: 1750 L--------TTETAVSPPIEKSILNMTGSLGSIKGEFSDKFLRLLELIPDFSKEEDIKSL 1801
            L           T  S   EK I++   ++ SI+G+  D  ++L+ +    S   D    
Sbjct: 1596 LIESSLPPSAKNTEDSASTEKMIISC--NIKSIRGDLGDNIVKLVRMYDGLSNLSDTNLK 1653

Query: 1802 TENSSIVSEKSPYFTIHLFLLFENGGLQLTMGDTTLSNNVTDGKISAXXXXXXXXXXXXX 1861
            T  +S+  +  P   I   LL +     + +    L       + S              
Sbjct: 1654 T--TSVKHDVKPKL-IQGVLLVDRTDTNIHLDGKRLILRSFRNRFSTFMERVPSKSETKV 1710

Query: 1862 XGAYYMKKSEMCLKHNKDIIAEFQLHHLGL-ISTGIYTP--ICPVILINLRSADLHFKSL 1918
              A     SE  ++H   ++ E  L    L  S  ++    I  V+L   RS  L   ++
Sbjct: 1711 SLAATCASSEAWVRHGSAVLLESSLKDGALNFSQSLFHEHLITKVVL---RSGGLSVSAM 1767

Query: 1919 ASTEKIVKTIEDIT--------EYSVHLYKHYDLRKYTTKPTKVDQKPEKINFDVRVACN 1970
            ASTE+ +  I  I         E +  + K  +    TTKP    +   ++N  V +   
Sbjct: 1768 ASTEQYIHFIWSIKASVDGIRKELASAIPKKNNTTISTTKP----ETSSRLN-TVTLDAT 1822

Query: 1971 LSKVSAELTLISPFYLRYETKQLDLYFNQNGDGEILLSLWDTDIFVTSHHTKEQYFRFSY 2030
            LS  S  +  ++PF +   T  ++++  ++      +++ D DI + S  +K++Y +FS 
Sbjct: 1823 LSGFSLNIQPLTPFGIHQSTDSIEVHVEKHHQLNADITIRDIDIELLSTRSKQRYLKFSQ 1882

Query: 2031 DDIQ-INCNPMSEXXXXXXXXXXXXXXXXTFSEPRRIFASFLQDERITIESFQELKKLKK 2089
              +  +  N   +                T S+PR    S ++DE + I++F +LK L +
Sbjct: 1883 STVNLVISNTPEQNAMFLNVGVASGISKLTVSDPREFIYSLVEDETLAIKNFAQLKSLAE 1942

Query: 2090 IFFSNAKNVKKLNNDVPKEDTPTKWALELNINYFGILLPIASTFFVLELHMLLGSLTNTT 2149
             F S  +   K      ++ T   W L +N+ Y GI++ + S  +VLEL+ +L SL+N  
Sbjct: 1943 KFPSKNQEKSK-----QRKQTNIIWLLHVNVEYIGIIVLLGSAGYVLELNNVLTSLSNNI 1997

Query: 2150 EE---IQEVNNQISGQISLENILFLINDRSLPLRLSKLVDFSIRISTLQKTTSSYESLQI 2206
                 +++  + I G  S+EN+L LI+   L   LSKLVD ++ +   Q+     +++QI
Sbjct: 1998 SARKYLEQGLHGIVGDFSIENVLLLIHANRLKGELSKLVDLAVNLKVSQEEGDDLQNIQI 2057

Query: 2207 ESSHFRMCFSPESLVFVLWGVKQLQNELEYYKDHKTKRQWNLXXXXXXXXXXXXXXPLNY 2266
            ESSHFR+   P SL  VLW + +     E YK   +  Q                   N 
Sbjct: 2058 ESSHFRVALCPMSLTKVLWAINEFTRVSEAYKTRSSLLQHKKTAPTDISELS------NK 2111

Query: 2267 FRSIHILSYNFCIGWMLPENQKDIPGWMFGYDRLFSAYEKNYGKLTLIEGYMSVTNSNSS 2326
            FRSI ILSYNFCIGW+     +  PG ++GY+RLF+AY+K YGKLTL++ Y S+ +  SS
Sbjct: 2112 FRSIQILSYNFCIGWIFDAGSETDPGLIWGYERLFAAYQKPYGKLTLLDAYFSIAHGASS 2171

Query: 2327 NDFFSQGEEKNRHNRSFLPSMQILYWLKEFNSKKDLFIRLHGDALDVDILSNFVNIIELI 2386
            + FFS G+EK++ NRS+LPSMQI YW  +     +LF+R+ G+ LDV+ LS+ + I    
Sbjct: 2172 DTFFSNGKEKDQFNRSYLPSMQIGYWFVKEGDTSNLFVRITGERLDVNFLSSSIGIANGA 2231

Query: 2387 FKSYQIFEDFRKSKIVQNIEKQKHHEHIKSENATEFVPTFLSDINSINCEFKYEGGTLRV 2446
             KS Q F++ +K+ +      +   + + SE A   +   LS I + NC  KY GG  ++
Sbjct: 2232 VKSIQTFQELKKTMVDPFATNKTTEKPVNSEAAP--LDPILSKIRAFNCIVKYAGGVFKL 2289

Query: 2447 FSVDDVEIDSTPSLELNAPKVSIYLNYKHFDDSPKPHWLRCVIDIHSSHNILYSKCAPFV 2506
            FS +D++ +S PS E+ +P V + ++YKH  D  K HW+R ++ +  S+N L+  C P +
Sbjct: 2290 FSEEDIQNNSKPSFEVESPSVEVAIDYKHLPDVIKSHWIRGLVTVDPSNNTLFPTCVPIL 2349

Query: 2507 IEFVESIQEILENRPVEPKQSV-SKIATPNRTYKRILAPFDIAFRIKAAKQMLSFSCEPS 2565
                + ++ +L++   +PK    S I++    YK++L  FDIAF +   KQ +S SCEP 
Sbjct: 2350 SGMTKDVRNMLKSFNSKPKPDRNSTISSSGMNYKKLLRAFDIAFLVNIGKQGISLSCEPK 2409

Query: 2566 AKVQANVGLDSFLFGISTGGSSVEDPLSLTLCINKISTSVQHIFSKEASASFSLNFIDLT 2625
            AKVQA+VG +     + T      +PLSL++ I  +  + +HIFS+E S SF ++ ID  
Sbjct: 2410 AKVQADVGFEKLAVKMFTNNLDNSEPLSLSIDIEHLRATSRHIFSREVSTSFQIDHIDAV 2469

Query: 2626 FIFTQPTL---YCVGLISDIDIFFNMKQQQNLLLFLDIWHLSESIGIRPNXXXXXXXXXX 2682
            F+ T P +   Y   L+SD+ I+FNMKQ Q+L LFLDIW     I   P           
Sbjct: 2470 FVLTHPEIIQTYGTTLVSDVQIYFNMKQLQDLNLFLDIWKPDSQILEMPKGGNTRTRSLS 2529

Query: 2683 GHTQIP----ETPQPGKIIPWNFNIIFTNVNADIHLGPALGIVSAKLEKTWFISDRYLDK 2738
             H ++P    + P      PWN+ +IF+N+  DI LGP+LG++S +  ++W ISD ++D 
Sbjct: 2530 SHDKLPVSKFQKPAGTNAFPWNYTLIFSNIKGDIDLGPSLGVLSVRNNRSWAISDHFVDW 2589

Query: 2739 RQILQLFTDGMVLKSRGRLSGMLDISNAGWRLEVNYADNELNYNSPIVAIGIDIGCVALK 2798
            RQ L +F + ++L S GRL G L I    W  E+++      Y +P++++ +++G +ALK
Sbjct: 2590 RQRLSVFLENILLSSDGRLGGFLGIERVCWSSEISWPVKGGFYETPLISLSLELGSLALK 2649

Query: 2799 TAFDYHMFMISKVNNIHFRLHSERDPEGKLPDXXXXXXXCEEISICSTTLVASNILDIYN 2858
            T+FDYHMF+I+ V ++  +L++ERD  G L D       C +I +  T L ++N +DIYN
Sbjct: 2650 TSFDYHMFLIANVEHLLLKLYNERDEMGILKDLLAVSVTCGKIHLFLTALASANAIDIYN 2709

Query: 2859 TIIRTRQDTKNSYFETLMESNNQDTRTNIPYSDILKSLNLLRTDVQIDVSKLQLQISPIS 2918
            TIIR RQD KNSY ETL +SN Q T++     ++L+SL+LLRTD+ + +    LQ+ P +
Sbjct: 2710 TIIRMRQDNKNSYIETLKDSNTQSTKSKRQNQNVLESLSLLRTDLSVGIDLFYLQVFPST 2769

Query: 2919 LFDFEVLVINIDNMSARSETTSTDKLKTRLELQVCNASVALSTAKEELDEESVNKISVAD 2978
            LFD EVLV+  ++MSA ++T    K+KTRL  Q+ N  V+LS  K + +EE V++I V +
Sbjct: 2770 LFDMEVLVLKAEDMSAHTQTQGDHKVKTRLNWQLHNFKVSLSAFKNQFNEEIVSQIEVKE 2829

Query: 2979 YMTYASKIKGGTILIIPKLLVGMTTWQKVTSNTIEYTFTCKFDGKVSVRWNLGPVNFIKE 3038
            Y+ +A+K++GGTIL  P +LV MTTWQ+V+SN IE  +T  F GKV V+WNLGP+NFI+E
Sbjct: 2830 YIKHATKVRGGTILAAPAILVDMTTWQEVSSNVIELLYTSSFGGKVDVKWNLGPINFIRE 2889

Query: 3039 MWATHVKSLAVRQARXXXXXXXXXXXXXXXXXXXXXXPAQPKFTYVALVEPSIEMPQIKD 3098
            MWATHV++LA+R+                            K+ Y+ L EP IEMPQIKD
Sbjct: 2890 MWATHVRALALRRVHDMRDKNKSFFEDEHIEEKIKDVDLGNKYVYIPLEEPRIEMPQIKD 2949

Query: 3099 LEDATPPMEWFGLNRKKFPSFTHQTAVIVVQKLVHAVEKEYAKIIGH 3145
            L DATPP+EWFG+NR++FP  THQ+ V+ +QKL H  E+EYA+++G+
Sbjct: 2950 LGDATPPVEWFGVNRQRFPGLTHQSVVVPLQKLAHMAEEEYARVLGN 2996

 Score =  136 bits (342), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 72/198 (36%), Positives = 118/198 (59%), Gaps = 19/198 (9%)

Query: 298 LNFYPFGLKLTKGSIIFGNKFTPSLLIISYKSAEGIVDVLPATNPRVDLYKMKMKLDFQN 357
           L F P  LK+ +G+++ GN  TPS++II Y+SAEG+VDV   +N ++DLYK++  LDF N
Sbjct: 217 LQFLPIHLKVNRGAVLLGNTTTPSVMIIGYESAEGVVDVC-QSNEKLDLYKIRYDLDFNN 275

Query: 358 FEIEVKPNISYEDDSKPKAFYCDSMLSRLWTKFSTLFDIMPNPLSRYIHFSRLHKNSLFL 417
            ++++KPNIS+ D++  K++   S +SR+W KF  +F        R  H+     N   +
Sbjct: 276 VDLKIKPNISFGDENPIKSYIVHSRMSRVWKKFKKIF------FERMSHYLAHSDNQKIM 329

Query: 418 EDNIFEDEDFEKKWKGLSLYKDAALNRGN---------PEEHIEFDFLNHEYARYCSIVK 468
                + + F +KW+GL+LY +  +   +          +E++  D  NHEYA+Y  I+K
Sbjct: 330 ---FVKHQQFFEKWRGLALYSEYNVTTSDHSVGDEEEEEDENMMSDVGNHEYAKYTQILK 386

Query: 469 APRLIFTNEYDIPGIVPY 486
           + ++  T  YDIPG+VP+
Sbjct: 387 STKVAVTYAYDIPGMVPH 404

 Score =  116 bits (290), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 67/172 (38%), Positives = 103/172 (59%), Gaps = 6/172 (3%)

Query: 6   KFVSVSLSREKYFSWVFLVTWILTCILCLLMFFYIDRVFAYSLTFILDWLLWRPYKVKIH 65
           +F ++ +S+E  FSWVFLV W+L  +L L + FY  R  AY +T ++ W+LWR YKVKI+
Sbjct: 6   QFKAIPISKENNFSWVFLVDWVLVVVLSLSVVFYFGRALAYCITILMKWVLWRRYKVKIN 65

Query: 66  CEXXXXXXXXXXXXFKNLCIITENSTISILEGKIIWQYWLLNTRVSAYELHQQQKEHGYI 125
            +            FKNL +IT++ TIS L+G   W+YWLLN+R +  E  ++  E    
Sbjct: 66  IQSLKISFLGGRVFFKNLTVITKDQTISFLQGSFTWRYWLLNSRKTLLEELEKSGEE--- 122

Query: 126 TPGSGFKNIQLPCKFLFQCEGAEIFVYNKTSAYENIIDSFSPDEKIKYKEFL 177
                 K+  L C+F  + +G E+F+YN+T AY+ I+ S + D+K  +K+F 
Sbjct: 123 ---KDQKSRMLQCRFFLESDGFELFIYNRTVAYDGILRSVAKDDKESFKKFF 171

>KLTH0G13728g Chr7 (1175228..1184128) [8901 bp, 2966 aa] {ON} similar
            to uniprot|Q12150 Saccharomyces cerevisiae YLR087C CSF1
            Protein required for fermentation at low temperature
          Length = 2966

 Score = 1415 bits (3664), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 860/2611 (32%), Positives = 1358/2611 (52%), Gaps = 107/2611 (4%)

Query: 590  NISAPPESNMEFQLFDASINYGPWAHRNIMNIQRIFSPIVSRTPELQPDPEPGFLRRYTM 649
            N   PP+ +++ Q+  AS+ YGPW+H  IM +Q++FSP+VSR  +      PG  R YT 
Sbjct: 409  NSGPPPDYSIDIQISGASLYYGPWSHHEIMPLQKLFSPVVSRDSQPVEQLTPGSKRIYTR 468

Query: 650  TKISVSIMEDSSWRVPTREPSKDQDFLKRYMKTNDSSRSFGWFDLNFSRNSEATFCISSI 709
             ++S+ I+ +S WR+PTRE SKD +FLKR+ +T D +R FGW +++ S  SE  F I+  
Sbjct: 469  LRLSILIVGESVWRIPTREASKDLEFLKRFRETEDETRPFGWLEVSLSEGSEVRFNIAMC 528

Query: 710  PDVNGYANKLNLDFKDLEVRSSVNHDIFFRSKSYRVDSDIGYPLGWNDEVTWSFVFDSYQ 769
            P   G+ N L+L F   E+R+SVNHDI   ++++ + + +GYPLGWN +  W F   S Q
Sbjct: 529  PTATGFDNTLDLHFVKPEIRTSVNHDILLSAQTHSMHATMGYPLGWNKKAEWVFDSVSNQ 588

Query: 770  LETFFLREHLVLIADTFSDFSSGEPTPYEFFRPSIYKVDWNFHGYSAYLNVNDHNIINNP 829
             + F L++H+ L+ D  SDF SGEPTPYE FRP  Y  +WNF GYS YLNVND NI+NNP
Sbjct: 589  CQIFILKDHITLLGDIISDFGSGEPTPYELFRPFSYTFNWNFTGYSIYLNVNDANIVNNP 648

Query: 830  LDFNENCYISVHGDDAHIGVEIPRLGITATYTDIIFQISTPMFRXXXXXXXXXXXXEFMR 889
            ++FNENCY+S HGDD  +  E+P+  I    T I +++ TP+FR            EFM+
Sbjct: 649  VNFNENCYLSFHGDDLRLNFEVPQENIAGNSTKINYELFTPLFRLNMNTPSWNTLHEFMK 708

Query: 890  NKEIGRGYDFTAEGSYIIYSDLDIDNVDSLTIECSTRRMTLLTYGFVIGYLLNVQMNYFG 949
            +KE+GR  +F+  GSY+ +S LD+DN+D++ IEC ++  TL  YG+V+ Y L V+MNYFG
Sbjct: 709  DKEVGRSANFSLSGSYLFHSKLDVDNIDTIIIECCSKSTTLKCYGYVLRYFLGVKMNYFG 768

Query: 950  EFSHFITAEEYTDIVRGNDNDIVSTLADFXXXXXXXXXXXXXXXQHNPDNSSK-SNIIDP 1008
            +F HF T EEY + +RG  N +  T  D                Q + D+S +  +I DP
Sbjct: 769  DFVHFKTTEEYMEELRGT-NAVTKTTHD------SETEIQEAPKQMDEDSSQREQHIKDP 821

Query: 1009 LYNPPLRKDDIKRKVNETDIWFTFSVWEGALLLPEVLYNSDPCIALSFKELIIDFRNCDY 1068
            L     +K  +KR VNE D+WFTF V +G  +LPE LY+ D C AL F  L ID R+ +Y
Sbjct: 822  L---TAKKTSLKRMVNEKDVWFTFVVEDGCFILPENLYDCDSCYALEFDSLDIDLRHINY 878

Query: 1069 YLDLLATLNGTSFKRCIRKNQNDIFELVHNNAIKNLEEHGSVSNISIHGHRMYGAPPTSP 1128
            Y+D+ A L+    +R I     ++FE     A+      G +S + IH HRM+G PP   
Sbjct: 879  YMDMQAALSPLRIRRLIDCGCEEVFE-QKGRALCGELVAGRLSRLHIHTHRMFGLPPAEE 937

Query: 1129 SYFSDWAVDVNNLSINSDIYFIRGFISYITKVGFEFSNLQNILLYDESVLDNMTSVTVHG 1188
            +YF  W   +  L ++SD+ F  GFI+   K+GF F + +NI+ Y  + + +MTSVT+  
Sbjct: 938  TYFCKWDFSLGTLDLSSDLPFTLGFINAWKKLGFGFRDYENIMNYKVAPILDMTSVTLAI 997

