Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0E044108.259ON1422142266390.0
TDEL0F038608.259ON1399136833330.0
NCAS0B050008.259ON1409138033170.0
Kpol_392.88.259ON1427145032540.0
Smik_12.1458.259ON1418144732340.0
Skud_12.1548.259ON1417144932160.0
YLR086W (SMC4)8.259ON1418139032130.0
Suva_10.1708.259ON1416146532010.0
SAKL0H17094g8.259ON1422146031970.0
KAFR0B027108.259ON1416138631880.0
ZYRO0C01716g8.259ON1413137731390.0
AGR089C8.259ON1370137630980.0
NDAI0B019708.259ON1415137230710.0
Kwal_56.238258.259ON1396140930580.0
TPHA0J007208.259ON1393138930130.0
Ecym_43118.259ON1376137830100.0
KLTH0G13750g8.259ON1399145629800.0
KNAG0G020208.259ON1444138329780.0
CAGL0L12188g8.259ON1398138128090.0
KLLA0F19085g8.259ON1372141127810.0
CAGL0F02079g8.68ON12237404897e-49
NDAI0G033208.68ON12317714531e-44
ZYRO0F03828g8.68ON12177654494e-44
TDEL0C009608.68ON12228114074e-39
NCAS0C040008.68ON12233063977e-38
TPHA0P003408.68ON12193033888e-37
YFL008W (SMC1)8.68ON12252943762e-35
TBLA0G035308.68ON12323103735e-35
KNAG0G009108.68ON12263043726e-35
Suva_6.528.68ON12642943717e-35
Skud_6.648.68ON12302923653e-34
Kpol_1011.58.68ON12213213582e-33
Smik_6.718.68ON12281633582e-33
Kwal_23.50438.68ON12251643573e-33
KAFR0C032008.68ON12231633458e-32
KLTH0A02706g8.68ON12281633432e-31
KLLA0D07502g8.68ON12432143394e-31
SAKL0B02288g8.68ON12282123323e-30
Ecym_73038.68ON12222573233e-29
AGL023W8.68ON12221733101e-27
TDEL0H026107.186ON11702152591e-21
ZYRO0D15642g7.186ON11701832572e-21
AGR236W7.186ON11701832544e-21
NDAI0G020707.186ON11711832482e-20
Kwal_55.204217.186ON11701832482e-20
SAKL0F07282g7.186ON11701842464e-20
KLTH0E04774g7.186ON11701832455e-20
KAFR0G029307.186ON11701832439e-20
NCAS0E019207.186ON11701832421e-19
KNAG0L011607.186ON11701832393e-19
CAGL0D05258g7.186ON11701832393e-19
Kpol_1063.207.186ON11711992393e-19
Smik_7.3467.186ON11701992383e-19
KLLA0D16005g7.186ON11701832375e-19
Suva_6.1047.186ON11701832375e-19
YFR031C (SMC2)7.186ON11701832366e-19
Ecym_43907.186ON11701842341e-18
Skud_6.1197.186ON11701832332e-18
TBLA0D046107.186ON11741832294e-18
TPHA0C044407.186ON11701842294e-18
KLLA0A00286g1.295ON12242992116e-16
NDAI0G056301.295ON12292972053e-15
Kpol_1018.21.295ON12112792018e-15
Kwal_14.24351.295ON12472132001e-14
TPHA0I010901.295ON12163051982e-14
TDEL0D016201.295ON12232001973e-14
Smik_10.1671.295ON12292581964e-14
NCAS0A093301.295ON12273121954e-14
Suva_6.1491.295ON12301991946e-14
YJL074C (SMC3)1.295ON12301991929e-14
KAFR0A016101.295ON12272291929e-14
Skud_10.1701.295ON12301991911e-13
ZYRO0G21296g1.295ON1227961911e-13
SAKL0D06116g1.295ON12293141864e-13
CAGL0H02805g1.295ON12191971831e-12
Ecym_63221.295ON12322111784e-12
KLTH0H09966g1.295ON12242021703e-11
TBLA0C027401.295ON11191361686e-11
AAL182W1.295ON1231961687e-11
KNAG0B052301.295ON12251961687e-11
KNAG0L006307.101ON11081921221e-05
SAKL0B09526g7.101ON10991621169e-05
Ecym_26257.101ON10973871122e-04
AEL337C7.101ON10971811104e-04
ZYRO0G01584g7.101ON10881851104e-04
ZYRO0B12122g4.237ON1109781095e-04
KLLA0F07997g7.101ON11191891088e-04
Kwal_26.72047.101ON11171621078e-04
NCAS0I005707.101ON10952311079e-04
TDEL0E013404.237ON1106851070.001
NCAS0J013904.237ON1096681040.002
Skud_12.4684.237ON1120681030.003
NDAI0J021804.237ON11081071030.003
Smik_12.4704.237ON1114681030.003
Suva_10.5004.237ON1115681030.003
YLR383W (SMC6)4.237ON1114681030.003
CAGL0H05071g4.237ON1110761010.005
Ecym_53444.237ON1102651000.005
Skud_15.1217.101ON1093961000.006
TDEL0H034907.101ON110385990.008
KLLA0E05303g4.237ON109892990.008
Kpol_483.104.237ON111882990.009
TBLA0I028904.237ON109871970.012
TBLA0E021907.101ON108969970.014
Suva_15.1337.101ON1092202970.015
TPHA0L006007.101ON111770960.016
KAFR0D013307.101ON108077960.019
NDAI0A084507.101ON111942960.020
AER044W4.237ON110365950.024
Smik_15.1317.101ON109342940.027
YOL034W (SMC5)7.101ON109342940.029
TPHA0B008404.237ON111968940.033
KAFR0A060404.237ON1102125930.037
KLTH0D02816g7.101ON1094165930.040
TBLA0I009107.441ON113992920.050
KNAG0B060104.237ON111768920.056
Kpol_1044.137.101ON110342910.067
SAKL0H03322g4.237ON111165900.087
CAGL0F01155g7.101ON1105131900.10
TBLA0A053001.67ON70776870.16
Kwal_26.93804.237ON110285870.21
KLTH0D14080g4.237ON110265870.23
NCAS0B087001.67ON71586801.1
AFR683C1.67ON677108772.7
KAFR0B056308.303ON151581773.3
NDAI0A048303.419ON937148763.6
NDAI0D044204.238ON1914123763.7
Smik_14.3706.357ON60576745.5
Ecym_10721.67ON68397745.7
KNAG0D043404.238ON2220163746.3
KLLA0F19888g8.295ON491573756.4
ZYRO0F17050g1.67ON71467746.7
TDEL0H00150singletonON29281727.5
AFR286W5.702ON1758157747.8
KAFR0C059405.624ON415100738.2
TDEL0B021905.702ON181071738.2
Kpol_1033.288.303ON153180738.9
TPHA0B042101.110ON1303130739.5
KLLA0F15950g5.643ON46993729.7
TBLA0B037208.699ON627757210.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0E04410
         (1422 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0E04410 Chr5 (1122005..1126273) [4269 bp, 1422 aa] {ON} Anc_...  2561   0.0  
TDEL0F03860 Chr6 (709579..713778) [4200 bp, 1399 aa] {ON} Anc_8....  1288   0.0  
NCAS0B05000 Chr2 (917841..922070) [4230 bp, 1409 aa] {ON} Anc_8....  1282   0.0  
Kpol_392.8 s392 complement(19392..23675) [4284 bp, 1427 aa] {ON}...  1258   0.0  
Smik_12.145 Chr12 (282081..286337) [4257 bp, 1418 aa] {ON} YLR08...  1250   0.0  
Skud_12.154 Chr12 (285613..289866) [4254 bp, 1417 aa] {ON} YLR08...  1243   0.0  
YLR086W Chr12 (302243..306499) [4257 bp, 1418 aa] {ON}  SMC4Subu...  1242   0.0  
Suva_10.170 Chr10 (307316..311566) [4251 bp, 1416 aa] {ON} YLR08...  1237   0.0  
SAKL0H17094g Chr8 complement(1508021..1512289) [4269 bp, 1422 aa...  1236   0.0  
KAFR0B02710 Chr2 (545337..549587) [4251 bp, 1416 aa] {ON} Anc_8....  1232   0.0  
ZYRO0C01716g Chr3 complement(130331..134572) [4242 bp, 1413 aa] ...  1213   0.0  
AGR089C Chr7 complement(901437..905549) [4113 bp, 1370 aa] {ON} ...  1197   0.0  
NDAI0B01970 Chr2 (479208..483455) [4248 bp, 1415 aa] {ON} Anc_8....  1187   0.0  
Kwal_56.23825 s56 complement(721498..725688) [4191 bp, 1396 aa] ...  1182   0.0  
TPHA0J00720 Chr10 (161017..165198) [4182 bp, 1393 aa] {ON} Anc_8...  1165   0.0  
Ecym_4311 Chr4 complement(666871..671001) [4131 bp, 1376 aa] {ON...  1164   0.0  
KLTH0G13750g Chr7 complement(1184169..1188368) [4200 bp, 1399 aa...  1152   0.0  
KNAG0G02020 Chr7 (449115..453449) [4335 bp, 1444 aa] {ON} Anc_8....  1151   0.0  
CAGL0L12188g Chr12 (1310968..1315164) [4197 bp, 1398 aa] {ON} si...  1086   0.0  
KLLA0F19085g Chr6 (1758111..1762229) [4119 bp, 1372 aa] {ON} sim...  1075   0.0  
CAGL0F02079g Chr6 (201002..204673) [3672 bp, 1223 aa] {ON} simil...   192   7e-49
NDAI0G03320 Chr7 (781468..785163) [3696 bp, 1231 aa] {ON}             179   1e-44
ZYRO0F03828g Chr6 (318190..321843) [3654 bp, 1217 aa] {ON} simil...   177   4e-44
TDEL0C00960 Chr3 (153572..157240) [3669 bp, 1222 aa] {ON} Anc_8....   161   4e-39
NCAS0C04000 Chr3 (807106..810777) [3672 bp, 1223 aa] {ON} Anc_8....   157   7e-38
TPHA0P00340 Chr16 (65711..69370) [3660 bp, 1219 aa] {ON} Anc_8.6...   154   8e-37
YFL008W Chr6 (119429..123106) [3678 bp, 1225 aa] {ON}  SMC1Subun...   149   2e-35
TBLA0G03530 Chr7 complement(941941..945639) [3699 bp, 1232 aa] {...   148   5e-35
KNAG0G00910 Chr7 (172759..176439) [3681 bp, 1226 aa] {ON} Anc_8....   147   6e-35
Suva_6.52 Chr6 (91156..94950) [3795 bp, 1264 aa] {ON} YFL008W (R...   147   7e-35
Skud_6.64 Chr6 (121616..125308) [3693 bp, 1230 aa] {ON} YFL008W ...   145   3e-34
Kpol_1011.5 s1011 complement(13399..17064) [3666 bp, 1221 aa] {O...   142   2e-33
Smik_6.71 Chr6 (132627..136313) [3687 bp, 1228 aa] {ON} YFL008W ...   142   2e-33
Kwal_23.5043 s23 (978758..982435) [3678 bp, 1225 aa] {ON} YFL008...   142   3e-33
KAFR0C03200 Chr3 (643231..646902) [3672 bp, 1223 aa] {ON} Anc_8....   137   8e-32
KLTH0A02706g Chr1 complement(234723..238409) [3687 bp, 1228 aa] ...   136   2e-31
KLLA0D07502g Chr4 complement(642751..646482) [3732 bp, 1243 aa] ...   135   4e-31
SAKL0B02288g Chr2 (215750..219436) [3687 bp, 1228 aa] {ON} simil...   132   3e-30
Ecym_7303 Chr7 (638719..642387) [3669 bp, 1222 aa] {ON} similar ...   129   3e-29
AGL023W Chr7 (670877..674545) [3669 bp, 1222 aa] {ON} Syntenic h...   124   1e-27
TDEL0H02610 Chr8 (434116..437628) [3513 bp, 1170 aa] {ON} Anc_7....   104   1e-21