Query: 1189 TGIDILVADKSTSAQVLLNMDGITFNRINFANDRYSSRIDLQVPGLHFAFFDNGSSMDKT 1248
              I            + LN   I+    +  N  YSSR+DL V  L  +  D   S    
Sbjct: 998  DAIVFCTDKIKDETAIQLNAQDISAKFADLENSLYSSRVDLDVANLTASIIDKNKS--NK 1055

Query: 1249 CLFEFKTKINFTNFTQMKDGELHSKKQQEFIALNDSAFHRCSFLLLPHIQESLLYHELYG 1308
             +  F T I  +NF Q++D   HS++Q+  IA ND+ FHRC FL+   +Q S  Y  L+G
Sbjct: 1056 AIASFMTSIKISNFCQLQDLLAHSQQQKVHIASNDAPFHRCPFLIPLTLQNSSDYKGLFG 1115

Query: 1309 GITXXXXXXXXXXXXQAETIAFIIDDFLGPFGINSTELLGSISTSTPIHXXXXXXXXXXX 1368
             I             Q E +  +   +L      S + +        +            
Sbjct: 1116 CIPPGVSIPSLAVPLQTENVKAVFQGYLKAENA-SKDFVDRWFPVNEVKNKNSSSLKDFK 1174

Query: 1369 XVIHPIESMQSHLVPSQS---VTHGNYIIDISYITLDINPLFFTYASNFLDEFYSENIIE 1425
              + PI    + L  S S     H   ++++    L I+P  +    N +++ + + I +
Sbjct: 1175 GQLQPILDDNTSLSSSFSDPTFEHNTLVVNLENSRLSISPECYEVIGNAVEQCHKKLIEQ 1234

Query: 1426 TIDGIEMAIVNRLGTKSEELDSVTNIKLQIKYLDFFFGQRNTEG-------LELYVDQID 1478
             ID IE+ +V      +    +  NI++ +  LD  F   N E        +++  +Q+ 
Sbjct: 1235 FIDNIELDVVLHFIKMASRQKNYKNIRVLMPTLDVLFETYNKENTYDVEGQVKVTANQVS 1294

Query: 1479 LEVSQKTFQK--------KSTVVLDEIAILSRFLSLRASINEKKVLEDFDERPPALSLAL 1530
            L+ S K   K        + T  L +I  L   L +   +++K    + DE   A   ++
Sbjct: 1295 LDWSLKKGLKLPGSDNDPEDTTSLLKIESLD--LEVFNKLDKKTKFAEMDENI-AFGCSV 1351

Query: 1531 EGWEGWSSTASSQVNSLNISSTDITVDESQIEWLIDYLNRLVVFVHELVNSLDSIQKKSN 1590
            +  E WS       +SL + S + +V   +  WLID++ +      +L+N L     +  
Sbjct: 1352 KELEAWSYLNGIADSSLYLKSINASVALDKFNWLIDFMRKAFNDSKQLINRLSYCTGQFR 1411

Query: 1591 GIQKKLVSDLTLASEYYQISHDPYVITKPAYVMRVSKGHVRQNRSWRIVTRLRHIYTYLP 1650
              +++    ++ AS+ YQI+HDP VITKPAY+ R+   HVR++RSW+IVTRLRHI  YLP
Sbjct: 1412 KAEQEFFYRISKASDEYQITHDPPVITKPAYITRLPSQHVRESRSWKIVTRLRHILNYLP 1471

Query: 1651 DDWEIHVQEEMRGKDMNDVSDSSDIFLTVFSNWRNWEVSDVARSYIYKKIFLSN-DETTS 1709
                  +  +++  +    S + + FL +FSNW NW+ SDV + Y+Y+++F +  D+T +
Sbjct: 1472 TTLISDIFNDLKNSEYPPRSTAEETFLEIFSNWGNWDYSDVEKCYMYRRVFTNTLDDTVA 1531

Query: 1710 EKKLQTTVKLNLNSIFFTIYSTGYAIDHNIILTKAVILLELTTETAVSPPIEKSILNMTG 1769
                +++ K+   +     + +      ++IL    +  + T E       EK   NM+ 
Sbjct: 1532 H---ESSTKIETGTFMLNFFDSINTGSDSVILKN--LKAQRTLEACKDEAAEKRS-NMSN 1585

Query: 1770 SLGSIKGEFS------------DKFLRLLELIPDFSKEEDIKSLTENSSIVSEKSPYFTI 1817
            +   ++   S               ++LL +   F+ E +  ++ EN     EK P F  
Sbjct: 1586 AEDDLEERLSCIINKAQISLSDGTLIKLLSVRELFTFEAEHAAVKEN-----EKLPAFQQ 1640

Query: 1818 HLFLLFENGGLQLTMGDTTLSNNVTDGKISAXXXXXXXXXXXXXXGAYYMKKSEMCLKHN 1877
            +  L+ +   +QL  G    +N  + G                   A+     E  ++H 
Sbjct: 1641 YTALV-DRCDIQLLCG-ANRANLKSFGNTLTIVRENKSEDADAFSTAFAWSWFEFGIRHR 1698

Query: 1878 KDIIAEFQLHHLGLISTGIYTPICPVILINLRSADLHFKSLASTEKIVKTIEDITEYSVH 1937
              I+ +        +    ++       ++LR+     K L S  K   T  D  E S +
Sbjct: 1699 NTILLD-AFSRSSAVGAHGFSGKNSRRKLDLRAKKFRLK-LPSESKHYCTFIDSLEESWN 1756

Query: 1938 LYKHYDLRKYTTKPTKVDQKP-----EKINFDVRVACNLSKVSAELTLISPFYLRYETKQ 1992
                 +LR      T   +KP     EK+     +  ++S ++ +++L+S   +    K+
Sbjct: 1757 -----NLRLALGPNTGFLEKPHSAATEKVAPQFALNIDISDLTTDISLLSSLAITKNFKK 1811

Query: 1993 LDLYFNQNGDGEILLSLWDTDIFVTSHHTKEQYFRFSYDDIQINCN-PMSEXXXXXXXXX 2051
            L L + Q+    + L+    DI V S  T +QY + S  +I  + + P            
Sbjct: 1812 LTLAYEQSASSALKLAFETLDIDVFSTRTTQQYLKISQSNISFSLHRPKKNNASPPTVKL 1871

Query: 2052 XXXXXXXTFSEPRRIFASFLQDERITIESFQELKKLKKIFFS-NAKNVKK-LNNDVPKED 2109
                      +PR I     +D     ++   L  LK  F   N KN K  ++    K +
Sbjct: 1872 DSNITKLKLYDPRDITLPLGKD---IAQAKACLASLKSCFGKLNTKNDKDIMSQGNTKFN 1928

Query: 2110 TPTKWALELNINYFGILLPIASTFFVLELHMLLGSLTN---TTEEIQEVNNQISGQISLE 2166
                W  ++ +NY G+L+P+ ST ++ EL+ +   +T    T +  +     + G +S  
Sbjct: 1929 FSASWIFQVRLNYVGLLIPLGSTSYITELNEISAFITADEFTNKASENSQGALRGDLSAA 1988

Query: 2167 NILFLINDRSLPLRLSKLVDFSIRISTLQKTTSSYESLQIESSHFRMCFSPESLVFVLWG 2226
            +I FLINDR LP  LS++VDF++ I   +++     SLQIES +FR+  SP SLV +L+ 
Sbjct: 1989 SIAFLINDRMLPEALSRVVDFAVSIKIAKESEEVIRSLQIESPYFRIALSPFSLVRILFL 2048

Query: 2227 VKQLQNELEYYKDHKTKRQWNLXXXXXXXXXXXXXXPLNYFRSIHILSYNFCIGWMLPEN 2286
            V +L    E       KRQ  +                  FRS+ +LSYNFC+GW+   N
Sbjct: 2049 VNELSRLSEL-----QKRQ-TVGKLPESVEVRETFRFRRAFRSVQVLSYNFCLGWIFDVN 2102

Query: 2287 QKDIPGWMFGYDRLFSAYEKNYGKLTLIEGYMSVTNSNSSNDFFSQGEEKNRHNRSFLPS 2346
                PG ++GY RLF+A+EK YGKLTL++ Y S+   ++S+DF++        NRSFLPS
Sbjct: 2103 DSPEPGLIWGYQRLFAAHEKPYGKLTLLDAYFSIAEGSTSDDFYAHKNSFENPNRSFLPS 2162

Query: 2347 MQILYWLKEFNSKKDLFIRLHGDALDVDILSNFVNIIELIFKSYQIFEDFRKSKIVQNIE 2406
            MQI YW++      +LFIR++G+ LDV  LS  +++   + KS  +F++ +K    Q ++
Sbjct: 2163 MQIRYWIESKGLTDELFIRINGERLDVRFLSKSIDVAGGLMKSLNMFDELKK----QYVD 2218

Query: 2407 KQKHHEHIKSENATEFVPTF--LSDINSINCEFKYEGGTLRVFSVDDVEIDSTPSLELNA 2464
              K   + K  +AT     F  LS I  ++C+ +Y GG  R++S+DDV+ ++ PS +L +
Sbjct: 2219 PFKSVANPKRPSATSTFSKFPGLSTIQRVDCKVQYAGGVFRLYSLDDVQNEAGPSFQLES 2278

Query: 2465 PKVSIYLNYKHFDDSPKPHWLRCVIDIHSSHNILYSKCAPFVIEFVESIQEILENRPVEP 2524
            P V I  +Y+        H LR  + ++SSHN ++  C P + E    I+++L+     P
Sbjct: 2279 PSVEILFDYRRMVHGKHSHILRAWMIVYSSHNTIFPTCVPVLNEMARDIRQLLKGFNRSP 2338

Query: 2525 KQSVSK-IATPNRTYKRILAPFDIAFRIKAAKQMLSFSCEPSAKVQANVGLDSFLFGIST 2583
            +++  K ++  +  Y+  L   DI+F I   KQ +SFSCEP AKVQA++G +     + T
Sbjct: 2339 QEASHKSVSQESLDYRSFLRGTDISFLIDIGKQQISFSCEPKAKVQADLGFEKLAVKVFT 2398

Query: 2584 GGSSVEDPLSLTLCINKISTSVQHIFSKEASASFSLNFIDLTFIFTQP-TLYCVGL--IS 2640
                + +PLSL++ I +I+   +HIFS+E S S  ++ +   FI T P T++  G+  I 
Sbjct: 2399 NDLDMSEPLSLSIDIYEITAKSRHIFSREVSTSIKIDQLSWIFILTHPDTIHTYGIMHIP 2458

Query: 2641 DIDIFFNMKQQQNLLLFLDIWHLSESIGIRPNXXXXXXXXXXGHTQIPETPQPGKI---- 2696
            +ID++FN+KQ Q+L +F++IW     +  +P              + P   +  K+    
Sbjct: 2459 NIDVYFNIKQLQDLNIFVNIWKPDSYVFTQPELDSEHSRALTSEEK-PLVAKFKKVSSTT 2517

Query: 2697 -IPWNFNIIFTNVNADIHLGPALGIVSAKLEKTWFISDRYLDKRQILQLFTDGMVLKSRG 2755
              PWNF +I + +  DI LG +LG++S   ++ W I+D Y D  Q L L  + ++L S G
Sbjct: 2518 SFPWNFILIISKIKGDIDLGISLGVLSLTTDRIWAITDHYSDWTQKLSLQMEKILLSSDG 2577

Query: 2756 RLSGMLDISNAGWRLEVNYADNELNYNSPIVAIGIDIGCVALKTAFDYHMFMISKVNNIH 2815
            RL G L + N  W   + +   E  + SP+V + + +    LK +FDYH+ +I+ V  + 
Sbjct: 2578 RLGGTLLLRNFSWMSRIRWPVREGVFESPLVTLDVLLDEFDLKLSFDYHLILIASVEVLK 2637

Query: 2816 FRLHSERDPEGKLPDXXXXXXXCEEISICSTTLVASNILDIYNTIIRTRQDTKNSYFETL 2875
             +L ++RDP G   +            +  T L  +NILD+YNTI+R R+D + SYFETL
Sbjct: 2638 LKLFNKRDPRGISRNLLSVAISSNSTQLFLTALAPANILDVYNTILRMRKDNRKSYFETL 2697

Query: 2876 MESNNQDTRTNIPYSDILKSLNLLRTDVQIDVSKLQLQISPISLFDFEVLVINIDNMSAR 2935
             +SN +DTR+     DIL SL+ LRT++++ +  + +QI P  LFD EVL     +   +
Sbjct: 2698 GDSNTKDTRSASTSKDILNSLSFLRTELEVSLKFVHIQIYPSKLFDMEVLTFKAKDFLTQ 2757

Query: 2936 SETTSTDKLKTRLELQVCNASVALSTAKEELDEESVNKISVADYMTYASKIKGGTILIIP 2995
            S+    +KLKT L+ Q+    +ALS  K +L E++ ++I V +Y+ +A K  GGTIL+IP
Sbjct: 2758 SQIEGDEKLKTHLKWQIHGVKIALSRFKNQLHEKAASQIGVKEYIEHARKADGGTILVIP 2817

Query: 2996 KLLVGMTTWQKVTSNTIEYTFTCKFDGKVSVRWNLGPVNFIKEMWATHVKSLAVRQARXX 3055
             +L+GMTTW  V +NT+E  ++  F GK+ +RWNLG +NF++EMWATHV+++A+R  R  
Sbjct: 2818 AILIGMTTWHDVATNTVELLYSNSFGGKIGIRWNLGSINFLREMWATHVRAMALR--RSH 2875

Query: 3056 XXXXXXXXXXXXXXXXXXXXPAQPKFTYVALVEPSIEMPQIKDLEDATPPMEWFGLNRKK 3115
                                    ++ YV L EP IE+PQ KDL +ATPP+EWFG+NRK+
Sbjct: 2876 NGQPRGFFEDEHLEEKLRDVDLGDEYEYVPLEEPHIEIPQTKDLGEATPPVEWFGVNRKQ 2935

Query: 3116 FPSFTHQTAVIVVQKLVHAVEKEYAKIIGHS 3146
            FP  THQ  ++ +QKL H  E E+A+I+G +
Sbjct: 2936 FPGLTHQAMIVPLQKLAHIAETEWARILGRA 2966

 Score =  149 bits (376), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 73/187 (39%), Positives = 113/187 (60%), Gaps = 11/187 (5%)

Query: 6   KFVSVSLSREKYFSWVFLVTWILTCILCLLMFFYIDRVFAYSLTFILDWLLWRPYKVKIH 65
           +F  VSLS  + FSWVFLV W+L   + LL  FY  RVF Y+LTF+L+WL W+ YKVKI 
Sbjct: 4   QFKRVSLSTNEDFSWVFLVDWVLILSVSLLGAFYFGRVFGYTLTFLLEWLAWKRYKVKIS 63

Query: 66  CEXXXXXXXXXXXXFKNLCIITENSTISILEGKIIWQYWLLNTRVSAYELHQQQKEHGYI 125
            +            FKNL ++T+N T S L+G I W+YWLLN+R +A+    +  +    
Sbjct: 64  IQSLKISFLGGRIFFKNLTVVTQNQTFSFLQGSITWRYWLLNSRKTAFAKASENID---- 119

Query: 126 TPGSGFKNIQ-LPCKFLFQCEGAEIFVYNKTSAYENIIDSFSPDEKIKYKEFLHKHFRFS 184
                 K+++ LPC+F  +C+G E F+YNKT A++NI++S   ++  ++K+F   +   +
Sbjct: 120 ------KSVEKLPCRFRVECQGLEHFIYNKTQAFDNILNSLPREDLERFKDFFQDNSDKN 173

Query: 185 KDDTPIE 191
            D+  ++
Sbjct: 174 TDECSVD 180

 Score =  109 bits (272), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 65/195 (33%), Positives = 108/195 (55%), Gaps = 26/195 (13%)

Query: 298 LNFYPFGLKLTKGSIIFGNKFTPSLLIISYKSAEGIVD-VLPATNPRVDLYKMKMKLDFQ 356
           L   P    + KG+++ GNK + S++++SY+  +G++D  LP  + ++DLYK+K++ +F+
Sbjct: 219 LKLLPLEYSVQKGAVVIGNKTSSSVMVLSYEKLDGVLDTCLP--DSKIDLYKIKVRNEFR 276

Query: 357 NFEIEVKPNISYEDDSKPKAFYCDSMLSRLWTKFSTLFDIMPNPLSRYIHFSRLH--KNS 414
            F I +KPN+S E ++  K+F   S LS+LW +   LF    +P S+    S     +N 
Sbjct: 277 KFHISLKPNLSLESENPLKSFVKRSKLSKLWHRSYQLFFKTDSPSSKNPANSAKDGTRNP 336

Query: 415 LFLEDNIFEDEDFEKKWKGLSLY---KDAALNRGNPEEHIEFDFLNHEYARYCSIVKAPR 471
           L             K+W+GL LY   +DAA      ++  +FD   HEYARY  ++K   
Sbjct: 337 L-------------KRWRGLGLYWKEEDAAW-----DDRFQFDLSKHEYARYTKVMKCDN 378

Query: 472 LIFTNEYDIPGIVPY 486
           ++    +D PGIVP+
Sbjct: 379 MLLEYAFDAPGIVPH 393

>Kwal_YGOB_56.23808 s56 (712095..712280,712384..721023) [8826 bp, 2941
            aa] {ON} ANNOTATED BY YGOB -
          Length = 2941

 Score = 1387 bits (3590), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 845/2616 (32%), Positives = 1372/2616 (52%), Gaps = 129/2616 (4%)

Query: 590  NISAPPESNMEFQLFDASINYGPWAHRNIMNIQRIFSPIVSRTPELQPDPEPGFLRRYTM 649
            N  APP+ +++ Q+F A+I+YGPWAH  IM IQ++FSP+VSR          G  R +T 
Sbjct: 396  NGGAPPDFSLDIQVFGANIHYGPWAHHEIMPIQKVFSPVVSRDSHPTERLSAGSTRVFTR 455

Query: 650  TKISVSIMEDSSWRVPTREPSKDQDFLKRYMKTNDSSRSFGWFDLNFSRNSEATFCISSI 709
             +IS+ IM DS WR+PTREPSKD DFLKRY +T D +R FGW +L+ +  SE    I+  
Sbjct: 456  LRISIMIMSDSIWRIPTREPSKDLDFLKRYKETEDDTRPFGWLELSLAEGSEVRLNIAMC 515

Query: 710  PDVNGYANKLNLDFKDLEVRSSVNHDIFFRSKSYRVDSDIGYPLGWNDEVTWSFVFDSYQ 769
            P   G+ NKL+L F   E+R+SVNHDI   ++++ +++ IGYPLGWN +  W+F   S+Q
Sbjct: 516  PTSTGFDNKLDLHFIKPEIRTSVNHDILLSAETHDIEAQIGYPLGWNAKAKWNFDLKSHQ 575

Query: 770  LETFFLREHLVLIADTFSDFSSGEPTPYEFFRPSIYKVDWNFHGYSAYLNVNDHNIINNP 829
               F L++H+ L+ D  SDF +G+PTPY+ FRP IY+ +W   GYS YLNVND NI+NNP
Sbjct: 576  ARMFILKDHITLLGDILSDFGTGDPTPYDLFRPFIYEFNWELTGYSMYLNVNDANIVNNP 635

Query: 830  LDFNENCYISVHGDDAHIGVEIPRLGITATYTDIIFQISTPMFRXXXXXXXXXXXXEFMR 889
            +DFNENCY+S HGDD  I   +P+  I    T I + + TP+FR            EFM+
Sbjct: 636  VDFNENCYLSFHGDDLRISFRVPQDSIAGNSTTIDYNLYTPLFRLNMNTPSWNTLHEFMK 695

Query: 890  NKEIGRGYDFTAEGSYIIYSDLDIDNVDSLTIECSTRRMTLLTYGFVIGYLLNVQMNYFG 949
            +KE+GR  DF+  GSY+ +S LD++N+D++ IEC +R  TL  YG+V+ +L+ V+MNYFG
Sbjct: 696  DKEVGRACDFSLAGSYLFHSKLDVENIDTIIIECKSRMTTLKCYGYVVRFLVGVKMNYFG 755

Query: 950  EFSHFITAEEYTDIVRGNDNDIVSTLADFXXXXXXXXXXXXXXXQHNPDNSSKSNIIDPL 1009
            +F HF T EEY + +R   +  V   A+                + +  N+ K++  DP+
Sbjct: 756  DFVHFKTTEEYMEELR---DAYVEPKANSEQSANSTETTTAGEGE-DKQNAPKNHTTDPV 811

Query: 1010 YNPPLRKDDIKRKVNETDIWFTFSVWEGALLLPEVLYNSDPCIALSFKELIIDFRNCDYY 1069
                 +K  +KR VNE D+WFTF V +G L+LP+ LY+ + C A  F  L ID R  +YY
Sbjct: 812  M---AKKLSLKRMVNEKDVWFTFIVEDGCLILPKNLYDCNACFAFEFDSLDIDLRYINYY 868

Query: 1070 LDLLATLNGTSFKRCIRKNQNDIFELVHNNAIKNLEEHGSVSNISIHGHRMYGAPPTSPS 1129
            +DL A L+    +     +   +F         +    GS+S++ IH HRM+G PP   +
Sbjct: 869  MDLQAALSPVIVRNLSDCDPAHLFSGSEGRC-PSRANFGSISDLHIHAHRMFGLPPDEET 927

Query: 1130 YFSDWAVDVNNLSINSDIYFIRGFISYITKVGFEFSNLQNILLYDESVLDNMTSVTVHGT 1189
            YF  W   +  L I+SD+  I  F    +K+ F F + +NI+ Y    + +MTS+  H  
Sbjct: 928  YFCKWDFSMGVLDISSDLSCILSFGDAWSKLAFSFKDYENIMNYKIVPILDMTSIIFHAG 987

Query: 1190 GIDILVADKSTSAQVLLNMDGITFNRINFANDRYSSRIDLQVPGLHFAFFDNGSSMDKTC 1249
             I + + D +    +++ ++ +T   ++F N+RYSSR D+ +  +     + G   D + 
Sbjct: 988  EIRVKINDVAVDYYIIVEVENVTARGVDFENERYSSRADVDIHSITVQVKEGGK--DGSL 1045

Query: 1250 LFEFKTKINFTNFTQMKDGELHSKKQQEFIALNDSAFHRCSFLLLPHIQESLLYHELYGG 1309
            + +F + +  T F Q+K+  +HS +Q+  IA ND+ FHRCSFLL   IQ S  Y +L G 
Sbjct: 1046 IGDFSSSLKITKFCQLKNFLVHSMQQKSHIATNDAPFHRCSFLLPLAIQRSDNYRKLLGS 1105

Query: 1310 ITXXXXXXXXXXXXQAETIAFIIDDFLGPFGINSTELLGSISTSTPIHXXXXXXXXXXXX 1369
            I               E +  I+D+FL   G  ++  +G        +            
Sbjct: 1106 IVPGVSIPGMVEPITPENVTMILDEFLK--GEKNSLQMG--------NEHFCSKKEEDGY 1155

Query: 1370 VIHPIESMQSHLVPSQSVTHGNYIIDISYITLDINPLFFTYASNFLDEFYSENIIETIDG 1429
              +    + S      +V   + ++ +      I+        +F D+ YS  + + ID 
Sbjct: 1156 AFNFASGLMSSTENDSNVESESLVVKLIKPQASISACCIKPFRSFSDQAYSNFVEQLIDS 1215

Query: 1430 IEMAIVNRLGTKSEELDSVTNIKLQIKYLDFF---FGQRN----TEGLELYVDQIDLEVS 1482
             E+ +V      + +     N+K+     +     FG  N    ++ +++ + +I +++S
Sbjct: 1216 NEIEVVLHFIETTLKRKQCKNVKVFSPTFEMTLSNFGSDNISQTSDTVDIVIKEISVDIS 1275

Query: 1483 QK-----TFQKKSTVVLDEIAILSRFLSLRASIN---EKKVLEDFDERPPALSLALEGWE 1534
             +        +KSTV   +I  L +  SL   ++       LE+  E     S +++  E
Sbjct: 1276 MREEPSPNSSEKSTV--QDITALVKVESLALCVSNTSRNGPLENIHE-DQLCSTSIKDLE 1332

Query: 1535 GWSSTASSQVNSLNISSTDITVDESQIEWLIDYLNRLVVFVHELVNSLDSIQKKSNGIQK 1594
             W ++   + +S N +S D  V   + E    +L      +  +   +   +++    Q+
Sbjct: 1333 FWMTSEDIRKSSFNATSIDTWVHSDKTELCCIFLKNTAANIDTITEVVSVHKERLQKAQR 1392

Query: 1595 KLVSDLTLASEYYQISHDPYVITKPAYVMRVSKGHVRQNRSWRIVTRLRHIYTYLPDDWE 1654
                 ++ AS+ YQI HDP VITKPAY+ R+   HVR+N+SW+I+TRLRHI  YLP    
Sbjct: 1393 DFFYRISTASDEYQIIHDPPVITKPAYITRLPNQHVRENKSWKIITRLRHILNYLPPSLL 1452

Query: 1655 IHVQEEMRGKDMNDVSDSSDIFLTVFSNWRNWEVSDVARSYIYKKIFLSNDETTSEKKLQ 1714
              +   ++       +++ +IFL +FS WR+WE SDV + Y+Y+K F S  E  +     
Sbjct: 1453 AEIYGALKSASFEAPTNAGEIFLNIFSKWRSWESSDVEQCYMYRKAFYSQYEGQAGP--- 1509

Query: 1715 TTVKLNLNSIFFTIYSTGYAIDHNIILTKAVILLELTTETAVSPPIEKSIL--------- 1765
              +++ ++S   T+  + +     I    AV  L+L  +  +   +  SIL         
Sbjct: 1510 LNLRVEVDSCSATVSDSTHKEGDMI----AVKGLKLLKKFILKSEMVGSILAIDDGTATD 1565

Query: 1766 --NMTGSLGSIKGEFSDKFLRLLELIPDFSKEEDIKSLTENSSIVSEKSPYFTIHLFLLF 1823
              +++ SL ++K   S+  ++LL     F + ++ + +  N+ ++        + L LL 
Sbjct: 1566 GNSLSCSLKAVKASISETAIKLLAFRELF-ESQNSQDILSNTQVLPSGKILKLMELALLI 1624

Query: 1824 ENGGLQLTMGDTTLSNNVTDGKISAXXXXXXXXXXXXXXGAYYMKKSEMCLKHNKDIIAE 1883
            +   +++++   T +       IS                A      E  ++HN  II +
Sbjct: 1625 DRCEIKISLDSKTANLKSFGNSISFALVDTESARDTGSSMALAWSWFEFDVRHNNAIIVD 1684

Query: 1884 FQLHHLGLISTGIYTPICPVILINLRSADLHFKSLASTEKIVKTIEDITEYSVHLYKHYD 1943
                   L S    +    +  ++L S  L  K  +ST+     I  ++E    L     
Sbjct: 1685 AFARRGSLGSFISQSESTTLHRVHLGSQKLRLKVPSSTKDYCNFINSLSESWSSLAPKL- 1743

Query: 1944 LRKYTTKPTKVDQKPEKINFD-VRVACNLSKVSAELTLISPFYLRYETKQLDLYFNQNGD 2002
              K+ T+    D  PE  NF  V    ++   ++E++ +SP  +    K L + F +  +
Sbjct: 1744 --KFNTRSK--DLSPEMKNFSKVAFEAHVDDFTSEISALSPLSISKRFKGLTVQFEKEAN 1799

Query: 2003 GEILLSLWDTDIFVTSHHTKEQYFRFSYDDIQINCNPMSEXXXXXXXXXXXXXXXX-TFS 2061
              + L + + D+ + S  T +QY + S   +++      +                    
Sbjct: 1800 SSLRLKVENFDLDLLSEMTAQQYLKVSQSQVELTAKIHDKIEKVASKMQLESALTKFKLC 1859

Query: 2062 EPRRIFASFLQDERITIESFQELK----KLKKIFFSNAKNVKKLNNDVPKEDTPTKWALE 2117
            +PR I  +  QD     ++ ++LK     L  +F +++ + +     +     P +W  +
Sbjct: 1860 DPREIIETLTQDLVNAKQNLEQLKIHLLALGALFGTDSTDEEVFAGAL----WPREWLWQ 1915

Query: 2118 LNINYFGILLPIASTFFVLELHMLLGSLTNTTEEIQEVN-NQISGQISLENILFLINDRS 2176
            L++ Y G+L+P+ +T ++ E++ L  SL+   +E  E +   + G++S+  I FLIND+ 
Sbjct: 1916 LDMKYVGLLVPLGTTSYISEINELSSSLS--CDEAAEFSFPLVHGELSVAGISFLINDKE 1973

Query: 2177 LPLRLSKLVDFSIRISTLQKTTSSYESLQIESSHFRMCFSPESLVFVLW---------GV 2227
            LP  LSK+++F+ RI   +   +S +SLQIES+HFR+   P SL+ +L          G+
Sbjct: 1974 LPEDLSKVLEFAFRIKLAKVAENSMKSLQIESTHFRIALCPFSLIRILSLAYEATHLSGL 2033

Query: 2228 KQLQNELEYYKDHKTKRQWNLXXXXXXXXXXXXXXPLNYFRSIHILSYNFCIGWMLPENQ 2287
            + L++          K  +N+                  F SI ILSY+FC+GW+   + 
Sbjct: 2034 QALKDNAGVKSSDDAKDFFNISQT---------------FHSIQILSYDFCLGWIFNNDG 2078

Query: 2288 KDIPGWMFGYDRLFSAYEKNYGKLTLIEGYMSVTNSNSSNDFFSQGEEKNRHNRSFLPSM 2347
                G  +GY RLF+A+EK YGKLTL++ Y  +   ++SNDF+ Q +E +R NRS LPSM
Sbjct: 2079 ASNSGLTWGYQRLFAAHEKPYGKLTLLDAYFFIARGSTSNDFYIQPDEVDRPNRSSLPSM 2138

Query: 2348 QILYWLKEFNSKKDLFIRLHGDALDVDILSNFVNIIELIFKSYQIFEDFRKSKIVQNIEK 2407
            QI YW +   S+ +LF+R++G+ LDV  LS  + I     +S  +F++ ++    Q ++ 
Sbjct: 2139 QICYWFETNGSEDELFVRINGERLDVSFLSKSIGIAGGFARSLHLFQELKR----QYLDP 2194

Query: 2408 QKHHEHIK---SENATEFVPTFLSDINSINCEFKYEGGTLRVFSVDDVEIDSTPSLELNA 2464
             K  E +K   + +A   +P  LS I+ +NC+ +Y GG  +++S+DD++  + PS +L +
Sbjct: 2195 FKPEEPVKRVPAGSAFSKLP-ILSSISHVNCKVRYAGGVFKLYSLDDIKRKTGPSFQLES 2253

Query: 2465 PKVSIYLNYKHFDDSPKPHWLRCVIDIHSSHNILYSKCAPFVIEFVESIQEILENRPVEP 2524
            P V +   Y       + H LR ++ + SSHN L+  C P + E    I+++L++     
Sbjct: 2254 PSVDVIFEYTKMLTGKRKHLLRALMSVDSSHNTLFPTCVPIISEMALDIRQLLKDLN--- 2310

Query: 2525 KQSVSKIATPNR----TYKRILAPFDIAFRIKAAKQMLSFSCEPSAKVQANVGLDSFLFG 2580
            K SV    T N      Y+ +L   DI+F +   KQ +S SCEP AKVQA+VG + F   
Sbjct: 2311 KSSVETPRTSNMQEGINYRSLLQDVDISFMMNIDKQQISLSCEPKAKVQADVGFEKFAMK 2370

Query: 2581 ISTGGSSVEDPLSLTLCINKISTSVQHIFSKEASASFSLNFIDLTFIFTQP-TLYCVGL- 2638
            + T    V +PLSL+L I+ I+ + +HIFS+E S S ++  +   F+ T P T++  G+ 
Sbjct: 2371 LFTNDFDVLEPLSLSLDIHNITATSRHIFSREVSTSLNIECLSFVFMLTHPDTIHTYGIA 2430

Query: 2639 -ISDIDIFFNMKQQQNLLLFLDIWHLSESIGIRPNXXXXXXXXXXGHTQI--PETPQPGK 2695
             I  ID++FN+KQ Q+L +F++IW L   I  +P           G T +  P T +  K
Sbjct: 2431 NIPTIDVYFNIKQLQDLNVFINIWKLDSKILSQPELDNKFVI---GPTNLEKPLTSKYKK 2487

Query: 2696 II-----PWNFNIIFTNVNADIHLGPALGIVSAKLEKTWFISDRYLDKRQILQLFTDGMV 2750
            +I     PWNF +I + +  +I LG +LG++S   EK W ++D Y D  Q L L  D + 
Sbjct: 2488 VISNSSFPWNFVVILSRIRGEIDLGISLGVLSLTTEKIWAVTDHYSDWTQTLSLQLDKLS 2547

Query: 2751 LKSRGRLSGMLDISNAGWRLEVNYADNELNYNSPIVAIGIDIGCVALKTAFDYHMFMISK 2810
            L S GRL G   + N  W  ++ +  NE ++ SP+V + I +   A+K  FDYH+ +I+ 
Sbjct: 2548 LSSDGRLGGTFLLQNFRWMSQIKWPLNEGSFESPLVVLNIFLDETAVKLTFDYHLVLIAS 2607

Query: 2811 VNNIHFRLHSERDPEGKLPDXXXXXXXCEEISICSTTLVASNILDIYNTIIRTRQDTKNS 2870
            V  +   L ++RDP G + +        +   +  T L  +NI D+YNTI+R R+D + S
Sbjct: 2608 VEKLSLSLFNKRDPRGVIRNLLSVSLSSDSTQVFLTALAPANIFDVYNTILRMRKDNRKS 2667

Query: 2871 YFETLMESNNQDTRTNIPYSDILKSLNLLRTDVQIDVSKLQLQISPISLFDFEVLVINID 2930
            Y ETL +SN +DT+ +    +IL SL+ LRT++ + +  + +Q+ P +LFD EV+     
Sbjct: 2668 YLETLGDSNTRDTKGSSSSHEILSSLSFLRTELSVMLKFVHIQVYPSTLFDMEVMTFKAR 2727

Query: 2931 NMSARSETTSTDKLKTRLELQVCNASVALSTAKEELDEESVNKISVADYMTYASKIKGGT 2990
            + S  S+T  + KLKT+L+L+V N  +ALST K +L E   ++I V +Y+ +ASK+ GGT
Sbjct: 2728 DFSTFSQTEGSKKLKTQLKLKVHNVKLALSTYKSQLHERVASQIGVKEYIEHASKVDGGT 2787

Query: 2991 ILIIPKLLVGMTTWQKVTSNTIEYTFTCKFDGKVSVRWNLGPVNFIKEMWATHVKSLAVR 3050
            IL  P +L+GMTTW  V +N +E  ++  F GK+ VRWNLG +NF++EMWATH +++A+R
Sbjct: 2788 ILSTPAILIGMTTWHDVATNKVELLYSNSFGGKIGVRWNLGSINFLREMWATHARAMALR 2847

Query: 3051 QARXXXXXXXXXXXXXXXXXXXXXXPAQPKFTYVALVEPSIEMPQIKDLEDATPPMEWFG 3110
              R                          ++TY+ L EP IE+PQ KDL +ATPP+EWFG
Sbjct: 2848 --RSHNGQSKSFFEDEHLGDKLKDVDLGDEYTYIPLEEPHIEIPQTKDLGEATPPVEWFG 2905