ZYRO0D15642g Chr4 complement(1307703..1311215) [3513 bp, 1170 aa...   103   2e-21
AGR236W Chr7 (1189845..1193357) [3513 bp, 1170 aa] {ON} Syntenic...   102   4e-21
NDAI0G02070 Chr7 (461697..465212) [3516 bp, 1171 aa] {ON} Anc_7....   100   2e-20
Kwal_55.20421 s55 (391382..394894) [3513 bp, 1170 aa] {ON} YFR03...   100   2e-20
SAKL0F07282g Chr6 complement(554459..557971) [3513 bp, 1170 aa] ...    99   4e-20
KLTH0E04774g Chr5 (426535..430047) [3513 bp, 1170 aa] {ON} simil...    99   5e-20
KAFR0G02930 Chr7 complement(609210..612722) [3513 bp, 1170 aa] {...    98   9e-20
NCAS0E01920 Chr5 (368382..371894) [3513 bp, 1170 aa] {ON} Anc_7....    98   1e-19
KNAG0L01160 Chr12 complement(206434..209946) [3513 bp, 1170 aa] ...    97   3e-19
CAGL0D05258g Chr4 (500858..504370) [3513 bp, 1170 aa] {ON} simil...    97   3e-19
Kpol_1063.20 s1063 (46233..49748) [3516 bp, 1171 aa] {ON} (46233...    97   3e-19
Smik_7.346 Chr7 complement(577634..581146) [3513 bp, 1170 aa] {O...    96   3e-19
KLLA0D16005g Chr4 complement(1346492..1350004) [3513 bp, 1170 aa...    96   5e-19
Suva_6.104 Chr6 complement(183396..186908) [3513 bp, 1170 aa] {O...    96   5e-19
YFR031C Chr6 complement(216594..220106) [3513 bp, 1170 aa] {ON} ...    96   6e-19
Ecym_4390 Chr4 (816076..819588) [3513 bp, 1170 aa] {ON} similar ...    95   1e-18
Skud_6.119 Chr6 complement(211918..215430) [3513 bp, 1170 aa] {O...    94   2e-18
TBLA0D04610 Chr4 complement(1139885..1143409) [3525 bp, 1174 aa]...    93   4e-18
TPHA0C04440 Chr3 complement(958279..961791) [3513 bp, 1170 aa] {...    93   4e-18
KLLA0A00286g Chr1 complement(22024..25698) [3675 bp, 1224 aa] {O...    86   6e-16
NDAI0G05630 Chr7 complement(1393671..1397360) [3690 bp, 1229 aa]...    84   3e-15
Kpol_1018.2 s1018 complement(5901..9536) [3636 bp, 1211 aa] {ON}...    82   8e-15
Kwal_14.2435 s14 complement(756213..759956) [3744 bp, 1247 aa] {...    82   1e-14
TPHA0I01090 Chr9 complement(252902..256552) [3651 bp, 1216 aa] {...    81   2e-14
TDEL0D01620 Chr4 complement(321963..325634) [3672 bp, 1223 aa] {...    80   3e-14
Smik_10.167 Chr10 complement(290936..294625) [3690 bp, 1229 aa] ...    80   4e-14
NCAS0A09330 Chr1 (1844122..1847805) [3684 bp, 1227 aa] {ON} Anc_...    80   4e-14
Suva_6.149 Chr6 (248275..251967) [3693 bp, 1230 aa] {ON} YJL074C...    79   6e-14
YJL074C Chr10 complement(299157..302849) [3693 bp, 1230 aa] {ON}...    79   9e-14
KAFR0A01610 Chr1 complement(326620..330303) [3684 bp, 1227 aa] {...    79   9e-14
Skud_10.170 Chr10 (316063..319755) [3693 bp, 1230 aa] {ON} YJL07...    78   1e-13
ZYRO0G21296g Chr7 (1747217..1750900) [3684 bp, 1227 aa] {ON} sim...    78   1e-13
SAKL0D06116g Chr4 complement(503196..506885) [3690 bp, 1229 aa] ...    76   4e-13
CAGL0H02805g Chr8 complement(256682..260341) [3660 bp, 1219 aa] ...    75   1e-12
Ecym_6322 Chr6 (611978..615676) [3699 bp, 1232 aa] {ON} similar ...    73   4e-12
KLTH0H09966g Chr8 complement(859362..863036) [3675 bp, 1224 aa] ...    70   3e-11
TBLA0C02740 Chr3 (656941..660300) [3360 bp, 1119 aa] {ON} Anc_1....    69   6e-11
AAL182W Chr1 (16155..19850) [3696 bp, 1231 aa] {ON} Syntenic hom...    69   7e-11
KNAG0B05230 Chr2 complement(1005244..1008921) [3678 bp, 1225 aa]...    69   7e-11
KNAG0L00630 Chr12 complement(93928..97254) [3327 bp, 1108 aa] {O...    52   1e-05
SAKL0B09526g Chr2 (805816..809115) [3300 bp, 1099 aa] {ON} simil...    49   9e-05
Ecym_2625 Chr2 (1208550..1211843) [3294 bp, 1097 aa] {ON} simila...    48   2e-04
AEL337C Chr5 complement(14613..17906) [3294 bp, 1097 aa] {ON} Sy...    47   4e-04
ZYRO0G01584g Chr7 (120582..123848) [3267 bp, 1088 aa] {ON} simil...    47   4e-04
ZYRO0B12122g Chr2 (972611..975940) [3330 bp, 1109 aa] {ON} simil...    47   5e-04
KLLA0F07997g Chr6 complement(748561..751920) [3360 bp, 1119 aa] ...    46   8e-04
Kwal_26.7204 s26 complement(263266..266619) [3354 bp, 1117 aa] {...    46   8e-04
NCAS0I00570 Chr9 complement(90806..94093) [3288 bp, 1095 aa] {ON...    46   9e-04
TDEL0E01340 Chr5 complement(265681..269001) [3321 bp, 1106 aa] {...    46   0.001
NCAS0J01390 Chr10 (242118..245408) [3291 bp, 1096 aa] {ON} Anc_4...    45   0.002
Skud_12.468 Chr12 (825378..828740) [3363 bp, 1120 aa] {ON} YLR38...    44   0.003
NDAI0J02180 Chr10 (529566..532892) [3327 bp, 1108 aa] {ON} Anc_4...    44   0.003
Smik_12.470 Chr12 (824001..827345) [3345 bp, 1114 aa] {ON} YLR38...    44   0.003
Suva_10.500 Chr10 (850833..854180) [3348 bp, 1115 aa] {ON} YLR38...    44   0.003
YLR383W Chr12 (885288..888632) [3345 bp, 1114 aa] {ON}  SMC6Comp...    44   0.003
CAGL0H05071g Chr8 (486899..490231) [3333 bp, 1110 aa] {ON} simil...    44   0.005
Ecym_5344 Chr5 (696147..699455) [3309 bp, 1102 aa] {ON} similar ...    43   0.005
Skud_15.121 Chr15 (218825..222106) [3282 bp, 1093 aa] {ON} YOL03...    43   0.006
TDEL0H03490 Chr8 (578645..581956) [3312 bp, 1103 aa] {ON} Anc_7....    43   0.008
KLLA0E05303g Chr5 complement(472583..475879) [3297 bp, 1098 aa] ...    43   0.008
Kpol_483.10 s483 (21646..25002) [3357 bp, 1118 aa] {ON} (21646.....    43   0.009
TBLA0I02890 Chr9 (683688..686984) [3297 bp, 1098 aa] {ON} Anc_4....    42   0.012
TBLA0E02190 Chr5 complement(534078..537347) [3270 bp, 1089 aa] {...    42   0.014
Suva_15.133 Chr15 (232441..235719) [3279 bp, 1092 aa] {ON} YOL03...    42   0.015
TPHA0L00600 Chr12 complement(102317..105670) [3354 bp, 1117 aa] ...    42   0.016
KAFR0D01330 Chr4 complement(263879..267121) [3243 bp, 1080 aa] {...    42   0.019
NDAI0A08450 Chr1 (1947452..1950811) [3360 bp, 1119 aa] {ON} Anc_...    42   0.020
AER044W Chr5 (714355..717666) [3312 bp, 1103 aa] {ON} Syntenic h...    41   0.024
Smik_15.131 Chr15 (226115..229396) [3282 bp, 1093 aa] {ON} YOL03...    41   0.027
YOL034W Chr15 (259923..263204) [3282 bp, 1093 aa] {ON}  SMC5Comp...    41   0.029
TPHA0B00840 Chr2 complement(194812..198171) [3360 bp, 1119 aa] {...    41   0.033
KAFR0A06040 Chr1 complement(1222239..1225547) [3309 bp, 1102 aa]...    40   0.037
KLTH0D02816g Chr4 complement(272310..275594) [3285 bp, 1094 aa] ...    40   0.040
TBLA0I00910 Chr9 complement(170526..173945) [3420 bp, 1139 aa] {...    40   0.050
KNAG0B06010 Chr2 (1178430..1181783) [3354 bp, 1117 aa] {ON} Anc_...    40   0.056
Kpol_1044.13 s1044 complement(23616..26927) [3312 bp, 1103 aa] {...    40   0.067
SAKL0H03322g Chr8 complement(314365..317700) [3336 bp, 1111 aa] ...    39   0.087
CAGL0F01155g Chr6 complement(116762..120079) [3318 bp, 1105 aa] ...    39   0.10 
TBLA0A05300 Chr1 (1297764..1299887) [2124 bp, 707 aa] {ON} Anc_1...    38   0.16 
Kwal_26.9380 s26 (1189521..1192829) [3309 bp, 1102 aa] {ON} YLR3...    38   0.21 
KLTH0D14080g Chr4 (1149555..1152863) [3309 bp, 1102 aa] {ON} sim...    38   0.23 
NCAS0B08700 Chr2 (1674262..1676409) [2148 bp, 715 aa] {ON} Anc_1...    35   1.1  
AFR683C Chr6 complement(1697786..1699819) [2034 bp, 677 aa] {ON}...    34   2.7  
KAFR0B05630 Chr2 complement(1156621..1161168) [4548 bp, 1515 aa]...    34   3.3  
NDAI0A04830 Chr1 (1102282..1105095) [2814 bp, 937 aa] {ON} Anc_3...    34   3.6  
NDAI0D04420 Chr4 (1033897..1039641) [5745 bp, 1914 aa] {ON} Anc_...    34   3.7  
Smik_14.370 Chr14 complement(655563..657380) [1818 bp, 605 aa] {...    33   5.5  
Ecym_1072 Chr1 (137296..139347) [2052 bp, 683 aa] {ON} similar t...    33   5.7  
KNAG0D04340 Chr4 complement(786487..793149) [6663 bp, 2220 aa] {...    33   6.3  
KLLA0F19888g Chr6 complement(1839682..1854429) [14748 bp, 4915 a...    33   6.4  
ZYRO0F17050g Chr6 complement(1417445..1419589) [2145 bp, 714 aa]...    33   6.7  
TDEL0H00150 Chr8 (15728..16606) [879 bp, 292 aa] {ON}                  32   7.5  
AFR286W Chr6 (951485..956761) [5277 bp, 1758 aa] {ON} Syntenic h...    33   7.8  
KAFR0C05940 Chr3 complement(1182174..1183421) [1248 bp, 415 aa] ...    33   8.2  
TDEL0B02190 Chr2 complement(389562..394994) [5433 bp, 1810 aa] {...    33   8.2  
Kpol_1033.28 s1033 complement(69924..74519) [4596 bp, 1531 aa] {...    33   8.9  
TPHA0B04210 Chr2 complement(987462..991373) [3912 bp, 1303 aa] {...    33   9.5  
KLLA0F15950g Chr6 (1477113..1478522) [1410 bp, 469 aa] {ON} simi...    32   9.7  
TBLA0B03720 Chr2 complement(857518..859401) [1884 bp, 627 aa] {O...    32   10.0 

>TBLA0E04410 Chr5 (1122005..1126273) [4269 bp, 1422 aa] {ON} Anc_8.259
            YLR086W
          Length = 1422

 Score = 2561 bits (6639), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1299/1422 (91%), Positives = 1299/1422 (91%)

Query: 1    MPDSPISKKQKITESRDEDKKXXXXXXXXXXXXXXXRSHVDDADITIGPYQGQEKHIQPQ 60
            MPDSPISKKQKITESRDEDKK               RSHVDDADITIGPYQGQEKHIQPQ
Sbjct: 1    MPDSPISKKQKITESRDEDKKINNNIIINHNNRDINRSHVDDADITIGPYQGQEKHIQPQ 60

Query: 61   SQDRHGRSRTPRKLIVSSADHRFTMSQPNLLSADSQTPSLQHPSVSTGREHKFYXXXXXX 120
            SQDRHGRSRTPRKLIVSSADHRFTMSQPNLLSADSQTPSLQHPSVSTGREHKFY      
Sbjct: 61   SQDRHGRSRTPRKLIVSSADHRFTMSQPNLLSADSQTPSLQHPSVSTGREHKFYSQSPPR 120

Query: 121  XXXXXXXXXXKKALELIQLSPIKNNRAELQKMYELQQTQKRTIRLVIERLVLTNFKSYAG 180
                      KKALELIQLSPIKNNRAELQKMYELQQTQKRTIRLVIERLVLTNFKSYAG
Sbjct: 121  SPHRSPVRSPKKALELIQLSPIKNNRAELQKMYELQQTQKRTIRLVIERLVLTNFKSYAG 180

Query: 181  RQVVGPFHTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLKDLIHKSEKYPELSS 240
            RQVVGPFHTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLKDLIHKSEKYPELSS
Sbjct: 181  RQVVGPFHTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLKDLIHKSEKYPELSS 240

Query: 241  CSVEIHFQYVIDDPNGGPSKIDESKEKLVVMRKAFKNNSSKYYINDKESSFTQVTTLLKN 300
            CSVEIHFQYVIDDPNGGPSKIDESKEKLVVMRKAFKNNSSKYYINDKESSFTQVTTLLKN
Sbjct: 241  CSVEIHFQYVIDDPNGGPSKIDESKEKLVVMRKAFKNNSSKYYINDKESSFTQVTTLLKN 300

Query: 301  EGIDLDHKRFLILQGEVENIAQMKPKSEKEGDDGLLEYLEDIIGTSHYKVQIEHNLSKVE 360
            EGIDLDHKRFLILQGEVENIAQMKPKSEKEGDDGLLEYLEDIIGTSHYKVQIEHNLSKVE
Sbjct: 301  EGIDLDHKRFLILQGEVENIAQMKPKSEKEGDDGLLEYLEDIIGTSHYKVQIEHNLSKVE 360

Query: 361  ALNEICIEKENRFNIVEKEKDSLVDGKNEALKYLANEKNLVLAKSKKYQHQLYIDNKKLT 420
            ALNEICIEKENRFNIVEKEKDSLVDGKNEALKYLANEKNLVLAKSKKYQHQLYIDNKKLT
Sbjct: 361  ALNEICIEKENRFNIVEKEKDSLVDGKNEALKYLANEKNLVLAKSKKYQHQLYIDNKKLT 420

Query: 421  STLAKITDAQENYDKELEKYSTISKELKNLQDEEITLNKRLNETKKYEEKLLSNQRKNNS 480
            STLAKITDAQENYDKELEKYSTISKELKNLQDEEITLNKRLNETKKYEEKLLSNQRKNNS
Sbjct: 421  STLAKITDAQENYDKELEKYSTISKELKNLQDEEITLNKRLNETKKYEEKLLSNQRKNNS 480

Query: 481  ELISTQEMIKNIEKKKDNAEKLVNTTEKSITQTNNKLETLNNQQEDYTKQXXXXXXXXXX 540
            ELISTQEMIKNIEKKKDNAEKLVNTTEKSITQTNNKLETLNNQQEDYTKQ          
Sbjct: 481  ELISTQEMIKNIEKKKDNAEKLVNTTEKSITQTNNKLETLNNQQEDYTKQIEELNEKLKI 540

Query: 541  XXXXXXXXXXXXXGKTEQFSNEILKNEKELEPYQIQLQEKMXXXXXXXXXXXXXXXXKDN 600
                         GKTEQFSNEILKNEKELEPYQIQLQEKM                KDN
Sbjct: 541  EKSKLEEIKISLKGKTEQFSNEILKNEKELEPYQIQLQEKMSQIQLLQSEISLLNENKDN 600

Query: 601  XXXXXXXXXXXXXXXXXXVVRMSEKITGWKQQLLEQRKEVESGDIEFNKFTKKIQEMRDK 660
                              VVRMSEKITGWKQQLLEQRKEVESGDIEFNKFTKKIQEMRDK
Sbjct: 601  LSNEIISIKKLIEEKKLSVVRMSEKITGWKQQLLEQRKEVESGDIEFNKFTKKIQEMRDK 660

Query: 661  LDSHRQKANDSRTSLSNVQNKNSVLTALFKLQKSGRISGFYGRLGDLGVIDEKYDVAIST 720
            LDSHRQKANDSRTSLSNVQNKNSVLTALFKLQKSGRISGFYGRLGDLGVIDEKYDVAIST
Sbjct: 661  LDSHRQKANDSRTSLSNVQNKNSVLTALFKLQKSGRISGFYGRLGDLGVIDEKYDVAIST 720

Query: 721  ACPRLEDLVVDSVDCGQQCIDYLRKNRLGYARFILLDKLRKFNLNRIETPDNAPRLFDLI 780
            ACPRLEDLVVDSVDCGQQCIDYLRKNRLGYARFILLDKLRKFNLNRIETPDNAPRLFDLI
Sbjct: 721  ACPRLEDLVVDSVDCGQQCIDYLRKNRLGYARFILLDKLRKFNLNRIETPDNAPRLFDLI 780

Query: 781  QVREDKFLPAFYSVLRDTLVATNLLHANKVAYGKRRFRVVTLDGKLIDISGTMSGGGNYV 840
            QVREDKFLPAFYSVLRDTLVATNLLHANKVAYGKRRFRVVTLDGKLIDISGTMSGGGNYV
Sbjct: 781  QVREDKFLPAFYSVLRDTLVATNLLHANKVAYGKRRFRVVTLDGKLIDISGTMSGGGNYV 840

Query: 841  LRGLMKLGQDLPENDFEQTSPEEVQKLERELEILEKNFKVAYNSLKEMNQEILHMKEQIP 900
            LRGLMKLGQDLPENDFEQTSPEEVQKLERELEILEKNFKVAYNSLKEMNQEILHMKEQIP
Sbjct: 841  LRGLMKLGQDLPENDFEQTSPEEVQKLERELEILEKNFKVAYNSLKEMNQEILHMKEQIP 900

Query: 901  ATELNISKTTIEIEYCENEIKQLISQLKEKQEIHDQESNNNDEIKVADDKLQALKKEYYS 960
            ATELNISKTTIEIEYCENEIKQLISQLKEKQEIHDQESNNNDEIKVADDKLQALKKEYYS
Sbjct: 901  ATELNISKTTIEIEYCENEIKQLISQLKEKQEIHDQESNNNDEIKVADDKLQALKKEYYS 960

Query: 961  LNDQTKVTKQEIEKLRQQIMDAGGIELKMQNSKVTSLVNQLKIVNSKQKNDKSAIXXXXX 1020
            LNDQTKVTKQEIEKLRQQIMDAGGIELKMQNSKVTSLVNQLKIVNSKQKNDKSAI     
Sbjct: 961  LNDQTKVTKQEIEKLRQQIMDAGGIELKMQNSKVTSLVNQLKIVNSKQKNDKSAIKKNNN 1020

Query: 1021 XXXXXXXXXXTTKDNSLEFKTNLENSKKKVTLLSEELAKLESDINDTQNAKEEILLNIDG 1080
                      TTKDNSLEFKTNLENSKKKVTLLSEELAKLESDINDTQNAKEEILLNIDG
Sbjct: 1021 ILKKLQNELNTTKDNSLEFKTNLENSKKKVTLLSEELAKLESDINDTQNAKEEILLNIDG 1080

Query: 1081 NKEKAQELEEDSRNFKSFXXXXXXXXXXXXXXXXXXXXQIGKLDTELNALTIREISQNLE 1140
            NKEKAQELEEDSRNFKSF                    QIGKLDTELNALTIREISQNLE
Sbjct: 1081 NKEKAQELEEDSRNFKSFELEIKNKLDKLKDLSHHLEKQIGKLDTELNALTIREISQNLE 1140

Query: 1141 SFDERLEKYDISKNGATEDTQHTSSALNSVSNINTDTMDIDSTDNEINPGIKRLSELEIN 1200
            SFDERLEKYDISKNGATEDTQHTSSALNSVSNINTDTMDIDSTDNEINPGIKRLSELEIN
Sbjct: 1141 SFDERLEKYDISKNGATEDTQHTSSALNSVSNINTDTMDIDSTDNEINPGIKRLSELEIN 1200

Query: 1201 ELDIESLDAEIENLEEQLEHSTANIEILEEYVRRLSEYKKRKSDLDESISEKETAKEETE 1260
            ELDIESLDAEIENLEEQLEHSTANIEILEEYVRRLSEYKKRKSDLDESISEKETAKEETE
Sbjct: 1201 ELDIESLDAEIENLEEQLEHSTANIEILEEYVRRLSEYKKRKSDLDESISEKETAKEETE 1260

Query: 1261 VLKKKRLEEFTTGFDIISLTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSW 1320
            VLKKKRLEEFTTGFDIISLTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSW
Sbjct: 1261 VLKKKRLEEFTTGFDIISLTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSW 1320

Query: 1321 RNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKDAQ 1380
            RNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKDAQ
Sbjct: 1321 RNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKDAQ 1380