Query: 3111 LNRKKFPSFTHQTAVIVVQKLVHAVEKEYAKIIGHS 3146
            +NRK+FP  THQ  ++ +QKL H  E E+A+I+G +
Sbjct: 2906 VNRKQFPGLTHQGVIVPLQKLAHLAESEWARILGRA 2941

 Score =  125 bits (313), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 63/172 (36%), Positives = 96/172 (55%), Gaps = 24/172 (13%)

Query: 6   KFVSVSLSREKYFSWVFLVTWILTCILCLLMFFYIDRVFAYSLTFILDWLLWRPYKVKIH 65
           +F  V +S  + FSWVFL  W+L   + LL  FY  RV  Y++T IL++L W+ Y VK+ 
Sbjct: 4   EFRRVPISTAQDFSWVFLTDWVLILSVSLLSAFYFGRVLGYTITTILEYLAWKRYGVKV- 62

Query: 66  CEXXXXXXXXXXXXFKNLCIITENSTISILEGKIIWQYWLLNTRVSAYELHQQQKEHGYI 125
                         FKNL +IT++ T SIL G I W+YWLL++R ++ E   +       
Sbjct: 63  ----------GRVFFKNLTVITQDQTYSILHGSITWRYWLLSSRKTSLESQSE------- 105

Query: 126 TPGSGFKNIQLPCKFLFQCEGAEIFVYNKTSAYENIIDSFSPDEKIKYKEFL 177
                 K  +LPC+F  +C+G E F+YN+T A++NI+ S   +++   K+F 
Sbjct: 106 ------KAAKLPCRFRIECQGLEHFIYNRTQAFDNILSSLPREDQENVKKFF 151

 Score = 88.2 bits (217), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 56/191 (29%), Positives = 97/191 (50%), Gaps = 16/191 (8%)

Query: 298 LNFYPFGLKLTKGSIIFGNKFTPSLLIISYKSAEGIVDVLPATNPRVDLYKMKMKLDFQN 357
           L   P    + KG++I GNK T S+++ S++  +G +D   A + ++DLYK+K++ D   
Sbjct: 204 LRLLPLEYSVQKGALIIGNKKTSSVMVSSFEKLKGHLDAC-APDTKIDLYKIKLQSDITK 262

Query: 358 FEIEVKPNISYEDDSKPKAFYCDSMLSRLWTKFSTLFDIMPNPLSRYIHFSRLHKNSLFL 417
           F++ ++PN+ Y++D   K     + L +L  K+   F  +     R  + SR  K     
Sbjct: 263 FQMSLRPNLCYDNDEPLKNLPKANRLPKLLHKYYETFLRV-----RKRYLSRGSKTESTR 317

Query: 418 ED--NIFEDEDFEKKWKGLSLYKDAALNRGNPEEHIEFDFLNHEYARYCSIVKAPRLIFT 475
           +D  N  E      +W+GL LY     N    ++   F+   HEYARY  ++K   ++  
Sbjct: 318 KDLRNPLE------RWRGLGLYWKE--NDPAWDDVFHFELPKHEYARYSKVMKCEHMLIE 369

Query: 476 NEYDIPGIVPY 486
             +D PG+VP+
Sbjct: 370 YSHDTPGVVPH 380

>Kwal_56.23810 s56 (712732..721023) [8292 bp, 2763 aa] {OFF} YLR087C
            (CSF1) -  [contig 172] PARTIAL
          Length = 2763

 Score = 1385 bits (3584), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 845/2616 (32%), Positives = 1372/2616 (52%), Gaps = 129/2616 (4%)

Query: 590  NISAPPESNMEFQLFDASINYGPWAHRNIMNIQRIFSPIVSRTPELQPDPEPGFLRRYTM 649
            N  APP+ +++ Q+F A+I+YGPWAH  IM IQ++FSP+VSR          G  R +T 
Sbjct: 218  NGGAPPDFSLDIQVFGANIHYGPWAHHEIMPIQKVFSPVVSRDSHPTERLSAGSTRVFTR 277

Query: 650  TKISVSIMEDSSWRVPTREPSKDQDFLKRYMKTNDSSRSFGWFDLNFSRNSEATFCISSI 709
             +IS+ IM DS WR+PTREPSKD DFLKRY +T D +R FGW +L+ +  SE    I+  
Sbjct: 278  LRISIMIMSDSIWRIPTREPSKDLDFLKRYKETEDDTRPFGWLELSLAEGSEVRLNIAMC 337

Query: 710  PDVNGYANKLNLDFKDLEVRSSVNHDIFFRSKSYRVDSDIGYPLGWNDEVTWSFVFDSYQ 769
            P   G+ NKL+L F   E+R+SVNHDI   ++++ +++ IGYPLGWN +  W+F   S+Q
Sbjct: 338  PTSTGFDNKLDLHFIKPEIRTSVNHDILLSAETHDIEAQIGYPLGWNAKAKWNFDLKSHQ 397

Query: 770  LETFFLREHLVLIADTFSDFSSGEPTPYEFFRPSIYKVDWNFHGYSAYLNVNDHNIINNP 829
               F L++H+ L+ D  SDF +G+PTPY+ FRP IY+ +W   GYS YLNVND NI+NNP
Sbjct: 398  ARMFILKDHITLLGDILSDFGTGDPTPYDLFRPFIYEFNWELTGYSMYLNVNDANIVNNP 457

Query: 830  LDFNENCYISVHGDDAHIGVEIPRLGITATYTDIIFQISTPMFRXXXXXXXXXXXXEFMR 889
            +DFNENCY+S HGDD  I   +P+  I    T I + + TP+FR            EFM+
Sbjct: 458  VDFNENCYLSFHGDDLRISFRVPQDSIAGNSTTIDYNLYTPLFRLNMNTPSWNTLHEFMK 517

Query: 890  NKEIGRGYDFTAEGSYIIYSDLDIDNVDSLTIECSTRRMTLLTYGFVIGYLLNVQMNYFG 949
            +KE+GR  DF+  GSY+ +S LD++N+D++ IEC +R  TL  YG+V+ +L+ V+MNYFG
Sbjct: 518  DKEVGRACDFSLAGSYLFHSKLDVENIDTIIIECKSRMTTLKCYGYVVRFLVGVKMNYFG 577

Query: 950  EFSHFITAEEYTDIVRGNDNDIVSTLADFXXXXXXXXXXXXXXXQHNPDNSSKSNIIDPL 1009
            +F HF T EEY + +R   +  V   A+                + +  N+ K++  DP+
Sbjct: 578  DFVHFKTTEEYMEELR---DAYVEPKANSEQSANSTETTTAGEGE-DKQNAPKNHTTDPV 633

Query: 1010 YNPPLRKDDIKRKVNETDIWFTFSVWEGALLLPEVLYNSDPCIALSFKELIIDFRNCDYY 1069
                 +K  +KR VNE D+WFTF V +G L+LP+ LY+ + C A  F  L ID R  +YY
Sbjct: 634  M---AKKLSLKRMVNEKDVWFTFIVEDGCLILPKNLYDCNACFAFEFDSLDIDLRYINYY 690

Query: 1070 LDLLATLNGTSFKRCIRKNQNDIFELVHNNAIKNLEEHGSVSNISIHGHRMYGAPPTSPS 1129
            +DL A L+    +     +   +F         +    GS+S++ IH HRM+G PP   +
Sbjct: 691  MDLQAALSPVIVRNLSDCDPAHLFSGSEGRC-PSRANFGSISDLHIHAHRMFGLPPDEET 749

Query: 1130 YFSDWAVDVNNLSINSDIYFIRGFISYITKVGFEFSNLQNILLYDESVLDNMTSVTVHGT 1189
            YF  W   +  L I+SD+  I  F    +K+ F F + +NI+ Y    + +MTS+  H  
Sbjct: 750  YFCKWDFSMGVLDISSDLSCILSFGDAWSKLAFSFKDYENIMNYKIVPILDMTSIIFHAG 809

Query: 1190 GIDILVADKSTSAQVLLNMDGITFNRINFANDRYSSRIDLQVPGLHFAFFDNGSSMDKTC 1249
             I + + D +    +++ ++ +T   ++F N+RYSSR D+ +  +     + G   D + 
Sbjct: 810  EIRVKINDVAVDYYIIVEVENVTARGVDFENERYSSRADVDIHSITVQVKEGGK--DGSL 867

Query: 1250 LFEFKTKINFTNFTQMKDGELHSKKQQEFIALNDSAFHRCSFLLLPHIQESLLYHELYGG 1309
            + +F + +  T F Q+K+  +HS +Q+  IA ND+ FHRCSFLL   IQ S  Y +L G 
Sbjct: 868  IGDFSSSLKITKFCQLKNFLVHSMQQKSHIATNDAPFHRCSFLLPLAIQRSDNYRKLLGS 927

Query: 1310 ITXXXXXXXXXXXXQAETIAFIIDDFLGPFGINSTELLGSISTSTPIHXXXXXXXXXXXX 1369
            I               E +  I+D+FL   G  ++  +G        +            
Sbjct: 928  IVPGVSIPGMVEPITPENVTMILDEFLK--GEKNSLQMG--------NEHFCSKKEEDGY 977

Query: 1370 VIHPIESMQSHLVPSQSVTHGNYIIDISYITLDINPLFFTYASNFLDEFYSENIIETIDG 1429
              +    + S      +V   + ++ +      I+        +F D+ YS  + + ID 
Sbjct: 978  AFNFASGLMSSTENDSNVESESLVVKLIKPQASISACCIKPFRSFSDQAYSNFVEQLIDS 1037

Query: 1430 IEMAIVNRLGTKSEELDSVTNIKLQIKYLDFF---FGQRN----TEGLELYVDQIDLEVS 1482
             E+ +V      + +     N+K+     +     FG  N    ++ +++ + +I +++S
Sbjct: 1038 NEIEVVLHFIETTLKRKQCKNVKVFSPTFEMTLSNFGSDNISQTSDTVDIVIKEISVDIS 1097

Query: 1483 QK-----TFQKKSTVVLDEIAILSRFLSLRASIN---EKKVLEDFDERPPALSLALEGWE 1534
             +        +KSTV   +I  L +  SL   ++       LE+  E     S +++  E
Sbjct: 1098 MREEPSPNSSEKSTV--QDITALVKVESLALCVSNTSRNGPLENIHEDQ-LCSTSIKDLE 1154

Query: 1535 GWSSTASSQVNSLNISSTDITVDESQIEWLIDYLNRLVVFVHELVNSLDSIQKKSNGIQK 1594
             W ++   + +S N +S D  V   + E    +L      +  +   +   +++    Q+
Sbjct: 1155 FWMTSEDIRKSSFNATSIDTWVHSDKTELCCIFLKNTAANIDTITEVVSVHKERLQKAQR 1214

Query: 1595 KLVSDLTLASEYYQISHDPYVITKPAYVMRVSKGHVRQNRSWRIVTRLRHIYTYLPDDWE 1654
                 ++ AS+ YQI HDP VITKPAY+ R+   HVR+N+SW+I+TRLRHI  YLP    
Sbjct: 1215 DFFYRISTASDEYQIIHDPPVITKPAYITRLPNQHVRENKSWKIITRLRHILNYLPPSLL 1274

Query: 1655 IHVQEEMRGKDMNDVSDSSDIFLTVFSNWRNWEVSDVARSYIYKKIFLSNDETTSEKKLQ 1714
              +   ++       +++ +IFL +FS WR+WE SDV + Y+Y+K F S  E  +     
Sbjct: 1275 AEIYGALKSASFEAPTNAGEIFLNIFSKWRSWESSDVEQCYMYRKAFYSQYEGQAGP--- 1331

Query: 1715 TTVKLNLNSIFFTIYSTGYAIDHNIILTKAVILLELTTETAVSPPIEKSIL--------- 1765
              +++ ++S   T+  + +     I    AV  L+L  +  +   +  SIL         
Sbjct: 1332 LNLRVEVDSCSATVSDSTHKEGDMI----AVKGLKLLKKFILKSEMVGSILAIDDGTATD 1387

Query: 1766 --NMTGSLGSIKGEFSDKFLRLLELIPDFSKEEDIKSLTENSSIVSEKSPYFTIHLFLLF 1823
              +++ SL ++K   S+  ++LL     F + ++ + +  N+ ++        + L LL 
Sbjct: 1388 GNSLSCSLKAVKASISETAIKLLAFRELF-ESQNSQDILSNTQVLPSGKILKLMELALLI 1446

Query: 1824 ENGGLQLTMGDTTLSNNVTDGKISAXXXXXXXXXXXXXXGAYYMKKSEMCLKHNKDIIAE 1883
            +   +++++   T +       IS                A      E  ++HN  II +
Sbjct: 1447 DRCEIKISLDSKTANLKSFGNSISFALVDTESARDTGSSMALAWSWFEFDVRHNNAIIVD 1506

Query: 1884 FQLHHLGLISTGIYTPICPVILINLRSADLHFKSLASTEKIVKTIEDITEYSVHLYKHYD 1943
                   L S    +    +  ++L S  L  K  +ST+     I  ++E    L     
Sbjct: 1507 AFARRGSLGSFISQSESTTLHRVHLGSQKLRLKVPSSTKDYCNFINSLSESWSSLAPKL- 1565

Query: 1944 LRKYTTKPTKVDQKPEKINFD-VRVACNLSKVSAELTLISPFYLRYETKQLDLYFNQNGD 2002
              K+ T+    D  PE  NF  V    ++   ++E++ +SP  +    K L + F +  +
Sbjct: 1566 --KFNTRSK--DLSPEMKNFSKVAFEAHVDDFTSEISALSPLSISKRFKGLTVQFEKEAN 1621

Query: 2003 GEILLSLWDTDIFVTSHHTKEQYFRFSYDDIQINCNPMSEXXXXXXXXXXXXXXXX-TFS 2061
              + L + + D+ + S  T +QY + S   +++      +                    
Sbjct: 1622 SSLRLKVENFDLDLLSEMTAQQYLKVSQSQVELTAKIHDKIEKVASKMQLESALTKFKLC 1681

Query: 2062 EPRRIFASFLQDERITIESFQELK----KLKKIFFSNAKNVKKLNNDVPKEDTPTKWALE 2117
            +PR I  +  QD     ++ ++LK     L  +F +++ + +     +     P +W  +
Sbjct: 1682 DPREIIETLTQDLVNAKQNLEQLKIHLLALGALFGTDSTDEEVFAGAL----WPREWLWQ 1737

Query: 2118 LNINYFGILLPIASTFFVLELHMLLGSLTNTTEEIQEVN-NQISGQISLENILFLINDRS 2176
            L++ Y G+L+P+ +T ++ E++ L  SL+   +E  E +   + G++S+  I FLIND+ 
Sbjct: 1738 LDMKYVGLLVPLGTTSYISEINELSSSLS--CDEAAEFSFPLVHGELSVAGISFLINDKE 1795

Query: 2177 LPLRLSKLVDFSIRISTLQKTTSSYESLQIESSHFRMCFSPESLVFVLW---------GV 2227
            LP  LSK+++F+ RI   +   +S +SLQIES+HFR+   P SL+ +L          G+
Sbjct: 1796 LPEDLSKVLEFAFRIKLAKVAENSMKSLQIESTHFRIALCPFSLIRILSLAYEATHLSGL 1855

Query: 2228 KQLQNELEYYKDHKTKRQWNLXXXXXXXXXXXXXXPLNYFRSIHILSYNFCIGWMLPENQ 2287
            + L++          K  +N+                  F SI ILSY+FC+GW+   + 
Sbjct: 1856 QALKDNAGVKSSDDAKDFFNISQT---------------FHSIQILSYDFCLGWIFNNDG 1900

Query: 2288 KDIPGWMFGYDRLFSAYEKNYGKLTLIEGYMSVTNSNSSNDFFSQGEEKNRHNRSFLPSM 2347
                G  +GY RLF+A+EK YGKLTL++ Y  +   ++SNDF+ Q +E +R NRS LPSM
Sbjct: 1901 ASNSGLTWGYQRLFAAHEKPYGKLTLLDAYFFIARGSTSNDFYIQPDEVDRPNRSSLPSM 1960

Query: 2348 QILYWLKEFNSKKDLFIRLHGDALDVDILSNFVNIIELIFKSYQIFEDFRKSKIVQNIEK 2407
            QI YW +   S+ +LF+R++G+ LDV  LS  + I     +S  +F++ ++    Q ++ 
Sbjct: 1961 QICYWFETNGSEDELFVRINGERLDVSFLSKSIGIAGGFARSLHLFQELKR----QYLDP 2016

Query: 2408 QKHHEHIK---SENATEFVPTFLSDINSINCEFKYEGGTLRVFSVDDVEIDSTPSLELNA 2464
             K  E +K   + +A   +P  LS I+ +NC+ +Y GG  +++S+DD++  + PS +L +
Sbjct: 2017 FKPEEPVKRVPAGSAFSKLP-ILSSISHVNCKVRYAGGVFKLYSLDDIKRKTGPSFQLES 2075

Query: 2465 PKVSIYLNYKHFDDSPKPHWLRCVIDIHSSHNILYSKCAPFVIEFVESIQEILENRPVEP 2524
            P V +   Y       + H LR ++ + SSHN L+  C P + E    I+++L++     
Sbjct: 2076 PSVDVIFEYTKMLTGKRKHLLRALMSVDSSHNTLFPTCVPIISEMALDIRQLLKDLN--- 2132

Query: 2525 KQSVSKIATPNR----TYKRILAPFDIAFRIKAAKQMLSFSCEPSAKVQANVGLDSFLFG 2580
            K SV    T N      Y+ +L   DI+F +   KQ +S SCEP AKVQA+VG + F   
Sbjct: 2133 KSSVETPRTSNMQEGINYRSLLQDVDISFMMNIDKQQISLSCEPKAKVQADVGFEKFAMK 2192

Query: 2581 ISTGGSSVEDPLSLTLCINKISTSVQHIFSKEASASFSLNFIDLTFIFTQP-TLYCVGL- 2638
            + T    V +PLSL+L I+ I+ + +HIFS+E S S ++  +   F+ T P T++  G+ 
Sbjct: 2193 LFTNDFDVLEPLSLSLDIHNITATSRHIFSREVSTSLNIECLSFVFMLTHPDTIHTYGIA 2252

Query: 2639 -ISDIDIFFNMKQQQNLLLFLDIWHLSESIGIRPNXXXXXXXXXXGHTQI--PETPQPGK 2695
             I  ID++FN+KQ Q+L +F++IW L   I  +P           G T +  P T +  K
Sbjct: 2253 NIPTIDVYFNIKQLQDLNVFINIWKLDSKILSQPELDNKFVI---GPTNLEKPLTSKYKK 2309

Query: 2696 II-----PWNFNIIFTNVNADIHLGPALGIVSAKLEKTWFISDRYLDKRQILQLFTDGMV 2750
            +I     PWNF +I + +  +I LG +LG++S   EK W ++D Y D  Q L L  D + 
Sbjct: 2310 VISNSSFPWNFVVILSRIRGEIDLGISLGVLSLTTEKIWAVTDHYSDWTQTLSLQLDKLS 2369

Query: 2751 LKSRGRLSGMLDISNAGWRLEVNYADNELNYNSPIVAIGIDIGCVALKTAFDYHMFMISK 2810
            L S GRL G   + N  W  ++ +  NE ++ SP+V + I +   A+K  FDYH+ +I+ 
Sbjct: 2370 LSSDGRLGGTFLLQNFRWMSQIKWPLNEGSFESPLVVLNIFLDETAVKLTFDYHLVLIAS 2429

Query: 2811 VNNIHFRLHSERDPEGKLPDXXXXXXXCEEISICSTTLVASNILDIYNTIIRTRQDTKNS 2870
            V  +   L ++RDP G + +        +   +  T L  +NI D+YNTI+R R+D + S
Sbjct: 2430 VEKLSLSLFNKRDPRGVIRNLLSVSLSSDSTQVFLTALAPANIFDVYNTILRMRKDNRKS 2489

Query: 2871 YFETLMESNNQDTRTNIPYSDILKSLNLLRTDVQIDVSKLQLQISPISLFDFEVLVINID 2930
            Y ETL +SN +DT+ +    +IL SL+ LRT++ + +  + +Q+ P +LFD EV+     
Sbjct: 2490 YLETLGDSNTRDTKGSSSSHEILSSLSFLRTELSVMLKFVHIQVYPSTLFDMEVMTFKAR 2549

Query: 2931 NMSARSETTSTDKLKTRLELQVCNASVALSTAKEELDEESVNKISVADYMTYASKIKGGT 2990
            + S  S+T  + KLKT+L+L+V N  +ALST K +L E   ++I V +Y+ +ASK+ GGT
Sbjct: 2550 DFSTFSQTEGSKKLKTQLKLKVHNVKLALSTYKSQLHERVASQIGVKEYIEHASKVDGGT 2609

Query: 2991 ILIIPKLLVGMTTWQKVTSNTIEYTFTCKFDGKVSVRWNLGPVNFIKEMWATHVKSLAVR 3050
            IL  P +L+GMTTW  V +N +E  ++  F GK+ VRWNLG +NF++EMWATH +++A+R
Sbjct: 2610 ILSTPAILIGMTTWHDVATNKVELLYSNSFGGKIGVRWNLGSINFLREMWATHARAMALR 2669

Query: 3051 QARXXXXXXXXXXXXXXXXXXXXXXPAQPKFTYVALVEPSIEMPQIKDLEDATPPMEWFG 3110
              R                          ++TY+ L EP IE+PQ KDL +ATPP+EWFG
Sbjct: 2670 --RSHNGQSKSFFEDEHLGDKLKDVDLGDEYTYIPLEEPHIEIPQTKDLGEATPPVEWFG 2727

Query: 3111 LNRKKFPSFTHQTAVIVVQKLVHAVEKEYAKIIGHS 3146
            +NRK+FP  THQ  ++ +QKL H  E E+A+I+G +
Sbjct: 2728 VNRKQFPGLTHQGVIVPLQKLAHLAESEWARILGRA 2763

 Score = 88.2 bits (217), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 56/191 (29%), Positives = 97/191 (50%), Gaps = 16/191 (8%)

Query: 298 LNFYPFGLKLTKGSIIFGNKFTPSLLIISYKSAEGIVDVLPATNPRVDLYKMKMKLDFQN 357
           L   P    + KG++I GNK T S+++ S++  +G +D   A + ++DLYK+K++ D   
Sbjct: 26  LRLLPLEYSVQKGALIIGNKKTSSVMVSSFEKLKGHLDAC-APDTKIDLYKIKLQSDITK 84

Query: 358 FEIEVKPNISYEDDSKPKAFYCDSMLSRLWTKFSTLFDIMPNPLSRYIHFSRLHKNSLFL 417
           F++ ++PN+ Y++D   K     + L +L  K+   F  +     R  + SR  K     
Sbjct: 85  FQMSLRPNLCYDNDEPLKNLPKANRLPKLLHKYYETFLRV-----RKRYLSRGSKTESTR 139

Query: 418 ED--NIFEDEDFEKKWKGLSLYKDAALNRGNPEEHIEFDFLNHEYARYCSIVKAPRLIFT 475
           +D  N  E      +W+GL LY     N    ++   F+   HEYARY  ++K   ++  
Sbjct: 140 KDLRNPLE------RWRGLGLYWKE--NDPAWDDVFHFELPKHEYARYSKVMKCEHMLIE 191

Query: 476 NEYDIPGIVPY 486
             +D PG+VP+
Sbjct: 192 YSHDTPGVVPH 202

>AGR088W Chr7 (892680..901343) [8664 bp, 2887 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YLR087C (CSF1)
          Length = 2887

 Score = 1107 bits (2863), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 778/2667 (29%), Positives = 1251/2667 (46%), Gaps = 180/2667 (6%)

Query: 564  PDTDRNNESDASNNQQRNTYSRSTTDNISAPPESNMEFQLFDASINYGPWAHRNIMNIQR 623
            P T R  +SD   N +     R   D+       +++  ++DA+  YGPWA+R +    R
Sbjct: 316  PGTARVTDSD---NAENPLLERPELDH-------SVDILVYDANCTYGPWANRQVQQCLR 365

Query: 624  IFSPIVSRTPELQPDPEPGFLRRYTMTKISVSIMEDSSWRVPTREPSKDQDFLKRYMKTN 683
            +FSP V R  +L+   E          K+SV+IMEDS  RVP +E SKD  FL++Y +T 
Sbjct: 366  VFSPTVCRNFKLRTPEEIAQQTEPAAFKLSVTIMEDSVLRVPMKESSKDAAFLEKYKQTR 425

Query: 684  DSSRSFGWFDLNFSRNSEATFCISSIPDVNGYANKLNLDFKDLEVRSSVNHDIFFRSKSY 743
            D +R FGW D+  ++ S  T  +++ P  NG+ N L+ +  D  + +SVNHD   ++KS+
Sbjct: 426  DETRPFGWIDIRIAKESNITVRMAAYPTENGFENILHANLVDTTISTSVNHDTLLKAKSH 485

Query: 744  RVDSDIGYPLGWNDEVTWSFVFDSYQLETFFLREHLVLIADTFSDFSSGEPTPYEFFRPS 803
             +  D  YP GW D+  W+F   S Q E F LR+H+ LI+D  +DFS GE   YE FRP 
Sbjct: 486  DITVDFSYPYGWQDKAEWNFNVCSTQAELFVLRDHVYLISDLVTDFSGGEEVLYEQFRPF 545

Query: 804  IYKVDWNFHGYSAYLNVNDHNIINNPLDFNENCYISVHGDDAHIGVEIPRLGITATYTDI 863
             Y+  W+  GYSAYLNVND NIINNP+DF ENCY+SVHGDDA I   +P   I   Y  +
Sbjct: 546  DYRFRWDIRGYSAYLNVNDANIINNPIDFGENCYLSVHGDDAEITFSLPITSIIQKYVTV 605

Query: 864  IFQISTPMFRXXXXXXXXXXXXEFMRNKEIGRGYDFTAEGSYIIYSDLDIDNVDSLTIEC 923
             F I TP F             E +  KEIGR  +F  +GSY  YS++D+DNVD+L I C
Sbjct: 606  DFNIFTPHFSLFLNAPPWHTFSELLHYKEIGRSKNFNIKGSYTSYSEVDVDNVDALNIAC 665

Query: 924  STRRMTLLTYGFVIGYLLNVQMNYFGEFSHFITAEEYTDIVRGNDNDIVSTLADFXXXXX 983
             T  + +L YG ++  +LNV++NYFGE  HF T EEY + ++  +    ST   F     
Sbjct: 666  ETDYIVVLCYGVILKCMLNVKVNYFGEMVHFRTTEEYVEELQRRNKQNPSTCRPFNSDGN 725

Query: 984  XXXXXXXXXXQHNPD--NSSKSNIIDPLYN-----PPLRKDDIKRKVNETDIWFTFSVWE 1036
                       H+ D   +  + IID  ++     P ++K  +KR +NE D+WFTF    
Sbjct: 726  V----------HDSDVVATESNEIIDASFDAFGGPPTIKKSALKRSINELDVWFTFISKG 775

Query: 1037 GALLLPEVLYNSDPCIALSFKELIIDFRNCDYYLDLLATLNGTSFKRCIRKNQNDIFELV 1096
            G    PE +Y  D C+   F  L    R  +YY+D   +L+   FKR    +   +F+++
Sbjct: 776  GCFFFPENIYKFDACLGFYFDNLEASLRFLNYYVDAAVSLDSIYFKRHTDIDARTLFKVI 835

Query: 1097 HNNAIKNLEEHGSVSNISIHGHRMYGAPPTSPSYFSDWAVDVNNLSINSDIYFIRGFISY 1156
             +  I        +S  S   H+M G  P+  SY  ++ V V+ L ++ D+  ++ F++ 
Sbjct: 836  EDIGIPIDASDAYLSQFSFRLHKMLGIMPSEESYACEFDVRVDTLDVHCDLAVLKAFVNT 895

Query: 1157 ITKVGFEFSNLQNILLYD-ESVLD-NMTSVTVHGTGIDILVADKSTSAQVLLNMDGITFN 1214
            +  + F F +++N L Y+ E V D N  S  +    + +   DK     + LN+   T  
Sbjct: 896  LRNLAFGFKDVENSLQYEREQVFDLNKISCVIENVTVKLQNVDKDEDIWLSLNLPVTTLT 955

Query: 1215 RINFANDRYSSRIDLQVPGLHFAFFDNGSSMDKTCLFEFKTKINFTNFTQMKDGELHSKK 1274
              + AN+RYS R DL +P L F  +   S  + TCL  F T +  T F + +        
Sbjct: 956  SFDLANERYSRRSDLSIPELLFGIYRGDS--ESTCLGAFSTGVTVTLFERFEQFARCRVL 1013

Query: 1275 QQEFIALNDSAFHRCSFLLLPHIQESLLYHELYGGITXXXXXXXXXXXXQAETIAFIIDD 1334
            Q++ I +ND+ FHRCSF+L P  ++  +Y  LYG I              A+    I + 
Sbjct: 1014 QRKHILVNDAPFHRCSFMLPPEYKKMPIYRSLYGCIPPSSSLPLFPEPISADNFEVIFEK 1073

Query: 1335 FLG----PFGINSTELLGSISTSTPIHXXXXXXXXXXXXVIHPIESMQSHLVPSQS--VT 1388
             LG     +  +S+  +   S S+  H            V   I +  S  + SQ+   T
Sbjct: 1074 LLGEIYQEYASDSSYQITDDSISSTEH------DYHNQTVNAAIGTSSSLFIRSQNHQQT 1127

Query: 1389 HGNYIIDISYIT--LDINPLFFTYASNFLDEFYSE----NIIETIDGIEMAIVNRLGTKS 1442
              ++I++   I   LD++      A+ F+ E Y      ++ E ID +E+ I+N+     
Sbjct: 1128 LSSFIVEFDPIDGYLDLS------ATEFMLEIYKYLTEVSLDEAIDSLEIGIINQFIQTF 1181

Query: 1443 EELDSVTNIKLQIKYLDFFFGQRNTE----GLELYVDQIDLEVSQKTFQKKSTVVLDEIA 1498
             E + ++ +++    +      + ++     L   +  +D+    K+         ++  
Sbjct: 1182 GEDNGISEVRVLCPNISLSATNKQSKFSMFKLSSKIKNLDITSRIKSSDPNLKPDPEKTT 1241

Query: 1499 ILSRFLSLRASINEKKVLEDFDERPPALSLALEGWEGWSSTASSQVNSLNISSTDITVDE 1558
            +  +   +RA+I +  ++    +     S ++E  EG+ S     +   N+ S  +T+  
Sbjct: 1242 LCYKIDYIRANIVQDGIVVPPKQPSQLFSCSIELLEGYLSYDKLSLLDNNVQSCSVTLSP 1301

Query: 1559 SQIEWLIDYLNRLVVFVHELVNSLDSIQKKSNGIQKKLVSDLTLASEYYQISHDPYVITK 1618
               + L ++LN  +     L   L S +      +++ + ++      Y+I HDP VITK
Sbjct: 1302 GTDKLLFEFLNPFISTFDLLQRELSSFEDTLLASKREFLLNILRGGRDYEIQHDPPVITK 1361

Query: 1619 PAYVMRVSKGHVRQNRSWRIVTRLRHIYTYLPDDWEIHVQEEMRGKDMNDVSDSSDIFLT 1678
            PA + R S  H+R   SWRI+ RLRHI  YLP +W       +  +D     ++   FL+
Sbjct: 1362 PANITRFSNRHIRSAESWRIIMRLRHILNYLPQEWHQSFTRHLGTQDFTSPEEAGKEFLS 1421

Query: 1679 VFSNWRNWEVSDVARSYIYKKIF---------------LSNDETTSEKKLQTTVKLNLNS 1723
            +FS+WR+WE +DV  S++++K+F                S+D+     K    V + +  
Sbjct: 1422 IFSDWRSWEPTDVQGSFVHEKVFTKKRSRPFAALQGFTFSSDDIRLNMKDDARVPITVKG 1481

Query: 1724 IFFTIYSTGYAIDHNIILTKAVILLELTTETAVSPP-------IEKSILNMTGSLGSIKG 1776
            +   I + G A +           ++  TE ++  P        ++ ++ +  S      
Sbjct: 1482 VTLGIRNNGLAPEQ----------VDGRTEGSMPDPDYISFCTTDEVVMRVDRSFVKTLK 1531

Query: 1777 EFSDKFLRLLELIPDFSKEEDIKSLTENSSIVSEKSPYFTIHLFLLFENGGLQLTMGDTT 1836
            EF D   R     P  + + D  SL  N +    K       L+++ +  G+ L +    
Sbjct: 1532 EFRDLIHRFKIGGPVGTAKHDNVSLFSNITFQFGK-------LYVVAKLAGVYLRICLDN 1584

Query: 1837 LSNNVTDGKISAXXXXXXXXXXXXXXGAYYMKKSEMCLKHNKDIIA----EFQLHHLGLI 1892
            LS  +   + S                +  +  S +   H + I+      F    + + 
Sbjct: 1585 LSALMLTSQSSVE--------------SKVISSSTLSFDHMQAILGYRSFRFMTIDIDMF 1630

Query: 1893 STGI-YTPICPVILINLRSADLHF-KSLASTEKIVKTIEDITEYSVHLYKHYDLRKYTTK 1950
            S  + Y P      I+ ++   H   S A+T+ + +++  + +   +L +      +   
Sbjct: 1631 SVLLHYLPGQGCYSIDWKARKFHIDSSSATTKDLTESLPYVRDEIKYLVEALVPELFAEP 1690

Query: 1951 PTKVDQKPEKINFDVRVACNLSKVSAELTLISPFYLRYETKQLDLYFNQNGDGEILLSLW 2010
            P + +    KI+  V     ++ ++ +L ++SPF + Y  +  +L           L+  
Sbjct: 1691 PIERESSGNKIH-AVLFQGQVANITLKLQILSPFIILYCAENFELQAESTDSVIFDLNSG 1749

Query: 2011 DTDIFVTSHHTKEQYFRFSYDDIQINCNPMSEXXXXXXXXXXXXXXXXTFSEPRRIFASF 2070
            ++ + ++S   K  YF++++  ++++    S                  F    RI    
Sbjct: 1750 ESYMEISSAKQKLDYFKYTHTCLKLSGTSSSARLFEHISCDIGILKLSVFDLKTRI-TDL 1808

Query: 2071 LQDERITIESFQELKKLKKIFFSNAKNVKKLNNDVPKEDTPTKW------ALELNINYFG 2124
            LQD +  + S + L            ++  ++   P       W       L L   Y G
Sbjct: 1809 LQDIKAALFSMKSL-----------SDILNISQSSPTASAFGSWFSILPDNLSLQATYAG 1857

Query: 2125 ILLPIASTFFVLELHMLLGSLTN-------TTEEIQEVNNQISGQISLENILFLINDRSL 2177
            +LL    T ++LE +      T        T     +V++      S+E+  FLI DR +
Sbjct: 1858 LLLGFGHTLYILEFNNFEAKHTRDGLPDAITPRPCFKVDH------SIESASFLIKDRRI 1911

Query: 2178 PLRLSKLVDFSIRISTLQKTTSSYESLQIESSHFRMCFSPESLVFVLWGVKQLQNELEYY 2237
              RL+K+VDF++  + +  T    +S+QIES+H ++  +P ++V +L     L NE    
Sbjct: 1912 DDRLAKVVDFAVNFNMVHDTDLCIQSVQIESTHLKITLAPMTVVRLL----SLINEFGII 1967