Query: 1381 LIVISLRNNMFELSKQLVGIYKSENMTQSATLVNNDMLNRDT 1422
            LIVISLRNNMFELSKQLVGIYKSENMTQSATLVNNDMLNRDT
Sbjct: 1381 LIVISLRNNMFELSKQLVGIYKSENMTQSATLVNNDMLNRDT 1422

>TDEL0F03860 Chr6 (709579..713778) [4200 bp, 1399 aa] {ON} Anc_8.259
            YLR086W
          Length = 1399

 Score = 1288 bits (3333), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 688/1368 (50%), Positives = 928/1368 (67%), Gaps = 24/1368 (1%)

Query: 68   SRTPRKLIVSSADHRFTMSQPNLLSADSQTPSLQHP-SVSTGREHKFYXXXXXXXXXXXX 126
            S TP+KL++ + D   + SQP + S+  Q PSLQHP S S GRE + Y            
Sbjct: 40   SHTPKKLVIGTNDDTTSQSQPIVSSSSLQAPSLQHPNSSSRGREQRTYSQSPPRSPGRSP 99

Query: 127  XXXXKKALELIQLSPIKNNRAELQKMYELQQTQKRTIRLVIERLVLTNFKSYAGRQVVGP 186
                 + LELI++SP+K NR ELQ++Y+ +Q+Q+   RL I +LVL +FKSYAGRQVVGP
Sbjct: 100  T----RKLELIKISPVKKNRLELQRLYDAEQSQRNAARLCINKLVLQDFKSYAGRQVVGP 155

Query: 187  FHTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLKDLIHKSEKYPELSSCSVEIH 246
            FH++FSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQ +L DLIH SE +P L SCSVE+H
Sbjct: 156  FHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHNSEVHPNLKSCSVEVH 215

Query: 247  FQYVIDDPNGGPSKIDESKEKLVVMRKAFKNNSSKYYINDKESSFTQVTTLLKNEGIDLD 306
            FQYV+D+P+G  ++IDE K  LVV RKAFKNNSSKYY+NDKES++T+VT LLK EGIDLD
Sbjct: 216  FQYVVDEPDG-TTRIDEEKPTLVVTRKAFKNNSSKYYVNDKESNYTEVTQLLKKEGIDLD 274

Query: 307  HKRFLILQGEVENIAQMKPKSEKEGDDGLLEYLEDIIGTSHYKVQIEHNLSKVEALNEIC 366
            HKRFLILQGEVENIAQM+PK+EKEG+DGLLEYLEDI GT+ YK QIE  L ++E LNE C
Sbjct: 275  HKRFLILQGEVENIAQMRPKAEKEGEDGLLEYLEDITGTAKYKPQIETILQEIEVLNESC 334

Query: 367  IEKENRFNIVEKEKDSLVDGKNEALKYLANEKNLVLAKSKKYQHQLYIDNKKLTSTLAKI 426
            IEKENRF+IV++EK SL  GK+EAL++L  EK L L +SK  Q++++ ++ KLTSTL K 
Sbjct: 335  IEKENRFHIVDQEKSSLETGKDEALEFLEKEKTLTLLRSKMIQYKIWQNDIKLTSTLDKS 394

Query: 427  TDAQENYDKELEKYSTISKELKNLQDEEITLNKRLNETKKYEEK-LLSNQRKNNSELIST 485
            +  +   D+E EKYS   KE+ +L+DE   + KR+ ET   EEK LL+ +R  + + ++ 
Sbjct: 395  SKLKGQLDQENEKYSETLKEVDSLKDESKQVAKRI-ETLAIEEKALLAQKRGLDQQRVAI 453

Query: 486  QEMIKNIEKKKDNAEKLVNTTEKSITQTNNKLETLNNQQEDYTKQXXXXXXXXXXXXXXX 545
            +E IK++ +K + AEKL+ + + S+  T   L  L   Q DY K+               
Sbjct: 454  EEKIKSVNQKTNKAEKLLKSNQHSLNATEANLRELRQSQLDYEKELQDLNQELITERAKL 513

Query: 546  XXXXXXXXGKTEQFSNEILKNEKELEPYQIQLQEKMXXXXXXXXXXXXXXXXKDNXXXXX 605
                     KT   S  I + EK+LEP+  QLQ+K                         
Sbjct: 514  EDVKISLKEKTVNISAGIAQYEKDLEPWDGQLQQKRAEIQLAESELSLLKDTNARINKDI 573

Query: 606  XXXXXXXXXXXXXVVRMSEKITGWKQQLLEQRKEVESGDIEFNKFTKKIQEMRDKLDSHR 665
                          +   + I   KQ+  +   EV +   E +  + ++++M + L + R
Sbjct: 574  EQLKNEIARGGEEKLAKEKVIRELKQEESDVTAEVHTAGAECSSASARLKKMHEILIAQR 633

Query: 666  QKANDSRTSLSNVQNKNSVLTALFKLQKSGRISGFYGRLGDLGVIDEKYDVAISTACPRL 725
            Q+  D+R + S+ QNK++VLTAL KLQKSGRISGF+GRLGDLGVIDEKYDVAISTACPRL
Sbjct: 634  QRTLDARAAFSSAQNKSTVLTALTKLQKSGRISGFHGRLGDLGVIDEKYDVAISTACPRL 693

Query: 726  EDLVVDSVDCGQQCIDYLRKNRLGYARFILLDKLRKFNLNRIETPDNAPRLFDLIQVRED 785
            ED+VV+SV+CGQQCI+YLRKN+LGYARFILLDKLRKF+  +I+TP+N PRLFDL++ ++D
Sbjct: 694  EDIVVESVECGQQCIEYLRKNKLGYARFILLDKLRKFHTGKIQTPENVPRLFDLVKPKDD 753

Query: 786  KFLPAFYSVLRDTLVATNLLHANKVAYGKRRFRVVTLDGKLIDISGTMSGGGNYVLRGLM 845
            KF+PAFYSVLRDTL A +L  AN+VAYGK+RFRVV+LDGKLIDISGTMSGGG++V+RGLM
Sbjct: 754  KFIPAFYSVLRDTLAAQSLAQANRVAYGKKRFRVVSLDGKLIDISGTMSGGGSHVVRGLM 813

Query: 846  KLGQDLPENDFEQT--SPEEVQKLERELEILEKNFKVAYNSLKEMNQEILHMKEQIPATE 903
            +L Q+   N +     SPEEV +LE EL   EK+F++A ++ +EM  ++  +K+++P  +
Sbjct: 814  RLSQN---NSYSPDIFSPEEVAQLENELTEKEKSFQIASDTFREMEDQLKKLKDRVPEIQ 870

Query: 904  LNISKTTIEIEYCENEIKQLISQLKEKQEIHDQESNNNDEIKVADDKLQALKKEYYSLND 963
            L +SK  +E E   +E+K     L E+ E   + +  N+E ++A+ +++ LK E  +L+D
Sbjct: 871  LKVSKLVMETESWMSELKLKEKLLLERLEAQKKATGKNEEYQLAEARVKTLKDEQRALSD 930

Query: 964  QTKVTKQEIEKLRQQIMDAGGIELKMQNSKVTSLVNQLKIVNSKQKNDKSAIXXXXXXXX 1023
            QT  T+Q+I  L+ +IM+ GG EL++QNSKVTS + +++I+ SKQK  K++I        
Sbjct: 931  QTTTTRQKIAVLKDKIMEIGGSELQIQNSKVTSTIQRMEILTSKQKKGKASIKKAENELK 990

Query: 1024 XXXXXXXTTKDNSLEFKTNLENSKKKVTLLSEELAKLESDINDTQNAKEEILLNIDGNKE 1083
                    T+ +   +   + + K+    + + L  +E  +++ Q+   E+   +D  K+
Sbjct: 991  KSAKIVGNTQKDLDLYSQEIASLKENADNVQQTLESVEKSVDEQQDLSHEMNEKLDQLKQ 1050

Query: 1084 KAQELEEDSRNFKSFXXXXXXXXXXXXXXXXXXXXQIGKLDTELNALTIREISQNLESFD 1143
            +  ++E     FKS                     ++ +L+++LN L IR++++ L+  D
Sbjct: 1051 RLAQMEAGFTEFKSLKIEINDKLEKLNALLGHITKEVRQLESDLNNLKIRDVTRTLQLLD 1110

Query: 1144 E-----------RLEKYDISKNGATEDTQHTSSALNSVSNINTDTMDIDSTDNEINPGIK 1192
            E            L++       AT      S         N + M++D   +E+  G+ 
Sbjct: 1111 EGESTNNSKMPNELQEKRTEGADATRQEGEESDVSMEEEKSNDEVMEVDEKPHELENGLP 1170

Query: 1193 RLSELEINELDIESLDAEIENLEEQLEHSTANIEILEEYVRRLSEYKKRKSDLDESISEK 1252
            R+SE E+  LD+E L A+IE+L+  ++    ++EILEEY +RL+E+K+RK DL+E++ E+
Sbjct: 1171 RVSEAELKSLDVEDLGAQIEDLQNYVDSVNVDVEILEEYAKRLAEHKRRKVDLNEAVGER 1230

Query: 1253 ETAKEETEVLKKKRLEEFTTGFDIISLTLKEMYQMITMGGNAELELVDSLDPFSEGVTFS 1312
            +  +E+   LKK+R +EF  GF IIS+TLKEMYQMITMGGNAELELVDSLDPFSEGVTFS
Sbjct: 1231 DAMREKLGELKKRRFDEFMQGFGIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFS 1290

Query: 1313 VMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1372
            VMPPKKSWRNI+NLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI
Sbjct: 1291 VMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1350

Query: 1373 KERTKDAQLIVISLRNNMFELSKQLVGIYKSENMTQSATLVNNDMLNR 1420
            KERTK+AQ IVISLRNNMFEL++QLVGIYK++NMT+SA+L NND+LNR
Sbjct: 1351 KERTKNAQFIVISLRNNMFELAQQLVGIYKTQNMTKSASLKNNDILNR 1398

>NCAS0B05000 Chr2 (917841..922070) [4230 bp, 1409 aa] {ON} Anc_8.259
            YLR086W
          Length = 1409

 Score = 1282 bits (3317), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 713/1380 (51%), Positives = 938/1380 (67%), Gaps = 14/1380 (1%)

Query: 48   GPYQGQEKHIQPQSQDRHGRSRTPRKLIVSSADHRFTMSQPNLLSADSQTPSLQHPSVST 107
             P Q  E H Q  S   + +S TPRKLI+   D+R+  SQP++ S+  Q P+LQ P  S+
Sbjct: 34   SPLQRPE-HQQSISPINNSKSHTPRKLILGQNDNRYAFSQPSVSSSSFQVPTLQPPDSSS 92

Query: 108  GREHKFYXXXXXXXXXXXXXXXXKKALELIQLSPIKNNRAELQKMYELQQTQKRTIRLVI 167
             R  K                  K+ LELIQLSP+KNNR +L+++Y+   +Q +  RL I
Sbjct: 93   SRGRKDIKSYSQSPPRSPGRSP-KRRLELIQLSPVKNNRIKLRELYDAHNSQSKKERLFI 151

Query: 168  ERLVLTNFKSYAGRQVVGPFHTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLKD 227
             +L L NFKSYAG+QVVGPFHT+FSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQ +L D
Sbjct: 152  NKLTLNNFKSYAGQQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSD 211