Query: 2238 KDHKTKRQWNLXXXXXXXXXXXXXXPLNYFRSI----HILSYNFCIGWMLPENQKDIPGW 2293
            +   T+                     + +R I    HILS++F I W+         G 
Sbjct: 1968 RKQFTEESIYTPSSAHNNSTATECLEPSVWRLIIKSGHILSHDFSIVWLFDIPNSSADGL 2027

Query: 2294 MFGYDRLFSAYEKNYGKLTLIEGYMSVTNSNSSN-DFFSQGEEKNRHNRSFLPSMQILYW 2352
            + GYDRLFS YEK YGKLTL+  Y S     +S  DF+S    K R N S+L  MQ+ YW
Sbjct: 2028 ICGYDRLFSVYEKPYGKLTLLNAYFSAAKILASEADFYSSVVRKQRINTSYLSDMQLRYW 2087

Query: 2353 LKEFNSKKDLFIRLHGDALDVDILSNFVNIIELIFKSYQIFEDFRKSKIVQNIEKQKHHE 2412
              E +   DLFIR+HG  L VDI +  V ++E   +S Q F + +K+ +V     +K   
Sbjct: 2088 FTEDSENTDLFIRIHGAKLAVDISAEIVTLLEETIQSIQTFNNLKKA-LVDPFRTKKQDS 2146

Query: 2413 HIKSENATEFVPTFLSDINSINCEFKYEGGTLRVFSVDDVEIDSTPSLELNAPKVSIYLN 2472
             I  E    +     + + S+NC   Y G TL++ S  D   D++P LEL +P   + ++
Sbjct: 2147 DISKE-PYNWNNQLATGVRSLNCIINYAGVTLKLHS-HDGRGDASP-LELTSPSYKVAID 2203

Query: 2473 YKHFDDSPKPHWLRCVIDIHSSHNILYSKCAPFVIEFVESIQEILENRPVEPK----QSV 2528
            YK+F +  K H  R +I    +HN  YS  A  + +      ++L+    E K     + 
Sbjct: 2204 YKYFPNLEKTHRFRTLITATPTHNTFYSTSAFLIHDLCYRFSKLLKTSSTENKSSSASTS 2263

Query: 2529 SKIATPNRTYKRILAPFDIAFRIKAAKQMLSFSCEPSAKVQANVGLDSFLFGISTGGSSV 2588
            S I         +L   D+   +   KQ ++FSCEP AKVQA VG + F   I     + 
Sbjct: 2264 SSIKVEGSDNSTLLGSIDLVIILNVGKQEVTFSCEPKAKVQATVGFEKFDIKIFNNNIND 2323

Query: 2589 EDPLSLTLCINKISTSVQHIFSKEASASFSLNFIDLTFIFTQPT---LYCVGLISDIDIF 2645
            E+ L L + I  + T+ +HI+S+E  AS  L  I + F         +Y   LIS    +
Sbjct: 2324 EESLCLAIEIENLMTNSRHIYSREVCASLKLRHISMVFDIMGSQVRRIYGSTLISSPLFY 2383

Query: 2646 FNMKQQQNLLLFLDIWHLSES---IGIRPNXXXXXXXXXXGHTQIPETPQPGKIIPWNFN 2702
            FNMKQ Q+L LF+D W   ++    G  P             ++  +         W ++
Sbjct: 2384 FNMKQLQDLKLFIDQWFPQKTPMNTGSYPEGVLVDDISRSIGSKFYKGSSSSSFT-WGYS 2442

Query: 2703 IIFTNVNADIHLGPALGIVSAKLEKTWFISDRYLDKRQILQLFTDGMVLKSRGRLSGMLD 2762
            +I     A+I LGP+LG+++   E  W IS + +D  Q L L    + + S GRL G   
Sbjct: 2443 VIVAGSCAEIELGPSLGVLNVTSEDVWAISKQQVDWSQQLDLNMGKLDVTSSGRLGGNFL 2502

Query: 2763 ISNAGWRLEVNYADNELNYNSPIVAIGIDIGCVALKTAFDYHMFMISKVNNIHFRLHSER 2822
            + NA   LE+ + + +  +  P+V + +    V  K +FDYH F IS +   +  L +ER
Sbjct: 2503 VRNAHLSLELKWPNPKDFFQVPLVCVKLGSDTVDTKLSFDYHTFFISSLKQGYASLFNER 2562

Query: 2823 DPEGKLPDXXXXXXXCEEISICSTTLVASNILDIYNTIIRTRQDTKNSYFETLMESNNQD 2882
            D +G L D        E ++I  T L A+NI DI N+I R ++D + SY  + + S   D
Sbjct: 2563 DEDGSLADLLSVTVSFESVNIFLTALAAANISDIKNSITRLKKDNELSYLSSFLAS---D 2619

Query: 2883 TRTNIPYSD--ILKSLNLLRTDVQIDVSKLQLQISPISLFDFEVLVINIDNMSARSETTS 2940
              ++ P  D  I  +L+LLRT + +++   +LQISP SLFD +VL++    M A +   +
Sbjct: 2620 QPSDEPEEDGGIFDTLSLLRTQLSLNLGVFRLQISPTSLFDSDVLILTATKMMANTGIQA 2679

Query: 2941 TDKLKTRLELQVCNASVALSTAKEELDEESVNKISVADYMTYASKIKGGTILIIPKLLVG 3000
              K+KT L  Q+ + S+AL      LDE  +  + V  Y+  +S I+GG I   P ++V 
Sbjct: 2680 DIKIKTDLHWQLDDVSLALLPFNNSLDESYLATMEVGKYIELSSTIQGGAIFSAPSIVVN 2739

Query: 3001 MTTWQKVTSNTIEYTFTCKFDGKVSVRWNLGPVNFIKEMWATHVKSLAVRQARXXXXXXX 3060
            MTTWQ+  SN IE  ++  F G V +RWNLGP++FIK+MW  H+ ++ +R+         
Sbjct: 2740 MTTWQEPQSNVIELLYSTSFGGTVKIRWNLGPISFIKDMWQAHMNAMQLREGYYHGLAES 2799

Query: 3061 XXXXX-XXXXXXXXXXPAQPKFTYVALVEPSIEMPQIKDLEDATPPMEWFGLNRKKFPSF 3119
                                 + Y+ L EP IEMP+IKDL DATPP+EWFG+NR KFP F
Sbjct: 2800 GVAVTPLNSKAVPLEMHLGSDYQYLPLQEPDIEMPRIKDLGDATPPIEWFGVNRTKFPGF 2859

Query: 3120 THQTAVIVVQKLVHAVEKEYAKIIGHS 3146
            THQ  ++ +QKL    EKEY KI+G +
Sbjct: 2860 THQFVIVPLQKLARTAEKEYEKILGRA 2886

 Score = 81.6 bits (200), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 55/184 (29%), Positives = 92/184 (50%), Gaps = 16/184 (8%)

Query: 300 FYPFGLKLTKGSIIFGNKFTPSLLIISYKSAEGIVDV-LPATNPRVDLYKMKMKLDFQNF 358
           F P      KG+I+ GNK T S+ I++Y+   G V + +P        ++ + K+   N 
Sbjct: 149 FLPVEFLHNKGAIVLGNKQTHSVAIMNYEKLAGTVSIEVPDDTRAPSSFRTEAKI--SNC 206

Query: 359 EIEVKPNISYEDDSKPKAFYCDSMLSRLWTKFSTLFDIMPNPLSRYIHFSRLHKNSLFLE 418
            + +KPNISYE D+  K +      +RLW K+ TL   +   L   +H  R  +      
Sbjct: 207 TVAIKPNISYEVDNPVKIYVEPKRTARLWKKYKTLLGTV---LEATLHAKRKKEQH---- 259

Query: 419 DNIFEDEDFEKKWKGLSLYKDAALNRGNPEEHIEFDFLNHEYARYCSIVKAPRLIFTNEY 478
               +   +   W+GLS+Y D  L+    +E ++FD  +HEYA+  +++KA ++  T  Y
Sbjct: 260 ----QTPKWYDNWRGLSMY-DVNLDE-ELDEEVKFDIEHHEYAKCTTVLKADQMDVTYSY 313

Query: 479 DIPG 482
            +PG
Sbjct: 314 GMPG 317

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 35/130 (26%), Positives = 60/130 (46%), Gaps = 17/130 (13%)

Query: 32  LCLLMFFYIDRVFAYSLTFILDWLLWRPYKVKIHCEXXXXXXXXXXXXFKNLCIITENST 91
           + +   FY+ RV  Y ++   + +LW+ Y+V +  +            FKN+ + +++  
Sbjct: 1   MVIFAIFYVGRVLGYIVSKAANLVLWKQYRVTVSIQSLVFSPLAGKVHFKNVSVTSQDQL 60

Query: 92  ISILEGKIIWQYWLLNTRVSAYELHQQQKEHGYITPGSGFKNIQLPCKFLFQCEGAEIFV 151
           IS+L+G I W+YWL    +  Y               SG  +    C+F  + EG E FV
Sbjct: 61  ISVLKGTITWRYWL----IGRYR-------------RSGTADGARRCRFALKFEGFEYFV 103

Query: 152 YNKTSAYENI 161
           YN+   Y+ I
Sbjct: 104 YNRNGVYDRI 113

>Ecym_4310 Chr4 (657929..666760) [8832 bp, 2943 aa] {ON} similar to
            Ashbya gossypii AGR088W
          Length = 2943

 Score =  625 bits (1612), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 391/1199 (32%), Positives = 626/1199 (52%), Gaps = 48/1199 (4%)

Query: 1967 VACNLSKVSAELTLISPFYLRYETKQLDLYFNQNGD-GEIL---LSLWDTDIFVTSHHTK 2022
            V  N++ ++ +L L+ PF LRY  K+ ++    N D G IL   LSL DT + + S   +
Sbjct: 1770 VKMNIAAINIQLQLLLPFILRYSCKEFEI----NVDFGRILQSSLSLQDTSVELLSLEFQ 1825

Query: 2023 EQYFRFSYDDIQINCNPMSEXXXXXXXXXXXXXXXXTFSEPRRIFASFLQDERITIESFQ 2082
            E Y ++S+  +++    +                  +  EP++    FL D    +++ +
Sbjct: 1826 EPYMKYSHSYLKLIGMDLGNTDNLGRISLDSSFSKLSIFEPKKNMRLFLSDIEQAVKNIE 1885

Query: 2083 ELKK-LKKIFFSNAKNVKKLNNDVPKEDTPTKWALELNINYFGILLPIASTFFVLELHML 2141
             L+  + +   S  +N    +  +P +       L LN+ Y G+LL   +T +VLE + L
Sbjct: 1886 ILRSTMLETKSSTVQNEFPFSRLIPIQ-------LNLNVEYIGLLLDFGTTLYVLEFNNL 1938

Query: 2142 LGSLTNTTEEIQEVNNQISGQISLENILFLINDRSLPLRLSKLVDFSIRISTLQKTTSSY 2201
              S +        V    S   S E+I FLI DR +   LSK++DFS+RI  ++ +  + 
Sbjct: 1939 EFSFSKDKTSSNPVVPTFSSDYSSESICFLIKDRRVKETLSKVLDFSLRIKVIRSSLLAI 1998

Query: 2202 ESLQIESSHFRMCFSPESLVFVLWGVKQLQNELEYYKDHKTKRQWNLXXXXXXXXXXXXX 2261
            +SLQIESS+     SP SLV +L  V +       Y D K +                  
Sbjct: 1999 QSLQIESSYLHAVLSPMSLVRLLSFVNEFSIMKSIYHDIKPR--------STSSNSTLSI 2050

Query: 2262 XPLNYFRSIHILSYNFCIGWMLPENQKDIPGWMFGYDRLFSAYEKNYGKLTLIEGYMSVT 2321
             P++  +S HILSYN CIGW+         G ++GY+RLF+ Y+K YGKLTL++ Y SV 
Sbjct: 2051 LPIS-IKSAHILSYNLCIGWLFDLGYNANEGLIWGYERLFAVYDKPYGKLTLLDAYFSVA 2109

Query: 2322 NSNSSNDFFSQGEEKNRHNRSFLPSMQILYWLKEFNSKKDLFIRLHGDALDVDILSNFVN 2381
            +  SS+ ++  G EK   NRS+LPSMQI YWL+E N  KDLFIR++G+ LDV +L+ +  
Sbjct: 2110 HGFSSSTYYPDGNEKGAMNRSYLPSMQINYWLEEENGTKDLFIRVNGEELDVSLLAWWFT 2169

Query: 2382 IIELIFKSYQIFEDFRKSKIVQNIEKQKHHEHIKSENATEFVPTFLSDINSINCEFKYEG 2441
            I++   +S   F+  +++ I+  ++   +   +   N  +      S + SINC   Y G
Sbjct: 2170 IVDEATQSLHKFKKLKET-ILDPLKVTSNDPILGEWNYLD--NPLASSVRSINCIINYAG 2226

Query: 2442 GTLRVFSVDDVEIDSTPSLELNAPKVSIYLNYKHFDDSPKPHWLRCVIDIHSSHNILYSK 2501
             +++++S DD++   T S E+ +P  ++ ++YK++    K HW+R +  ++++HN L+  
Sbjct: 2227 SSMKLYSRDDIQ-HGTCSFEIRSPAHTVTIDYKYYPSKKKSHWIRTLATVNTTHNTLFPV 2285

Query: 2502 CAPFVIEFVESIQEILENRPVEPKQSVSKIATPNR--TYKRILAPFDIAFRIKAAKQMLS 2559
            C P + E   +   +L+N   +       +A+      Y+ +L  FDIA  I   KQ +S
Sbjct: 2286 CVPLLNEMWLTFNTMLKNSCSQFSNGAPNLASAKAEINYRDLLEAFDIAVIINVGKQEIS 2345

Query: 2560 FSCEPSAKVQANVGLDSFLFGISTGGSSVEDPLSLTLCINKISTSVQHIFSKEASASFSL 2619
             +CEP+AK+QA +G + F   I T     ++PL L++ ++ +  S +H+FS+E S+S SL
Sbjct: 2346 LTCEPTAKIQATIGFEKFDIKIFTNSMVPDEPLCLSVDLHNLMASSRHVFSREISSSLSL 2405

Query: 2620 NFIDLTFIFTQPTL---YCVGLISDIDIFFNMKQQQNLLLFLDIWHLSESIGIRPNXXXX 2676
              I + F  T       Y   LIS    +FN+KQ ++L LFL+IW + +   +  N    
Sbjct: 2406 QQISMVFSLTHSEYIHTYGSTLISKPLFYFNVKQIEDLNLFLEIWSIEKQKSV--NDIIL 2463

Query: 2677 XXXXXXGHTQIPETPQPGKI-----IPWNFNIIFTNVNADIHLGPALGIVSAKLEKTWFI 2731
                      +P  P+  ++       W++ +I + + A+I LGP+LG+V  K +  W +
Sbjct: 2464 APVTASSFESVPSMPKLQRVPINATFSWDYLLIISEIGAEIDLGPSLGLVKVKSDNLWGL 2523

Query: 2732 SDRYLDKRQILQLFTDGMVLKSRGRLSGMLDISNAGWRLEVNYADNELNYNSPIVAIGID 2791
            S   +D  Q L +    + + S GRL G + I +  W+ ++ +      +  P+V + + 
Sbjct: 2524 SSHNIDWTQKLLISMKEICMSSSGRLGGYVFIKDIVWKSKITWPIINNFHGVPLVELSLA 2583

Query: 2792 IGCVALKTAFDYHMFMISKVNNIHFRLHSERDPEGKLPDXXXXXXXCEEISICSTTLVAS 2851
            +G    K +FDYHMF IS + N    L +++D  G L D        + I +  T+L  +
Sbjct: 2584 LGAFNTKLSFDYHMFFISTIQNAAIELFNQQDERGFLADLLSVSVSVDNIQVFITSLAYA 2643

Query: 2852 NILDIYNTIIRTRQDTKNSYFETLMESNNQDTRTNIPYSDILKSLNLLRTDVQIDVSKLQ 2911
            N+ DIY+TI R R D+  +  + L+ESN     ++   S +L SL  LRT++ ++   L 
Sbjct: 2644 NLFDIYSTIRRMRNDSGRTNLD-LLESNELKKISSFDNSKMLASLLSLRTELSVNAQLLN 2702

Query: 2912 LQISPISLFDFEVLVINIDNM------SARSETTSTDKLKTRLELQVCNASVALSTAKEE 2965
            L I   +L   EV+V+    +       A S+TTS  K++T L  Q+ + S++LS+ K +
Sbjct: 2703 LHIFSTTLIGTEVVVLRTRKVIANTKNEASSKTTSDAKVQTELTWQLQDMSLSLSSFKHQ 2762

Query: 2966 LDEESVNKISVADYMTYASKIKGGTILIIPKLLVGMTTWQKVTSNTIEYTFTCKFDGKVS 3025
            LDE  ++KI V DY+  AS I GG IL  P + V M TWQ   SN IE  ++  F   VS
Sbjct: 2763 LDENQLDKIDVIDYVKLASIIHGGIILEAPSIFVTMNTWQSQYSNVIELLYSSSFGNGVS 2822

Query: 3026 VRWNLGPVNFIKEMWATHVKSLAVRQARXXXXXXXXXXXXXXXXXXXXXXPAQPKFTYVA 3085
            + WNL P+NFIK+MW+ H+ ++ +R  +                          K+ Y  
Sbjct: 2823 ITWNLRPINFIKDMWSIHINAMKLRHMQKGNSSEIHIPKDEDIEAKLAKVDLGTKYIYKP 2882

Query: 3086 LVEPSIEMPQIKDLEDATPPMEWFGLNRKKFPSFTHQTAVIVVQKLVHAVEKEYAKIIG 3144
            L EP+IEMP+IKDL DATPP+EWFGLNR +FP  THQ  V+ +QKL    EKEY +I+G
Sbjct: 2883 LEEPNIEMPKIKDLGDATPPVEWFGLNRSRFPGLTHQIVVVPLQKLSAVAEKEYVRILG 2941