Query: 228  LIHKSEKYPELSSCSVEIHFQYVIDDPNGGPSKIDESKEKLVVMRKAFKNNSSKYYINDK 287
            LIHKSEK+P+L+SCSV++ F Y ID+ +G  +KI E+K KLV+ RKAFKNNSSKYYIN K
Sbjct: 212  LIHKSEKFPDLTSCSVDVEFLYAIDEHDGD-TKISETKPKLVISRKAFKNNSSKYYINGK 270

Query: 288  ESSFTQVTTLLKNEGIDLDHKRFLILQGEVENIAQMKPKSEKEGDDGLLEYLEDIIGTSH 347
            ES++T VT LLK EGIDLDHKRFLILQGEVENIAQMKPK+EKE DDGLLEYLEDIIGTS 
Sbjct: 271  ESNYTDVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTSK 330

Query: 348  YKVQIEHNLSKVEALNEICIEKENRFNIVEKEKDSLVDGKNEALKYLANEKNLVLAKSKK 407
            YK  IE +L ++E+LNEICIEKENRF IV++EK+SL  GKN AL++L  EK L L+KSK 
Sbjct: 331  YKQLIEKDLIEIESLNEICIEKENRFEIVDREKNSLESGKNLALEFLEKEKQLTLSKSKL 390

Query: 408  YQHQLYIDNKKLTSTLAKITDAQENYDKELEKYSTISKEL---KNLQDEEITLNKRLNET 464
             Q+ L+ +N KLT+TL KI+   E Y+ E  K  T+  E+   K L +E  +  K L   
Sbjct: 391  LQYNLWQNNSKLTNTLQKISALNEEYNVEKSKNQTLQNEINRTKQLLNESQSKIKVLEGE 450

Query: 465  KKYEEKLLSNQRKNNSELISTQEMIKNIEKKKDNAEKLVNTTEKSITQTNNKLETLNNQQ 524
            +K +   L ++R    E +S  E +KN+ +KK   EK++ TTEK+I+   ++++ L   Q
Sbjct: 451  EKQQ---LKSKRILEGEHVSLDEKLKNLTQKKAKTEKIIATTEKTISSLTSEIQELEKSQ 507

Query: 525  EDYTKQXXXXXXXXXXXXXXXXXXXXXXXGKTEQFSNEILKNEKELEPYQIQLQEKMXXX 584
            ++Y+ +                        KT   S EIL +E +LEP+ I++QEK    
Sbjct: 508  KEYSDELETLNQQLQSERESLEAMKLKLKEKTSGISEEILIHEHDLEPWNIKVQEKKTEI 567

Query: 585  XXXXXXXXXXXXXKDNXXXXXXXXXXXXXXXXXXVVRMSEKITGWKQQLLEQRKEVESGD 644
                         +                     ++  E +   K+Q     KE+ +G+
Sbjct: 568  QLVESQISLLQEGQVKLKNDIKVLSQEVSNQTALKIKREEDLVNLKKQQSSITKEISNGE 627

Query: 645  IEFNKFTKKIQEMRDKLDSHRQKANDSRTSLSNVQNKNSVLTALFKLQKSGRISGFYGRL 704
             E N    K++EM++ L+  RQ+A+++R +L+NVQN+  VLTAL+KLQKSGRI GF+GRL
Sbjct: 628  TECNDGRSKLKEMKNVLNMQRQRASEARLALANVQNRGKVLTALYKLQKSGRIVGFHGRL 687

Query: 705  GDLGVIDEKYDVAISTACPRLEDLVVDSVDCGQQCIDYLRKNRLGYARFILLDKLRKFNL 764
            GDLG ID  YDVA+STACPRL+D+VV++V+CGQQCI+YLRKN+LGYARFILLDKLR FN 
Sbjct: 688  GDLGTIDNTYDVAVSTACPRLDDIVVETVECGQQCIEYLRKNKLGYARFILLDKLRSFNT 747

Query: 765  NRIETPDNAPRLFDLIQVREDKFLPAFYSVLRDTLVATNLLHANKVAYGKRRFRVVTLDG 824
            N I+TP N PRLFDLI+ ++ KF+PAFYSVLRDTLVA +L  AN+VAYG+RR+RVVTLDG
Sbjct: 748  NTIQTPKNVPRLFDLIKPKDSKFVPAFYSVLRDTLVAKDLKQANRVAYGQRRYRVVTLDG 807

Query: 825  KLIDISGTMSGGGNYVLRGLMKLGQDLPENDFEQTSPEEVQKLERELEILEKNFKVAYNS 884
            KLID+SGTMSGGGN+V +GLM L Q   +N F+  +PE+V+++E++L   EKNF++A N+
Sbjct: 808  KLIDVSGTMSGGGNHVSKGLMML-QRKGQNYFDDYNPEDVEQIEKDLSDKEKNFELANNA 866

Query: 885  LKEMNQEILHMKEQIPATELNISKTTIEIEYCENEIKQLISQLKEKQEIHDQESNNNDEI 944
              EM  E+  +  + P  EL ISK  +EI+    EIK    QL+EK  I + E  +N+E+
Sbjct: 867  FYEMENELQKLNNRKPEIELEISKIIMEIDTYSAEIKSKERQLQEKTNIDNSELQDNEEL 926

Query: 945  KVADDKLQALKKEYYSLNDQTKVTKQEIEKLRQQIMDAGGIELKMQNSKVTSLVNQLKIV 1004
            KVA + LQ LK+E+ +L D+TK  K++I  L+++IM  GGIEL++QNSKVTS+V ++ I+
Sbjct: 927  KVAIENLQKLKEEHLALQDKTKAKKKKIASLKEKIMKIGGIELQVQNSKVTSIVQRIDIL 986

Query: 1005 NSKQKNDKSAIXXXXXXXXXXXXXXXTTKDNSLEFKTNLENSKKKVTLLSEELAKLESDI 1064
             +KQK D+++                T+K++      +++   +++  +S  L  ++  I
Sbjct: 987  TAKQKKDRTSKKKSDTELEKAKKTLLTSKNDITLITDDIKEISERIDKISSSLNNIDKSI 1046

Query: 1065 NDTQNAKEEILLNIDGNKEKAQELEEDSRNFKSFXXXXXXXXXXXXXXXXXXXXQIGKLD 1124
             + Q  KE +    D  K+K  +LEE+   FKSF                    QI  L+
Sbjct: 1047 EEFQAHKETLKDECDELKDKVVDLEENINEFKSFEIEVNNKLEKLNGLLNHIKNQIKTLE 1106

Query: 1125 TELNALTIREISQNLESFDERLEKYDISKNGATEDTQ---HTSSALNSVSNINTDTMDID 1181
              L+ LT+R++ Q L + DE  E      NG   D Q    T   L + +  + D+MDID
Sbjct: 1107 DSLSKLTLRKMHQVLMALDEESEA-KAPNNGTLSDEQIHDQTGHELTNTAVQDDDSMDID 1165

Query: 1182 STDNEINPGIKRLSELEINELDIESLDAEIENLEEQLEHSTANIEILEEYVRRLSEYKKR 1241
            +    I+ G+  LS+ E++ LDI  ++ E+ +LE+ +E + ANIE+LEEYV+RL+E+K R
Sbjct: 1166 NGAEVISNGLPILSDDELSALDITLVETEVSDLEKYIESTDANIEVLEEYVKRLTEFKTR 1225

Query: 1242 KSDLDESISEKETAKEETEVLKKKRLEEFTTGFDIISLTLKEMYQMITMGGNAELELVDS 1301
            K DL++++ ++ET +++ E LKK R EEF  GF IIS+TLKEMYQMITMGGNAELELVDS
Sbjct: 1226 KLDLNDAVDKRETVRKQLEELKKTRYEEFMHGFGIISMTLKEMYQMITMGGNAELELVDS 1285

Query: 1302 LDPFSEGVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALD 1361
            LDPFSEGVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALD
Sbjct: 1286 LDPFSEGVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALD 1345

Query: 1362 FRNVSIVANYIKERTKDAQLIVISLRNNMFELSKQLVGIYKSENMTQSATLVNNDMLNRD 1421
            FRNVSIVANYIKERTK+AQ IVISLRNNMFEL++QLVGIYK EN T SAT+ N ++LN D
Sbjct: 1346 FRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKCENRTHSATIKNREILNSD 1405

>Kpol_392.8 s392 complement(19392..23675) [4284 bp, 1427 aa] {ON}
            complement(19392..23675) [4284 nt, 1428 aa]
          Length = 1427

 Score = 1258 bits (3254), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 709/1450 (48%), Positives = 942/1450 (64%), Gaps = 52/1450 (3%)

Query: 1    MPDSPISKKQKITESRDEDKKXXXXXXXXXXXXXXXRSHVDDADITIGPYQGQEKHIQPQ 60
            MP +P+SK+ K+ E+                       H DD       Y  QE  + P 
Sbjct: 1    MPKTPLSKRPKLVEAN---------------LNANELDHNDDDQ----RYNRQEIKVSPT 41

Query: 61   SQDRHG------RSRTPRKLIVSSADH-RFTMSQPNLLSADSQTPSLQHP--SVSTGREH 111
            +QD         +S+TP+KLI+   D    T +     S+  Q PSL  P  S S GR  
Sbjct: 42   TQDAAAVSHLNFKSQTPKKLILRDYDSIAITPTAAMPPSSSLQAPSLHPPTESSSRGRTA 101

Query: 112  KFYXXXXXXXXXXXXXXXXKKALELIQLSPIKNNRAELQKMYELQQTQKRTIRLVIERLV 171
            + Y                 + LELIQLSP+KN+R  LQK+YE  + +K+  RL I++LV
Sbjct: 102  RTYSQSPPRSPARSPARSPTRKLELIQLSPVKNSRIALQKIYE-SKNEKQIERLCIDKLV 160

Query: 172  LTNFKSYAGRQVVGPFHTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLKDLIHK 231
            L +FKSYAG QVVGPFH++FSAVVGPNGSGKSNVIDSMLFVFGFRA+KMRQ +L DLIHK
Sbjct: 161  LHDFKSYAGTQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRASKMRQDRLSDLIHK 220

Query: 232  SEKYPELSSCSVEIHFQYVIDDPNGGPSKIDESKEKLVVMRKAFKNNSSKYYINDKESSF 291
            SE +P+L SCSVE+HF+YVID P+G  + I+  KEKLV+ RKAFKNN+SKYYIN KES++
Sbjct: 221  SENFPDLKSCSVEVHFEYVIDKPDG-TTIINTVKEKLVITRKAFKNNTSKYYINGKESNY 279

Query: 292  TQVTTLLKNEGIDLDHKRFLILQGEVENIAQMKPKSEKEGDDGLLEYLEDIIGTSHYKVQ 351
            T VT LLK+EGIDLDH RFLILQGEVENIAQMKPK+E +GDDGLLEYLEDIIGT+ YK  
Sbjct: 280  TSVTKLLKDEGIDLDHNRFLILQGEVENIAQMKPKAENDGDDGLLEYLEDIIGTAKYKPL 339

Query: 352  IEHNLSKVEALNEICIEKENRFNIVEKEKDSLVDGKNEALKYLANEKNLVLAKSKKYQHQ 411
            IE    ++EALNEICIEKENRF IV++EK SL  GK+EAL++L  EK L L KSK YQ++
Sbjct: 340  IEKKFEEIEALNEICIEKENRFEIVDREKASLESGKDEALEFLEKEKELTLVKSKLYQYK 399