 Score =  599 bits (1545), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 367/1153 (31%), Positives = 579/1153 (50%), Gaps = 66/1153 (5%)

Query: 590  NISAPPESNMEFQLFDASINYGPWAHRNIMNIQRIFSPIVSRTPELQPDPEPGFLRRYTM 649
            +I   PE +++ QL+DA+  YGPWAHR +    ++FSP VSR       P  G  R +  
Sbjct: 397  DIPPSPEYSIDVQLYDANFYYGPWAHRQLQYFIKMFSPAVSRDFSAHRKPVLGKSREHAN 456

Query: 650  TKISVSIMEDSSWRVPTREPSKDQDFLKRYMKTNDSSRSFGWFDLNFSRNSEATFCISSI 709
             +  + IMEDS WR+PT+EPSKD  FL +Y  TND SR+FGW D+  ++++  +  +   
Sbjct: 457  FRCEIVIMEDSVWRIPTKEPSKDAAFLDKYKSTNDESRAFGWIDIKLNKDTNISIELGLQ 516

Query: 710  PDVNGYANKLNLDFKDLEVRSSVNHDIFFRSKSYRVDSDIGYPLGWNDEVTWSFVFDSYQ 769
                G+ N  + +  +  + +SVNHD+ F +K++++ +   YP  WN  +TW+  F S  
Sbjct: 517  ASECGFENTFHANLVNPVIITSVNHDVLFNAKAHQIIARQSYPHQWNSAITWALHFISSD 576

Query: 770  LETFFLREHLVLIADTFSDFSSGEPTPYEFFRPSIYKVDWNFHGYSAYLNVNDHNIINNP 829
            LE F LR+H  L+ D F+DF+SG+  PYE FRP +Y+  W+   YS YLN ND NI+NNP
Sbjct: 577  LELFILRDHFNLLVDLFTDFASGDAVPYELFRPVLYQFSWDISNYSLYLNANDANIVNNP 636

Query: 830  LDFNENCYISVHGDDAHIGVEIPRLGITATYTDIIFQISTPMFRXXXXXXXXXXXXEFMR 889
            LDFNENCYIS+HG+ A IGV++P   I+     I ++I TP F             EFM 
Sbjct: 637  LDFNENCYISIHGNSARIGVKLPIETISEESITISYEIYTPKFDIQLKTPPWHTLHEFMA 696

Query: 890  NKEIGRGYDFTAEGSYIIYSDLDIDNVDSLTIECSTRRMTLLTYGFVIGYLLNVQMNYFG 949
             + +GR ++F+A GSY+ Y+D+DIDNVD++ +EC T   T L YGF++ Y++N+++NYFG
Sbjct: 697  QRFVGRSHEFSASGSYLSYNDVDIDNVDTINLECKTNHATFLAYGFLLRYVMNLKLNYFG 756

Query: 950  EFSHFITAEEY-----------TDIVRGNDNDIVSTLADFXXXXXXXXXXXXXXXQHNPD 998
            EF+ F T EEY           TDI   ND+D  + L +                     
Sbjct: 757  EFAQFRTTEEYSEELAQRNDVATDIFNNNDDDQTTELVE--------------------P 796

Query: 999  NSSKSNIIDPLYNPPLRKDDIKRKVNETDIWFTFSVWEGALLLPEVLYNSDPCIALSFKE 1058
            NS   +  D L+   + K  +KR VNE DIW TF   +G  +LPE  Y+   C  L F  
Sbjct: 797  NSYGESGFDILHGKKIDKASLKRTVNEKDIWVTFFFEDGCFVLPESFYDFKSCFGLHFDN 856

Query: 1059 LIIDFRNCDYYLDLLATLNGTSFKRCIRKNQNDIFELVHNNAIKNLEEHGSVSNISIHGH 1118
            +  D R   YY DL  ++N T  KR    + N +F++  +N        G +S  +IH H
Sbjct: 857  ITFDMRYLSYYADLAFSMNSTYIKRYPDVSSNSVFDVCGSNPFITSNYDGYLSEFNIHIH 916

Query: 1119 RMYGAPPTSPSYFSDWAVDVNNLSINSDIYFIRGFISYITKVGFEFSNLQNILLYDESVL 1178
            RM+G PP   +Y     V +  LS  SDI  ++GFI +ITK  F F N +++L Y+ +  
Sbjct: 917  RMFGLPPAEETYLFKIDVSLGYLSFESDIEALKGFIQFITKFSFGFDNFEDVLHYEMARS 976

Query: 1179 DNMTSVTVHGTGIDILVADKSTSAQVLLNMDGITFNRINFANDRYSSRIDLQVPGLHFAF 1238
             +++ ++     I I + +  T+  + L++  ++   ++F   +YS R ++ +P   F  
Sbjct: 977  FDISCLSFFADDISIRLNNIDTNKFISLSIPNVSLKLLDFGTSKYSLRANIDIPNFDFLV 1036

Query: 1239 FDNGSSMD--KTCLFEFKTKINFTNFTQMKDGELHSKKQQEFIALNDSAFHRCSFLLLPH 1296
                SSMD     L    T I+F  F++  D +  +  Q + I L+D+ F RCSFL    
Sbjct: 1037 ----SSMDDHNIVLGTISTSISFAIFSRNPDFKTTNNLQTQHILLSDAPFCRCSFLHPQE 1092

Query: 1297 IQESLLYHELYGGITXXXXXXXXXXXXQAETIAFIIDDFLGP-FGINSTELLGSISTSTP 1355
             Q S LY  LY  I                    I ++ LG  +    +E    IS  T 
Sbjct: 1093 YQTSDLYKLLYASIPPSSSIPLLPEPIGPNNFDTIFENLLGDIYQDYISEGTFDISNDTK 1152

Query: 1356 IHXXXXXXXXXXXXVIHPIESMQSHLVPSQSV-----TH--GNYIIDISYITLDINPLFF 1408
            +               H   S   H   + ++      H   +++ ++ +I +DI+    
Sbjct: 1153 LQLNIDEFKK------HSENSFSKHKTKNLTIDIVDELHEVRSFVFELPHINIDIHIDVL 1206

Query: 1409 TYASNFLDEFYSENIIETIDGIEMAIVNRLGTKSEELDSVTNIKLQIKYLDFFFGQRNTE 1468
               ++   +  +  I +TIDG+ + IVN          SVT  K+    +DF        
Sbjct: 1207 EVFADLYRQLTTFTISDTIDGLGVDIVNNFSKTFFGASSVTEAKVVCPRIDFRLRMYEYY 1266

Query: 1469 GLE----LYVDQI-----DLEVSQKTFQKKSTVVLDEIAILSRFLSLRASINEKKVLEDF 1519
             LE     +V  I     +L + Q+  ++ +   ++    LS +    A IN K + ++ 
Sbjct: 1267 ALEDVKHYFVSDINKLDLNLRLRQEYDKESANSEMNSKNKLSVYYK-TALINGKMLSKEN 1325

Query: 1520 DERPPALS-----LALEGWEGWSSTASSQVNSLNISSTDITVDESQIEWLIDYLNRLVVF 1574
               P   S        E  EG++      V   N+    + +++   + + +++  L + 
Sbjct: 1326 FIYPSESSEFSYKSTFEELEGYAFYDDDLVTDANLQRGCVFINQEHSDSISEFIKTLYLK 1385

Query: 1575 VHELVNSLDSIQKKSNGIQKKLVSDLTLASEYYQISHDPYVITKPAYVMRVSKGHVRQNR 1634
             +  + S+   +  +  ++++L+  +  A + Y I HDP VITKPA + R+S+ HVR++R
Sbjct: 1386 FNTFIKSVTISKNFNKSMKRELLIRIAQAGQDYGIQHDPPVITKPAVITRLSRHHVRESR 1445

Query: 1635 SWRIVTRLRHIYTYLPDDWEIHVQEEMRGKDMNDVSDSSDIFLTVFSNWRNWEVSDVARS 1694
            SWRIVTRLRH+  YLP  W      E++        D+   FL +F+ WR+WE +DV R 
Sbjct: 1446 SWRIVTRLRHVLNYLPQYWYETTSLELQKGKFRSEEDAKLQFLDIFTRWRSWEFADVERC 1505

Query: 1695 YIYKKIFLSNDET 1707
            ++YKK ++  + T
Sbjct: 1506 FLYKKTYIPAEVT 1518

 Score =  112 bits (279), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 54/173 (31%), Positives = 91/173 (52%), Gaps = 13/173 (7%)

Query: 4   EPKFVSVSLSREKYFSWVFLVTWILTCILCLLMFFYIDRVFAYSLTFILDWLLWRPYKVK 63
           + +F ++ +  E+ F WVFLV W    ++ +   FY+ R   Y +T IL+W++W+ YKV 
Sbjct: 4   QTEFEAIQVPYERRFGWVFLVNWAQLILINVFTTFYLWRAIGYIVTKILNWVIWKRYKVV 63

Query: 64  IHCEXXXXXXXXXXXXFKNLCIITENSTISILEGKIIWQYWLLNTRVSAYELHQQQKEHG 123
           I+ +            FKN+ I   + TISIL+G   W+YWLLN R +  +         
Sbjct: 64  INIQSLGFSIIGGKVYFKNISITDRDQTISILKGTFTWRYWLLNPRPTQLK--------- 114

Query: 124 YITPGSGFKNIQLPCKFLFQCEGAEIFVYNKTSAYENIIDSFSPDEKIKYKEF 176
                S   +    C+F  +C+G E+F+YNK + YE+I++  +  +K   ++F
Sbjct: 115 ----NSNINDENSKCRFKLECDGVELFIYNKIAVYEDILNELAKSDKDSSRKF 163

 Score =  106 bits (264), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 65/187 (34%), Positives = 99/187 (52%), Gaps = 13/187 (6%)

Query: 298 LNFYPFGLKLTKGSIIFGNKFTPSLLIISYKSAEGIVDVLPATNPRVDLYKMKMKLDFQN 357
           L+F P  + L+ G+++ GNK TPS+ II Y   EGI+DV   T+  +D YK++ + +  +
Sbjct: 212 LDFLPAEVILSSGAVVVGNKHTPSVAIIQYARIEGIIDVAGPTS-NLDQYKLRSEFELSS 270

Query: 358 FEIEVKPNISYEDDSKPKAFYCDSMLSRLWTKFSTLFDIMPNPLSRYIHFSRLHKNSLFL 417
             + VKPNIS+ + S  K    D     LW K   L D +   +S  + F+   K     
Sbjct: 271 TRVSVKPNISFGNGSSSKKHKIDGKPFNLWQK---LKDCLLFTISHILAFTGNKK----- 322

Query: 418 EDNIFEDEDFEKKWKGLSLYKDAALNRGNPEEHIEFDFLNHEYARYCSIVKAPRLIFTNE 477
              +   E+F   WKGL++Y  A  +  + E  I FD  NHEYA+Y +I+ A R+     
Sbjct: 323 --GLTGQEEFLTSWKGLAMYDVATSDTFSDE--IPFDLQNHEYAKYTTILNADRIKLLYS 378

Query: 478 YDIPGIV 484
           YD PG++
Sbjct: 379 YDTPGVI 385

>KLLA0F19096g Chr6 complement(1762215..1770986) [8772 bp, 2923 aa]
            {ON} similar to uniprot|Q12150 Saccharomyces cerevisiae
            YLR087C CSF1 Protein required for fermentation at low
            temperature
          Length = 2923

 Score =  584 bits (1505), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 362/1100 (32%), Positives = 585/1100 (53%), Gaps = 59/1100 (5%)

Query: 2071 LQDERITIESFQE-----LKKLKKIFFSNAKNVKKLNNDVPKEDTPTKWALELNINYFGI 2125
            L D R+ IE   +     + +L KIF    KN    N     +  P   + ++N  Y G+
Sbjct: 1851 LSDNRVYIEELTDSLNGTVSELIKIF----KNKNADNEPAAPKFKPC--SFKMNAIYIGL 1904

Query: 2126 LLPIASTFFVLELHMLLGSLTNTTEEIQEV---NNQISGQISLENILFLI-NDRSLPLRL 2181
            L  + +T +VLE +    S  +  E ++E    +N     + ++N+  L+ N   LP  L
Sbjct: 1905 LTDLKTTNYVLEFNETAFSCASRAEALEETHANDNLREMSLVIQNVCILVLNPEVLP-TL 1963

Query: 2182 SKLVDFSIRISTLQKTTSSYESLQIESSHFRMCFSPESLVFVLWGVKQLQNELEYYKDHK 2241
            SK+ D    +  ++      ++LQIE+ H R+  +P +L+ V++ +++ +  L+  K   
Sbjct: 1964 SKIFDIGFALKLIEDDIK--KTLQIETPHSRVMLAPSTLIAVIFFIQEAKVSLQKVKQ-- 2019

Query: 2242 TKRQWNLXXXXXXXXXXXXXXPLNYFRSIHILSYNFCIGWMLPENQKDIPGWMFGYDRLF 2301
             K ++N               P     S++ILS   C+GW+  E+  D  G + GY+ LF
Sbjct: 2020 -KGKFN------SSSNAIEIPPYFETLSVNILSNKLCLGWIFEEDT-DENGIVIGYESLF 2071

Query: 2302 SAYEKNYGKLTLIEGYMSVTNSNSSNDFF-SQGEEKNRHNRSFLPSMQILYWLKEFNSKK 2360
            +AYEK YGKLT+++GY++      SN+FF + G  +   NRS L SMQI +W      +K
Sbjct: 2072 AAYEKPYGKLTIVDGYVATAQGKESNNFFFANGVPE--LNRSHLSSMQINFWFSGQFIEK 2129

Query: 2361 DLFIRLHGDALDVDILSNFVNIIELIFKSYQIFEDFRKSKIVQNIEKQKHHEHIKSENAT 2420
            DLF+R++ D LDV IL+  V I+ ++  S + F+  +K   + NI+K     H  +EN +
Sbjct: 2130 DLFVRMNADKLDVRILTTSVEIVNVMRSSIESFQ--KKLAKISNIKKSSISTHNVAENLS 2187

Query: 2421 EFVPTFLSDINSINCEFKYEGGTLRVFSVDDVEIDS-TPSLELNAPKVSIYLNYKHFDDS 2479
            + V      I SINC  KY GG + +++ DD+  DS   SLEL +P + + L+Y H   S
Sbjct: 2188 DKVSIL--SIRSINCIAKYGGGIINLYTPDDIAQDSPKSSLELTSPSIEVSLDYMHNFPS 2245

Query: 2480 PKPHWLRCVIDIHSSHNILYSKCAPFVIEFVESIQEILENRPVEPKQSVSKIA--TPNRT 2537
             K HW+R ++++ S+HNIL+S C P ++     IQ+ +E    E KQ V K    T N  
Sbjct: 2246 QKQHWIRSLVNVESTHNILFSSCVPVLVNLTTEIQKQMERFNSEKKQLVHKTQEQTTNTQ 2305

Query: 2538 -----YKRILAPFDIAFRIKAAKQMLSFSCEPSAKVQANVGLDSFLFGISTGGSSVEDPL 2592
                 YK +    D A  I    Q ++ +CEP AK+QA++G  +F   + T      +PL
Sbjct: 2306 RISFDYKNLFKKIDTAIVINVGAQNITLTCEPRAKIQADLGFSNFRISMFTDSPDHSEPL 2365

Query: 2593 SLTLCINKISTSVQHIFSKEASASFSLNFIDLTFIFTQPTL---YCVGLISDIDIFFNMK 2649
            SL+L  ++I  S +HIFS+E S+S  +N + L F+ T       Y   LISD+  + NMK
Sbjct: 2366 SLSLQWSEIEISTRHIFSREISSSAGINEVYLDFMLTHENTIKTYGNTLISDMKFYVNMK 2425

Query: 2650 QQQNLLLFLDIW----HLSESIGIRPNXXXXXXXXXXGHTQIPETPQPGKIIPWNFNIIF 2705
            Q Q + LFLDIW      ++ +G  P+               P+       IPW + IIF
Sbjct: 2426 QLQEITLFLDIWSPKTKKAQKLGSGPHSGQKCQPQALTEFTTPK-------IPWIYQIIF 2478

Query: 2706 TNVNADIHLGPALGIVSAKLEKTWFISDRYLDKRQILQLFTDGMVLKSRGRLSGMLDISN 2765
             N +A I + P+LG ++ K+   W  S   +D    +  + D +  KS GRL G+ +I N
Sbjct: 2479 KNTSAVIDMDPSLGSINFKVPTFWISSHHRVDWSHSVSFYLDELNSKSDGRLGGLFEIKN 2538

Query: 2766 AGWRLEVNYADNELNYNSPIVAIGIDIGCVALKTAFDYHMFMISKVNNIHFRLHSERDPE 2825
              +   +++   +  + +P++ +   +  ++ K  FDYH F+I++V+++   + +ERD  
Sbjct: 2539 IFFDSSISWPVKDNKFEAPLINLAFKMSHLSSKIGFDYHSFLIARVSDLQLAIRNERDES 2598

Query: 2826 GKLPDXXXXXXXCEEISICSTTLVASNILDIYNTIIRTRQDTKNSYFETLMESNNQDT-R 2884
            G L D          ++I  T L ++N+ DIY T  R R + K SY +TL ESN + + +
Sbjct: 2599 GLLKDLLIVSMSFGSVNIFLTALASANLYDIYATFARMRIENKKSYVQTLKESNPESSGK 2658

Query: 2885 TNIPYSDILKSLNLLRTDVQIDVSKLQLQISPISLFDFEVLVINIDNMSARSETTSTDKL 2944
             +   +++L  L L RT++  ++   +L + P +LFD EVLV+  + M+  + T +  K 
Sbjct: 2659 IHFSNNELLAPLRL-RTNLTAEIGSFRLYVFPSTLFDSEVLVLKANKMNVEAATQTEQKT 2717