Query: 412  LYIDNKKLTSTLAKITDAQENYDKELEKYSTISKELKNLQDEEITLNKRLNETKKYEEKL 471
            L+ DNKKL++TL K+++ +E +++  +K+ST   ++  +      + K +  +++ E+KL
Sbjct: 400  LWQDNKKLSTTLEKLSNIKEEFEETKKKHSTTEIQMNEISKSYHEMLKNIKASQEQEKKL 459

Query: 472  LSNQRKNNSELISTQEMIKNIEKKKDNAEKLVNTTEKSITQTNNKLETLNNQQEDYTKQX 531
               +R  ++E +S +E  KNI KKK   EK +    K+I+ T  K+E L   + +Y  Q 
Sbjct: 460  NIQKRNYDTERVSLEEQRKNIMKKKKKMEKELEDCNKTISNTKIKIEDLGKNESEYESQL 519

Query: 532  XXXXXXXXXXXXXXXXXXXXXXGKTEQFSNEILKNEKELEPYQIQLQEKMXXXXXXXXXX 591
                                   KT +FS+EI ++EKELEP+ +QLQ K           
Sbjct: 520  DELNAQLQIERGLLEEIKISLKDKTIEFSDEISQHEKELEPWNLQLQGKKSQIQVKESEI 579

Query: 592  XXXXXXKDNXXXXXXXXXXXXXXXXXXVVRMSEKITGWKQQLLEQRKEVESGDIEFNKFT 651
                  +                     +   ++I   + +L    KEV  GD E+    
Sbjct: 580  SLIKEGRVKLENDIENLNSLISVKIEEKISREKEIGSLRNELNRITKEVSIGDTEYTNAK 639

Query: 652  KKIQEMRDKLDSHRQKANDSRTSLSNVQNKNSVLTALFKLQKSGRISGFYGRLGDLGVID 711
            +K++EM+  L+ HRQKA D+RTSLS  +NKN VL +LF+LQKSGRISGFYGRLGDLG ID
Sbjct: 640  EKLREMKAVLNQHRQKAIDARTSLSAEENKNQVLASLFRLQKSGRISGFYGRLGDLGAID 699

Query: 712  EKYDVAISTACPRLEDLVVDSVDCGQQCIDYLRKNRLGYARFILLDKLRKFNLNRIETPD 771
            ++YD+AISTACPRL DLVV++V+CGQQCI+YLRKN+LGYARFILL+KLR F++N+I TP+
Sbjct: 700  DRYDIAISTACPRLNDLVVETVECGQQCIEYLRKNKLGYARFILLEKLRNFDMNKISTPN 759

Query: 772  NAPRLFDLIQVREDKFLPAFYSVLRDTLVATNLLHANKVAYGKRRFRVVTLDGKLIDISG 831
            N PRLFDL+   + KFLPAFYSVLRDTLV  NL  AN+VAYG +RFRVVTL G+LID+SG
Sbjct: 760  NVPRLFDLVISSDPKFLPAFYSVLRDTLVVNNLKDANRVAYGNKRFRVVTLSGELIDVSG 819

Query: 832  TMSGGGNYVLRGLMKLGQDLPENDFEQTSPEEVQKLERELEILEKNFKVAYNSLKEMNQE 891
            TMSGGG    RGLMKL +    + F+  + E+V+K+E+EL   EKNF++A  +  EM  E
Sbjct: 820  TMSGGGTQTSRGLMKLTKS-GNSGFKSYTIEDVEKIEKELAAREKNFEIANETFTEMETE 878

Query: 892  ILHMKEQIPATELNISKTTIEIEYCENEIKQLISQLKEKQEIHDQESNNNDEIKVADDKL 951
            +  +K++ P  EL ISK  +EI     E + +  QL EKQ+  D+  +NN+E+   + +L
Sbjct: 879  LRRLKDRKPDVELEISKFELEITSWVTEHELMQQQLNEKQQSLDECMSNNEELSTMEHEL 938

Query: 952  QALKKEYYSLNDQTKVTKQEIEKLRQQIMDAGGIELKMQNSKVTSLVNQLKIVNSKQKND 1011
              L+ +Y SL  +TK  K  I+ L+ +IM  GGI+L++Q+SKV S++ +  I+N K K D
Sbjct: 939  GTLQNDYKSLQLETKSKKDRIKFLKDEIMKVGGIKLQVQSSKVDSIIQKKDILNGKHKKD 998

Query: 1012 KSAIXXXXXXXXXXXXXXXTTKDNSLEFKTNLENSKKKVTLLSEELAKLESDINDTQNAK 1071
            K+ +                   + L     LEN+  +++ +S+ L++ E+ +++ + ++
Sbjct: 999  KNDLKKAETELKRLSKKQSECSTDLLTSTDKLENTDGQLSKISKSLSETETLLHELEFSR 1058

Query: 1072 EEILLNIDGNKEKAQELEEDSRNFKSFXXXXXXXXXXXXXXXXXXXXQIGKLDTELNALT 1131
            EE L N +  K++ +E EE+  +FK F                     I   D+EL +L 
Sbjct: 1059 EESLQNSENLKDQLKEFEENLNSFKVFQLEHQNKEEKLNNLLNFIKKDIRSTDSELQSLK 1118

Query: 1132 IREISQNLESFDERLEKYDISKNGATEDTQHTSSALNSVSN---------------INTD 1176
            IR+I+  L+  D      D  ++ + +D   + SA NS+ N               ++ D
Sbjct: 1119 IRDITHTLQELDNGNIDQD-EEDVSMKDNAVSVSANNSLGNSENMEGVEIETNESDVSPD 1177

Query: 1177 T-----MDIDSTDNEINPGIKRLSELEINELDIESLDAEIENLEEQLEHSTANIEILEEY 1231
                  M+ID  +NEI+ GI R+SE E   +D+E L+A+   L++ ++    NI++LEEY
Sbjct: 1178 ANNDLEMEIDEDNNEISKGIPRISEDEFKNVDVEELEAQKLQLQDYIDTVNVNIDVLEEY 1237

Query: 1232 VRRLSEYKKRKSDLDESISEKETAKEETEVLKKKRLEEFTTGFDIISLTLKEMYQMITMG 1291
             RR++EYK+RK DL+ ++ E+E  +E  + LKK R EEF  GF +IS+TLKEMYQMITMG
Sbjct: 1238 ARRVAEYKRRKLDLNNAVDEREKVRELLDKLKKTRFEEFMQGFGVISITLKEMYQMITMG 1297

Query: 1292 GNAELELVDSLDPFSEGVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLY 1351
            GNAELELVDSLDPFSEGVTFSVMPPKKSWRNI+NLSGGEKTLSSLALVFALHKYKPTPLY
Sbjct: 1298 GNAELELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLY 1357

Query: 1352 VMDEIDAALDFRNVSIVANYIKERTKDAQLIVISLRNNMFELSKQLVGIYKSENMTQSAT 1411
            VMDEIDAALDFRNVSIVANYIKERTK+AQ IVISLRNNMFEL++QLVGIYKS N T+SAT
Sbjct: 1358 VMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAEQLVGIYKSNNQTKSAT 1417

Query: 1412 LVNNDMLNRD 1421
            L NND++NRD
Sbjct: 1418 LQNNDIINRD 1427

>Smik_12.145 Chr12 (282081..286337) [4257 bp, 1418 aa] {ON} YLR086W
            (REAL)
          Length = 1418

 Score = 1250 bits (3234), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 698/1447 (48%), Positives = 937/1447 (64%), Gaps = 57/1447 (3%)

Query: 1    MPDSPISKKQKITESRDEDKKXXXXXXXXXXXXXXXRSHVDDADITIGPYQGQEKHIQPQ 60
            M DSP+SK+QK    +  ++                    D ++ T  P         P 
Sbjct: 1    MCDSPLSKRQK---RKAVEEPELSLDDSDATQELQAEKQADRSEKTPDPNS-------PA 50

Query: 61   SQDRHGRSRTPRKLIVSSADHRFTMSQP-NLLSADSQTPSLQHPSVST-GREHKFYXXXX 118
             +  + +S TPRKL++SS ++R+  SQP N  +     P+LQ P  S+ GR++K Y    
Sbjct: 51   LETSYAKSHTPRKLVLSSGENRYAFSQPTNSATTSLHVPNLQPPGTSSRGRDYKAYSQSP 110

Query: 119  XXXXXXXXXXXXKKALELIQLSPIKNNRAELQKMYELQQTQ-KRTIRLVIERLVLTNFKS 177
                         + LEL+QLSP+KN+R ELQK+Y   Q+  K+  RL I  LVL NFKS
Sbjct: 111  PRSPGRSPT----RRLELLQLSPVKNSRVELQKLYNSHQSSTKQQGRLFINELVLENFKS 166

Query: 178  YAGRQVVGPFHTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLKDLIHKSEKYPE 237
            YAGRQVVGPFHT+FSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQ +L DLIHKSE +P 
Sbjct: 167  YAGRQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEAFPN 226

Query: 238  LSSCSVEIHFQYVIDDPNGGPSKIDESKEKLVVMRKAFKNNSSKYYINDKESSFTQVTTL 297
            L SCSV +HF+YVID+ + G S+IDE K  LV+ RKAFKNNSSKYYIN KESS+T+VT L
Sbjct: 227  LQSCSVAVHFEYVIDE-SSGTSRIDEEKPGLVITRKAFKNNSSKYYINGKESSYTEVTKL 285

Query: 298  LKNEGIDLDHKRFLILQGEVENIAQMKPKSEKEGDDGLLEYLEDIIGTSHYKVQIEHNLS 357
            LKNEGIDLDHKRFLILQGEVENIAQMKPK+EKE DDGLLEYLEDIIGT++YK  IE  ++
Sbjct: 286  LKNEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTANYKPLIEEQMN 345

Query: 358  KVEALNEICIEKENRFNIVEKEKDSLVDGKNEALKYLANEKNLVLAKSKKYQHQLYIDNK 417
            ++EALNE+C+EKENRF IV++EK+SL  GK  AL++LA EK L L KSK +Q ++   N 
Sbjct: 346  QIEALNEVCLEKENRFEIVDREKNSLESGKETALEFLAKEKQLTLLKSKLFQFKVLQSNS 405

Query: 418  KLTSTLAKITDAQENYDKELEKYSTISKELKNLQDEEITLNKRLNETKKYEEKLLSNQRK 477
            KL STL KI+   ++++ E  K+    K+++ ++ +   +  R++     E+ L+  +R+
Sbjct: 406  KLASTLEKISSLNKDFETEKVKFQESLKKVEEVKTQRKEIKDRISSNDSREKDLVLERRE 465

Query: 478  NNSELISTQEMIKNIEKKKDNAEKLVNTTEKSITQTNNKLETLNNQQEDYTKQXXXXXXX 537
                 +S +E  KN+  K + +E+    T++SI++  + L+ L+ QQ ++  +       
Sbjct: 466  LEGTRVSLEERTKNLANKIEKSERTSKCTKRSISEAEHTLKELHTQQTEHESEIKDLNQL 525

Query: 538  XXXXXXXXXXXXXXXXGKTEQFSNEILKNEKELEPYQIQLQEKMXXXXXXXXXXXXXXXX 597
                             KT+  S EI+++EKELEP+ +QLQEK                 
Sbjct: 526  LEEERSVLDEIKLSLKDKTKDISTEIIQHEKELEPWDLQLQEKESQIQLAESELSLLEET 585

Query: 598  KDNXXXXXXXXXXXXXXXXXXVVRMSEKITGWKQQLLEQRKEVESGDIEFNKFTKKIQEM 657
            +                       + + I   K++L   R E   G+  F+    K++EM
Sbjct: 586  QSKLKKNVETMEEKILARKAHKQELQDLILNLKKKLSSLRDERSQGEENFSSAHLKLEEM 645

Query: 658  RDKLDSHRQKANDSRTSLSNVQNKNSVLTALFKLQKSGRISGFYGRLGDLGVIDEKYDVA 717
            +  L++HRQ+A ++R+SLS  QNK+ VLTAL KLQKSGRI+GF+GRLGDLG+ID  +DVA
Sbjct: 646  QKVLNTHRQRAMEARSSLSEAQNKSKVLTALSKLQKSGRINGFHGRLGDLGIIDNSFDVA 705

Query: 718  ISTACPRLEDLVVDSVDCGQQCIDYLRKNRLGYARFILLDKLRKFNLNRIETPDNAPRLF 777
            ISTACPRL+D+VVD+V+C QQCIDYLRKN+LGYARFILLD+LR+FNL  I TP+N PRLF
Sbjct: 706  ISTACPRLDDVVVDTVECAQQCIDYLRKNKLGYARFILLDRLRQFNLQPISTPENVPRLF 765

Query: 778  DLIQVREDKFLPAFYSVLRDTLVATNLLHANKVAYGKRRFRVVTLDGKLIDISGTMSGGG 837
            DL++ ++ KF  AFYSVLRDTLVA +L  AN VAYG++RFRVVT+DGKLIDISGT+SGGG
Sbjct: 766  DLVKPKDPKFSNAFYSVLRDTLVARSLKQANNVAYGRKRFRVVTIDGKLIDISGTISGGG 825

Query: 838  NYVLRGLMKLGQDLPENDFEQTSPEEVQKLERELEILEKNFKVAYNSLKEMNQEILHMKE 897
            N+V +GLM+LG +   N  +  +PEEV K+E EL   E NF+VA +++ EM  E+ ++++
Sbjct: 826  NHVSKGLMRLGTN-QSNKIDDYTPEEVNKIEHELSERENNFRVANDTVHEMEAELKNLRD 884

Query: 898  QIPATELNISKTTIEIEYCENEIKQLISQLKEKQEIHDQESNNNDEIKVADDKLQALKKE 957
            Q PA E  ISKT +E +   +E+     Q+KE +  +    ++  ++ +    L+ LK E
Sbjct: 885  QEPAIESKISKTEMEADSITSELTLAEQQVKEARIAYHNALSDKAQVNMIMKNLERLKGE 944

Query: 958  YYSLNDQTKVTKQEIEKLRQQIMDAGGIELKMQNSKVTSLVNQLKIVNSKQKNDKSAIXX 1017
            +  L  +TK  K++I+ L+ +IM  GG +L+MQNSKV SL  +L I+ +K K  KS I  
Sbjct: 945  HDDLQSETKTKKEKIKVLQGEIMKIGGTKLQMQNSKVGSLCQRLDILVAKLKKVKSGIKK 1004

Query: 1018 XXXXXXXXXXXXXTTKDNSLEFKTNLENSKKKVTLLSEELAKLESDINDTQ--------- 1068
                          ++ + L+F+  L+NS++ V L S EL  +E  +  T+         
Sbjct: 1005 --------------SEGDVLKFQKQLKNSERDVELSSNELKAIEEKLKHTKLDLSENDIK 1050

Query: 1069 -----NAKEEILLNIDGNKEKAQELEEDSRNFKSFXXXXXXXXXXXXXXXXXXXXQIGKL 1123
                 N + E+    +  KE   E EE+   FKS                     +I + 
Sbjct: 1051 MTETFNLRSELKEESEQLKEMVAETEENIDEFKSLEIEMKNKLEKLNSLLMHIKKEINQQ 1110

Query: 1124 DTELNALTIREISQNLESFDE----------RLEKYDISKNGATEDTQHTSSALNSVSNI 1173
            +  L+ L+IR+++  LE  D           ++E+  + +  ++E     +      +  
Sbjct: 1111 EKGLSELSIRDVTHTLEILDNNTMDIVKTDNKIEQAVVKEKRSSETQDEKNIQEEERTCD 1170

Query: 1174 NTDTMDIDSTDNEINPGIKRLSELEINELDIESLDAEIENLEEQLEHSTANIEILEEYVR 1233
            +  +MDID T NE+  GI R SE E+ ELDIE L+ EI  L   ++ +  +I +LEEY R
Sbjct: 1171 DHHSMDIDETSNEVIRGIPRFSEEELKELDIELLEKEISELSYYIDETNVDIGVLEEYAR 1230

Query: 1234 RLSEYKKRKSDLDESISEKETAKEETEVLKKKRLEEFTTGFDIISLTLKEMYQMITMGGN 1293
            RL+E+K+RK DL++++ +++  K + EVLKKKR +EF TGF+IIS+TLKEMYQMITMGGN
Sbjct: 1231 RLAEFKRRKLDLNQAVQKRDEVKGQVEVLKKKRFDEFMTGFNIISMTLKEMYQMITMGGN 1290

Query: 1294 AELELVDSLDPFSEGVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVM 1353
            AELELVDSLDPFSEGVTFSVMPPKKSWRNI+NLSGGEKTLSSLALVFALHKYKPTPLYVM
Sbjct: 1291 AELELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVM 1350

Query: 1354 DEIDAALDFRNVSIVANYIKERTKDAQLIVISLRNNMFELSKQLVGIYKSENMTQSATLV 1413
            DEIDAALDFRNVSIVANYIKERTK+AQ IVISLRNNMFEL++QLVGIYK +N T+S T+ 
Sbjct: 1351 DEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKRDNRTRSTTVK 1410

Query: 1414 NNDMLNR 1420
            N D+LNR
Sbjct: 1411 NIDILNR 1417

>Skud_12.154 Chr12 (285613..289866) [4254 bp, 1417 aa] {ON} YLR086W
            (REAL)
          Length = 1417

 Score = 1243 bits (3216), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 695/1449 (47%), Positives = 934/1449 (64%), Gaps = 60/1449 (4%)

Query: 1    MPDSPISKKQKITESRDEDKKXXXXXXXXXXXXXXXRSHVDDADITIGPYQGQEKHIQPQ 60
            M DSP+SKKQK    +  ++                 + V+  + T  P         P 
Sbjct: 1    MCDSPLSKKQK---RKATEEPELSLNDTDAERESRVENRVNRTEKTPDPNS-------PS 50

Query: 61   SQDRHGRSRTPRKLIVSSADHRFTMSQP-NLLSADSQTPSLQHPSVST-GREHKFYXXXX 118
             +  + RS TPRKL++SS ++R+  SQP N  +     P+LQ P VS+ GR++K Y    
Sbjct: 51   LESSYARSHTPRKLVLSSGENRYAFSQPTNSATTSLHVPNLQPPKVSSRGRDYKAYSQSP 110

Query: 119  XXXXXXXXXXXXKKALELIQLSPIKNNRAELQKMYELQQTQ-KRTIRLVIERLVLTNFKS 177
                         + LEL+QLSP+KN+R ELQK+Y+  ++  K+  RL I +LVL NFKS
Sbjct: 111  PRSPGRSPA----RRLELLQLSPVKNSRIELQKLYDSHKSSGKQQGRLFINKLVLDNFKS 166

Query: 178  YAGRQVVGPFHTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLKDLIHKSEKYPE 237
            YAGRQVVGPFHT+FSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQ +L DLIHKSE +P+
Sbjct: 167  YAGRQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEAFPD 226

Query: 238  LSSCSVEIHFQYVIDDPNGGPSKIDESKEKLVVMRKAFKNNSSKYYINDKESSFTQVTTL 297
            L +CSV +HF+Y+ID+P+G  S+IDE K  LV+ R+AFKNNSSKYYIN+KESS+T+VT L
Sbjct: 227  LQACSVAVHFEYIIDEPSG-TSRIDEEKPGLVITRRAFKNNSSKYYINEKESSYTEVTKL 285

Query: 298  LKNEGIDLDHKRFLILQGEVENIAQMKPKSEKEGDDGLLEYLEDIIGTSHYKVQIEHNLS 357
            LK EGIDLDHKRFLILQGEVENIAQMKPK+EKE DDGLLEYLEDIIGT++YK  IE  LS
Sbjct: 286  LKKEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTANYKPLIEERLS 345

Query: 358  KVEALNEICIEKENRFNIVEKEKDSLVDGKNEALKYLANEKNLVLAKSKKYQHQLYIDNK 417
            ++E+LNEIC+EK NRF IV++EK+SL  GK  AL++L  EK L L KSK  Q ++   N 
Sbjct: 346  QIESLNEICLEKANRFEIVDREKNSLESGKETALEFLKKEKQLTLLKSKLLQFKMLQSNS 405

Query: 418  KLTSTLAKITDAQENYDKELEKYSTISKELKNLQDEEITLNKRLNETKKYEEKLLSNQRK 477
            KL STL KI+     ++ E +K+    +E+  ++ +   +  R++ +   E+ L   +R+
Sbjct: 406  KLASTLEKISSLNREFESEKKKFQESLREVDEVKAQHKDIKDRISSSTSREKTLSLEKRE 465

Query: 478  NNSELISTQEMIKNIEKKKDNAEKLVNTTEKSITQTNNKLETLNNQQEDYTKQXXXXXXX 537
                 +S +E  KN+  K   AEK + +T+ SI+++ +  + L  QQ ++ K+       
Sbjct: 466  LEGSRVSLEERTKNLVNKMGKAEKALKSTKHSISESEHMFQELQRQQTEHEKEIKDLNQS 525

Query: 538  XXXXXXXXXXXXXXXXGKTEQFSNEILKNEKELEPYQIQLQEKMXXXXXXXXXXXXXXXX 597
                             KT+  S +I+++EKE EP+ +QLQEK                 
Sbjct: 526  LEEERIILDDIKLSLKDKTKDISAKIIRHEKESEPWDLQLQEKKSQIQLAESELSLLEET 585

Query: 598  KDNXXXXXXXXXXXXXXXXXXVVRMSEKITGWKQQLLEQRKEVESGDIEFNKFTKKIQEM 657
            +                       +   +    Q+L         G+ +F     K++EM
Sbjct: 586  RAKLKKNAEALEEKIISKKQRKQELQGLVLDLSQRLKSLIDGRSQGERDFRSAHLKLKEM 645

Query: 658  RDKLDSHRQKANDSRTSLSNVQNKNSVLTALFKLQKSGRISGFYGRLGDLGVIDEKYDVA 717
            +  L++HRQ+A ++R+SLS  QNKN VLTAL KLQKSGRI+GF+GRLGDLGVID  +DVA
Sbjct: 646  QRILNAHRQRAMEARSSLSKAQNKNMVLTALSKLQKSGRINGFHGRLGDLGVIDNSFDVA 705