Query: 2945 KTRLELQVCNASVALSTAKEELDEESVNKISVADYMTYASKIKGGTILIIPKLLVGMTTW 3004
            KT L  Q+ + +++L+  K EL EE   ++SV +Y   A+ ++G  IL  P + VG+TTW
Sbjct: 2718 KTDLTWQIRDINISLAQFKNELTEEQFAELSVEEYNRQAALLEGDIILAAPSVFVGITTW 2777

Query: 3005 QKVTSNTIEYTFTCKFDGKVSVRWNLGPVNFIKEMWATHVKSLAVRQARXXXXXXXXXXX 3064
            QK+    IE+ ++  F  KV ++WNL P+NFI+EMWATHV++L+VR+             
Sbjct: 2778 QKIPDTDIEFLYSSSFGDKVDIKWNLDPINFIREMWATHVRALSVRRGHTEPSPSKPFFE 2837

Query: 3065 XXXXXXXXXXXPAQPKFTYVALVEPSIEMPQIKDLEDATPPMEWFGLNRKKFPSFTHQTA 3124
                           K+ Y+ L EP IEMP ++DL +ATPP+EWFG+NRK+FP   HQ  
Sbjct: 2838 DENIAEKIKIVNLGTKYKYIPLEEPHIEMPLLRDLGNATPPIEWFGVNRKRFPGMAHQLI 2897

Query: 3125 VIVVQKLVHAVEKEYAKIIG 3144
            V+ +QKL++  E +Y + +G
Sbjct: 2898 VVPLQKLIYVAEDQYNRTLG 2917

 Score =  533 bits (1374), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 365/1194 (30%), Positives = 591/1194 (49%), Gaps = 89/1194 (7%)

Query: 595  PESNMEFQLFDASINYGPWAHRNIMNIQRIFSPIVSRTPELQPDPEPGFLRRYTMTKISV 654
            P    +  ++ A++ YGPWAH+++ +I R+FSPIVSR       PEPG LR Y   K+SV
Sbjct: 408  PAFGTDIHIYTAAVYYGPWAHKHMQDIIRLFSPIVSRDQMKATKPEPGSLRIYENFKLSV 467

Query: 655  SIMEDSSWRVPTREPSKDQDFLKRYMKTNDSSRSFGWFDLNFSRNSEATFCISSIPDVNG 714
               + S   +PTRE SKD++F+KRY  T D+ R+FGW +++ +   E  F ++     + 
Sbjct: 468  DFRDKSVLHIPTRESSKDEEFIKRYKTTGDTHRAFGWLNVSLNEGGEILFNLALCSQADR 527

Query: 715  YANKLNLDFKDLEVRSSVNHDIFFRSKSYRVDSDIGYPLGWNDEVTWSFVFDSYQLETFF 774
              N+L +   + E++SSVNH++ FR  +  + ++IGYP GWN +  W F  DS   E F 
Sbjct: 528  LPNELYVLLLNPEIKSSVNHEVLFRCNTQTIKANIGYPTGWNKQADWLFELDSRTAELFL 587

Query: 775  LREHLVLIADTFSDFSSGEPTPYEFFRPSIYKVDWNFHGYSAYLNVNDHNIINNPLDFNE 834
            LR+H+ LI+D F+DFS+ +   YE FRP  Y++ W F  Y  +LNVND NIINN LD NE
Sbjct: 588  LRDHISLISDLFTDFSANDALRYELFRPFTYEIKWVFTEYKLFLNVNDANIINNLLDLNE 647

Query: 835  NCYISVHGDDAHIGVEIPRLGITATYTDIIFQISTPMFRXXXXXXXXXXXXEFMRNKEIG 894
            NC++S+ GD  +  + +P   I     +  F + +P+ +            EF+     G
Sbjct: 648  NCFLSLSGDILNTSINLPFTSIVKEPHETTFLLKSPLVKLSIHPPCWNTLHEFLSETTFG 707

Query: 895  RGYDFTAEGSYIIYSDLDIDNVDSLTIECSTRRMTLLTYGFVIGYLLNVQMNYFGEFSHF 954
               DF+  G+YI +  +D+DN D++ I+  +     L++GFV+ YL+N+++NYFG+F+HF
Sbjct: 708  ECPDFSMTGTYISFPSVDVDNTDTILIDFRSSSTKFLSFGFVLRYLMNIKLNYFGDFNHF 767

Query: 955  ITAEEYTDIVRGNDNDIVSTLADFXXXXXXXXXXXXXXXQHNPDNSSKS----------N 1004
             T EEY++ +   + D  +   +F               Q  P N  +S           
Sbjct: 768  KTTEEYSNDL-SMEEDTKTKTKNF---------------QEQPTNDVESLTSSSSDGSYQ 811

Query: 1005 IIDPLYNPPLRKDDIKRKVNETDIWFTFSVWEGALLLPEVLYNSDPCIALSFKELIIDFR 1064
            + D +    + K  + R  NETD+W TF V +G +++PE LY+      LSF+ L  D R
Sbjct: 812  VADTINENTIHKSSLLRTKNETDVWITFFVNDGCIIIPENLYDCQRSFLLSFRRLEFDMR 871

Query: 1065 NCDYYLDLLATLNGTSFKRCIRKNQNDIFELVHNNAIK--NLEEHGSVSNISIHGHRMYG 1122
              +Y++DL      T+F   I  N ++ F      AI+  + E  G + ++++HGHRM+G
Sbjct: 872  YTNYFMDL------TAFFSRIYLNHSNEFSFNRVVAIEESHSENTGYLDDLNLHGHRMFG 925

Query: 1123 APPTSPSYFSDWAVDVNNLSINSDIYFIRGFISYITKVGFEFSNLQNILLYDESVLDNMT 1182
             PP   +Y   W + + +LS +SD  F+  F+  I KVGF + + +NIL+Y     +++T
Sbjct: 926  VPPVEETYLCKWDISIGSLSTDSDGQFLFSFLEAIQKVGFTYKDAENILIYSIHKPEDVT 985

Query: 1183 SVTVH-GTGIDILVADKSTSAQVLLNMDGITFNRINFANDRYSSRIDLQVPGLHFAFFDN 1241
            S+T+  G    I+  +   SA + LN   IT N  + +N RYS R+DL V  +     D 
Sbjct: 986  SLTISIGRVSSIVRTNHGGSATLSLN--DITINSWDLSNSRYSKRVDLLVAAISVCAIDE 1043

Query: 1242 GSSMDKTCLFEFKTKINFTNFTQMKDGELHSKKQQEFIALNDSAFHRCSFLL-LPHIQES 1300
                 KT LF   T +  T F    + + H   QQ  + LNDS FHRC FLL    +  S
Sbjct: 1044 ----KKTVLFTCDTAVELTKFVVRSNMKNHRVTQQNCVLLNDSPFHRCKFLLAFDQLNHS 1099

Query: 1301 LLYHELYGGITXXXXXXXXXXXXQAETIAFIIDDFLGPFGINSTELLGSISTSTPIHXXX 1360
             LY +L G IT              +T   I +  LG + IN       I     I    
Sbjct: 1100 TLYDDLLGSITPSISLPTLSEPLTFQTFDNIYERLLGSY-INLINFDTDI-----IDTKN 1153

Query: 1361 XXXXXXXXXVIHPIESMQSHLVPSQSVTH---GNYIIDISYITLDINPLFFTYASN---F 1414
                      + P+ +  S+ +  Q        N  ++IS +++ + P  FT+A N   F
Sbjct: 1154 LTDDRPDDKRLLPLSNTVSNDLSGQLAEEFESENTTVNISTLSVFVTPKAFTFAENAAHF 1213

Query: 1415 LDEFYSENIIETIDGIEMAIVNRLG----TKSEELDS---VTNIKLQIKYLDFFFGQRNT 1467
            +    +E+I   +D  EM IVN       T  +  +S   + N+K+ I   +    +   
Sbjct: 1214 MLTMSTESI---MDYFEMNIVNIFSVGHITNGKFFNSSVMLKNVKVNISD-ETALDKTQL 1269

Query: 1468 EGLELYVDQIDLEVSQKTFQKK-------------STVVLDEIAILSRFLSLRASINEKK 1514
            E L    D+++L VS  +   K             ST + D+  I   F SL+ +I  K 
Sbjct: 1270 EAL----DRLELSVSNISVISKILKYPQNLEQSNESTGITDDSTISCNFDSLQFNIF-KS 1324

Query: 1515 VLEDFDERPPALSLALEGWEGWSSTASSQVNSLNISSTDITVDESQIEWLIDYLNRLV-V 1573
                  +  P     +  +     +   +V+ L   S    + ++ +EW ++YL +L   
Sbjct: 1325 SKNRLTKVLPIAWFEILMFNTVLFSDVGKVSKLIFGSIKSAILDADVEWTVEYLLKLAKA 1384

Query: 1574 FVHELVNSLDSIQKKSNGIQKKLVSDLTLASEYYQISHDPYVITKPAYVMRVSKGHVRQN 1633
            F  E  + ++  + +S  +++ ++    L  +   I   PY+ITKPAY+ R+SK HVR  
Sbjct: 1385 FCKEGKSCIELGKLRSIDMKETIIRVAELG-KISGIDSVPYIITKPAYITRLSKFHVRDT 1443

Query: 1634 RSWRIVTRLRHIYTYLPDDWEIHVQEEMRGKDMNDVSDSSDIFLTVFSNWRNWEVSDVAR 1693
             SW+I+TRLRH+  +     E   Q +   +++ ++      FL +F +W+NW+V +V +
Sbjct: 1444 ASWKIITRLRHVSKHTSHVSETTSQCDDIPEEVRNICKDKSQFLDIFVDWKNWDVYEVEQ 1503

Query: 1694 SYIYKKIFLSNDETTSEKKLQTTVKLNLNSIFFTIYSTGYAIDHNIILTKAVIL 1747
            S ++  +F S + T  E+ L   + L+L  +   +    YA   + I+ K + L
Sbjct: 1504 SSLFTLLF-SGESTVHEEDLFNELSLSLEMLHLEL---PYAPQQSSIIAKQIDL 1553

 Score =  137 bits (345), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 65/156 (41%), Positives = 93/156 (59%), Gaps = 8/156 (5%)

Query: 7   FVSVSLSREKYFSWVFLVTWILTCILCLLMFFYIDRVFAYSLTFILDWLLWRPYKVKIHC 66
           F  +S+S EK  S  FLV WIL  ILC+L  FY+ R+ A+ LT  LD+ +WR YK+KI+ 
Sbjct: 7   FRPISISDEKDLSVPFLVDWILAVILCILAPFYLGRILAWVLTKGLDFWVWRQYKIKINL 66

Query: 67  EXXXXXXXXXXXXFKNLCIITENSTISILEGKIIWQYWLLNTRVSAYELHQQQKEHGYIT 126
           +            FKNL +++ + TIS LEG   W+YWLL+TR+   +   +        
Sbjct: 67  QSIKVSFLGGRIFFKNLTVVSNDFTISFLEGSFTWRYWLLHTRIRGIDFESED------- 119

Query: 127 PGSGFKNIQLPCKFLFQCEGAEIFVYNKTSAYENII 162
            G   +N +LPC+FL QC+G E+FVYNK   YE+++
Sbjct: 120 -GDASENAKLPCRFLLQCDGLEVFVYNKIDVYESVL 154

 Score = 81.3 bits (199), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 50/187 (26%), Positives = 93/187 (49%), Gaps = 17/187 (9%)

Query: 300 FYPFGLKLTKGSIIFGNKFTPSLLIISYKSAEGIVDVLPATNPRVDLYKMKMKLDFQNFE 359
            +P  L+  + +I+ GN+ T  + +  ++ A+G+ D+  + +  +D Y+ K+ LD  +  
Sbjct: 213 LFPIQLEANRAAIVLGNRNTRHVGVFKFEQAKGVYDIFSSISD-LDYYRTKISLDLYDAL 271

Query: 360 IEVKPNISYEDDSKPKAFYCDSMLSRLWTKFSTLFDIMPNPLSRYIHFSRLHKNSLFLED 419
            E++ N+ Y++D+  K F  +  + ++W               + I  S+L   +     
Sbjct: 272 FELRTNLGYQNDNPIKTFVVEKTMDKIWQTVK----------KQCISISKLLLPNQ--GK 319

Query: 420 NIFEDEDFEKKWKGLSLYKDAALNRGNPEEHIEFDFLN-HEYARYCSIVKAPRLIFTNEY 478
            I   + +   WKGL LY      +   EE+++   L+  EYARY  ++KA R+  T  +
Sbjct: 320 TINNQQAYIDSWKGLDLYHHT---KAVQEENVDTTVLHEQEYARYSRVMKAERVSLTYYF 376

Query: 479 DIPGIVP 485
           DIPGIVP
Sbjct: 377 DIPGIVP 383

>Kwal_56.23808 s56 (712095..712280) [186 bp, 62 aa] {OFF} YLR087C
          (CSF1) -  [contig 173] PARTIAL
          Length = 62

 Score = 57.4 bits (137), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 26/59 (44%), Positives = 37/59 (62%)

Query: 6  KFVSVSLSREKYFSWVFLVTWILTCILCLLMFFYIDRVFAYSLTFILDWLLWRPYKVKI 64
          +F  V +S  + FSWVFL  W+L   + LL  FY  RV  Y++T IL++L W+ Y VK+
Sbjct: 4  EFRRVPISTAQDFSWVFLTDWVLILSVSLLSAFYFGRVLGYTITTILEYLAWKRYGVKV 62

>Smik_4.541 Chr4 complement(974729..976594) [1866 bp, 621 aa] {ON}
            YDR292C (REAL)
          Length = 621

 Score = 35.4 bits (80), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 29/53 (54%), Gaps = 3/53 (5%)

Query: 2618 SLNFIDLTFIFTQPTLYCVGLISDIDIFFNMKQQQNLLLFLDIW---HLSESI 2667
            S +F  L ++  QP LY V   ++  I  N + QQ L L L +W   HLSESI
Sbjct: 70   STSFNALFYLNKQPELYFVVTFAEQTIELNQETQQTLALVLKLWNSLHLSESI 122

>KLTH0H06710g Chr8 (590346..591830) [1485 bp, 494 aa] {ON} similar to
            uniprot|P53170 Saccharomyces cerevisiae YGL059W
            Hypothetical ORF
          Length = 494

 Score = 34.7 bits (78), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 34/64 (53%), Gaps = 9/64 (14%)

Query: 2371 LDVDILSNFVNIIELIFKSYQIFEDFRKSKIVQNIEKQKHHEHIKSENATEFVPTFLSDI 2430
            L  D+++NF +  ++    Y IFE FR+   ++ IE         +E   EF+ T LSD 
Sbjct: 136  LPFDVVNNF-HFCQVYESYYNIFERFRRYPAIKTIED--------NEKFAEFLHTILSDF 186

Query: 2431 NSIN 2434
            NS+N
Sbjct: 187  NSLN 190

>CAGL0J11022g Chr10 (1075366..1076025) [660 bp, 219 aa] {ON} highly
            similar to uniprot|P47822 Saccharomyces cerevisiae
            YDR308c SRB7
          Length = 219

 Score = 33.5 bits (75), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 49/92 (53%), Gaps = 8/92 (8%)

Query: 1499 ILSRFLSLRASINEKKVLEDFDERPPALSLALEGWEGWSSTASSQ--VNSLNISSTDITV 1556
            ++ +F +    I+++   E F+++ P ++      +  +S A+ +   N ++  STDI V
Sbjct: 15   VMEQFCATLNFIDKRHDFEPFNDKEPKMT------DKHASVATPEEFSNGIDELSTDIIV 68

Query: 1557 DESQIEWLIDYLNRLVVFVHELVNSLDSIQKK 1588
               QI  LID L  + V   E ++ +DS+QKK
Sbjct: 69   KIRQITTLIDSLPGVGVSAEEQLHKIDSLQKK 100

>YDR292C Chr4 complement(1043146..1045011) [1866 bp, 621 aa] {ON}
            SRP101Signal recognition particle (SRP) receptor alpha
            subunit; contain GTPase domains; involved in
            SRP-dependent protein targeting; interacts with the beta
            subunit, Srp102p
          Length = 621

 Score = 33.9 bits (76), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 29/53 (54%), Gaps = 3/53 (5%)

Query: 2618 SLNFIDLTFIFTQPTLYCVGLISDIDIFFNMKQQQNLLLFLDIW---HLSESI 2667
            S +F  L ++  QP LY V   ++  +  N + QQ L L L +W   HLSESI
Sbjct: 70   SPSFNALFYLNKQPELYFVVTFAEQTLELNQETQQTLALVLKLWNSLHLSESI 122

>CAGL0I02090g Chr9 complement(177324..180734) [3411 bp, 1136 aa] {ON}
            some similarities with uniprot|P38853 Saccharomyces
            cerevisiae YHR158c KEL1 involved in cell fusion and
            morphology
          Length = 1136

 Score = 33.9 bits (76), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 41/83 (49%), Gaps = 9/83 (10%)

Query: 2125 ILLPIASTFFVLELHMLLGSLTNTTEEIQEVNNQISGQISLENILFLINDRSLPLRLSKL 2184
            +LLP       ++ HM  G+   T     ++++Q +   S  N+   + DR  P +L + 
Sbjct: 690  VLLP------EIKKHMSEGTEAKTVTHSSDMDDQTTMISSRHNV---VEDRQSPPQLKEA 740

Query: 2185 VDFSIRISTLQKTTSSYESLQIE 2207
            VD  I   TL+ T+++ E  Q+E
Sbjct: 741  VDMKIDSPTLEDTSANLERAQVE 763

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.136    0.404 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 325,174,599
Number of extensions: 14679195
Number of successful extensions: 46369
Number of sequences better than 10.0: 61
Number of HSP's gapped: 46879
Number of HSP's successfully gapped: 119
Length of query: 3148
Length of database: 53,481,399
Length adjustment: 128
Effective length of query: 3020
Effective length of database: 38,804,151
Effective search space: 117188536020
Effective search space used: 117188536020
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 75 (33.5 bits)