Query: 718  ISTACPRLEDLVVDSVDCGQQCIDYLRKNRLGYARFILLDKLRKFNLNRIETPDNAPRLF 777
            ISTACPRL+D+VVD+V+C Q CIDYLRKN+LGYARFILLD+LRKFNL  I TP+N PRLF
Sbjct: 706  ISTACPRLDDVVVDTVECAQHCIDYLRKNKLGYARFILLDRLRKFNLQPISTPENVPRLF 765

Query: 778  DLIQVREDKFLPAFYSVLRDTLVATNLLHANKVAYGKRRFRVVTLDGKLIDISGTMSGGG 837
            D+++ ++ KF  AFYSVL+DTLVA +L  ANKVAYGKRRFRVVT+DGKLIDISGTMSGGG
Sbjct: 766  DVVKPKDPKFSNAFYSVLKDTLVARDLKQANKVAYGKRRFRVVTVDGKLIDISGTMSGGG 825

Query: 838  NYVLRGLMKLGQDLPENDFEQTSPEEVQKLERELEILEKNFKVAYNSLKEMNQEILHMKE 897
            N+V++GLM+LG +   ++ E  +PEEV K+E EL   EKNF+VA +++ EM +E+  +++
Sbjct: 826  NHVMKGLMRLGTN-QSDEIEDYTPEEVIKIEHELAEREKNFRVANDTVHEMEEELKKVRD 884

Query: 898  QIPATELNISKTTIEIEYCENEIKQLISQLKEKQEIHDQESNNNDEIKVADDKLQALKKE 957
            Q P  E  IS+  +E +   +E+     Q KE +  +D+  N   ++      L+ L+ E
Sbjct: 885  QEPDLESQISRAEMEADSLTSELMLAEQQAKEAKMAYDKAVNEKTQVNEVMKNLEHLRGE 944

Query: 958  YYSLNDQTKVTKQEIEKLRQQIMDAGGIELKMQNSKVTSLVNQLKIVNSKQKNDKSAIXX 1017
            Y  L  +T+  K++I+ L+ QIM  GG +L  QNSKV SL  ++ I+  K K  KS I  
Sbjct: 945  YEDLQSETRTKKEQIKILQDQIMKIGGTKLHTQNSKVGSLCQRIDILVIKLKKVKSGIKK 1004

Query: 1018 XXXXXXXXXXXXXTTKDNSLEFKTNLENSKKKVTLLSEEL------------AKLESDIN 1065
                          ++ + L+++  L+N ++   L S EL            A  E+D N
Sbjct: 1005 --------------SEGDVLKYQKQLKNFEQDEELSSNELKVIEEKLKQTKLALTENDTN 1050

Query: 1066 DTQ--NAKEEILLNIDGNKEKAQELEEDSRNFKSFXXXXXXXXXXXXXXXXXXXXQIGKL 1123
             T+  N K E+    +  KE+  E+EE+   FKS                     +I + 
Sbjct: 1051 MTEISNLKSELKDQGEQLKERLTEMEENIDEFKSLEIEMKNKLEKLNSLLIHIKNEIKQQ 1110

Query: 1124 DTELNALTIREISQNLESFDERLEKYDISKNGATEDT---QHTSSALNSVSNI------- 1173
            D ELN L+IR+++  L+  D    + D+ ++G  ++    Q   S +     I       
Sbjct: 1111 DKELNDLSIRDVTHTLQMLDNN--QMDVVEDGIKDEQDADQDKPSGIPDDEKIQEKDDAD 1168

Query: 1174 -NTDTMDIDSTDNEINPGIKRLSELEINELDIESLDAEIENLEEQLEHSTANIEILEEYV 1232
             N  +M+ID   +EI+ GI +L E E+ +LDIE L+++I  L   +  ++ +I +LEEYV
Sbjct: 1169 NNHHSMNIDEMSSEISRGIPKLCEEELKDLDIELLESDISGLTCYINETSVDIGVLEEYV 1228

Query: 1233 RRLSEYKKRKSDLDESISEKETAKEETEVLKKKRLEEFTTGFDIISLTLKEMYQMITMGG 1292
            RRL E+K+RK DL++++ +++  KE+ E+LKK R +EF  GF+IIS+TLKEMYQMITMGG
Sbjct: 1229 RRLIEFKRRKLDLNQAVQKRDEVKEQLEILKKNRFDEFMNGFNIISMTLKEMYQMITMGG 1288

Query: 1293 NAELELVDSLDPFSEGVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYV 1352
            NAELELVDSLDPFSEGVTFSVMPPKKSWRNI+NLSGGEKTLSSLALVFALHKY+PTPLYV
Sbjct: 1289 NAELELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYRPTPLYV 1348

Query: 1353 MDEIDAALDFRNVSIVANYIKERTKDAQLIVISLRNNMFELSKQLVGIYKSENMTQSATL 1412
            MDEIDAALDFRNVSIVANYIKERTK+AQ IVISLRNNMFEL++QL+GIYK +N T+S T+
Sbjct: 1349 MDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLIGIYKRDNRTKSTTV 1408

Query: 1413 VNNDMLNRD 1421
             N D+L RD
Sbjct: 1409 KNIDILKRD 1417

>YLR086W Chr12 (302243..306499) [4257 bp, 1418 aa] {ON}  SMC4Subunit
            of the condensin complex; reorganizes chromosomes during
            cell division; forms a complex with Smc2p that has
            ATP-hydrolyzing and DNA-binding activity; required for
            tRNA gene clustering at the nucleolus; potential Cdc28p
            substrate
          Length = 1418

 Score = 1242 bits (3213), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 690/1390 (49%), Positives = 923/1390 (66%), Gaps = 49/1390 (3%)

Query: 59   PQSQDRHGRSRTPRKLIVSSADHRFTMSQP-NLLSADSQTPSLQHPSVST-GREHKFYXX 116
            P  +  + +S TPRKL++SS ++R+  SQP N  +     P+LQ P  S+ GR+HK Y  
Sbjct: 49   PALEASYSKSYTPRKLVLSSGENRYAFSQPTNSTTTSLHVPNLQPPKTSSRGRDHKSYSQ 108

Query: 117  XXXXXXXXXXXXXXKKALELIQLSPIKNNRAELQKMYELQQTQ-KRTIRLVIERLVLTNF 175
                           + LEL+QLSP+KN+R ELQK+Y+  Q+  K+  RL I  LVL NF
Sbjct: 109  SPPRSPGRSPT----RRLELLQLSPVKNSRVELQKIYDRHQSSSKQQSRLFINELVLENF 164

Query: 176  KSYAGRQVVGPFHTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLKDLIHKSEKY 235
            KSYAG+QVVGPFHT+FSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQ +L DLIHKSE +
Sbjct: 165  KSYAGKQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEAF 224

Query: 236  PELSSCSVEIHFQYVIDDPNGGPSKIDESKEKLVVMRKAFKNNSSKYYINDKESSFTQVT 295
            P L SCSV +HFQYVID+ + G S+IDE K  L++ RKAFKNNSSKYYIN+KESS+T+VT
Sbjct: 225  PSLQSCSVAVHFQYVIDE-SSGTSRIDEEKPGLIITRKAFKNNSSKYYINEKESSYTEVT 283

Query: 296  TLLKNEGIDLDHKRFLILQGEVENIAQMKPKSEKEGDDGLLEYLEDIIGTSHYKVQIEHN 355
             LLKNEGIDLDHKRFLILQGEVENIAQMKPK+EKE DDGLLEYLEDIIGT++YK  IE  
Sbjct: 284  KLLKNEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTANYKPLIEER 343

Query: 356  LSKVEALNEICIEKENRFNIVEKEKDSLVDGKNEALKYLANEKNLVLAKSKKYQHQLYID 415
            + ++E LNE+C+EKENRF IV++EK+SL  GK  AL++L  EK L L +SK +Q +L   
Sbjct: 344  MGQIENLNEVCLEKENRFEIVDREKNSLESGKETALEFLEKEKQLTLLRSKLFQFKLLQS 403

Query: 416  NKKLTSTLAKITDAQENYDKELEKYSTISKELKNLQDEEITLNKRLNETKKYEEKLLSNQ 475
            N KL STL KI+ + ++ + E  K+    K++  ++ +   +  R++     E+ L+  +
Sbjct: 404  NSKLASTLEKISSSNKDLEDEKMKFQESLKKVDEIKAQRKEIKDRISSCSSKEKTLVLER 463

Query: 476  RKNNSELISTQEMIKNIEKKKDNAEKLVNTTEKSITQTNNKLETLNNQQEDYTKQXXXXX 535
            R+     +S +E  KN+  K + AEK + +T+ SI++  N LE L  QQ ++  +     
Sbjct: 464  RELEGTRVSLEERTKNLVSKMEKAEKTLKSTKHSISEAENMLEELRGQQTEHETEIKDLT 523

Query: 536  XXXXXXXXXXXXXXXXXXGKTEQFSNEILKNEKELEPYQIQLQEKMXXXXXXXXXXXXXX 595
                               KT+  S EI+++EKELEP+ +QLQEK               
Sbjct: 524  QLLEKERSILDDIKLSLKDKTKNISAEIIRHEKELEPWDLQLQEKESQIQLAESELSLLE 583

Query: 596  XXKDNXXXXXXXXXXXXXXXXXXVVRMSEKITGWKQQLLEQRKEVESGDIEFNKFTKKIQ 655
              +                       + + I   K++L   + E   G+  F     K++
Sbjct: 584  ETQAKLKKNVETLEEKILAKKTHKQELQDLILDLKKKLNSLKDERSQGEKNFTSAHLKLK 643

Query: 656  EMRDKLDSHRQKANDSRTSLSNVQNKNSVLTALFKLQKSGRISGFYGRLGDLGVIDEKYD 715
            EM+  L++HRQ+A ++R+SLS  QNK+ VLTAL +LQKSGRI+GF+GRLGDLGVID+ +D
Sbjct: 644  EMQKVLNAHRQRAMEARSSLSKAQNKSKVLTALSRLQKSGRINGFHGRLGDLGVIDDSFD 703

Query: 716  VAISTACPRLEDLVVDSVDCGQQCIDYLRKNRLGYARFILLDKLRKFNLNRIETPDNAPR 775
            VAISTACPRL+D+VVD+V+C Q CIDYLRKN+LGYARFILLD+LR+FNL  I TP+N PR
Sbjct: 704  VAISTACPRLDDVVVDTVECAQHCIDYLRKNKLGYARFILLDRLRQFNLQPISTPENVPR 763

Query: 776  LFDLIQVREDKFLPAFYSVLRDTLVATNLLHANKVAYGKRRFRVVTLDGKLIDISGTMSG 835
            LFDL++ +  KF  AFYSVLRDTLVA NL  AN VAYGK+RFRVVT+DGKLIDISGTMSG
Sbjct: 764  LFDLVKPKNPKFSNAFYSVLRDTLVAQNLKQANNVAYGKKRFRVVTVDGKLIDISGTMSG 823

Query: 836  GGNYVLRGLMKLGQDLPENDFEQTSPEEVQKLERELEILEKNFKVAYNSLKEMNQEILHM 895
            GGN+V +GLMKLG +   +  +  +PEEV K+EREL   E NF+VA +++ EM +E+  +
Sbjct: 824  GGNHVAKGLMKLGTN-QSDKVDDYTPEEVDKIERELSERENNFRVASDTVHEMEEELKKL 882

Query: 896  KEQIPATELNISKTTIEIEYCENEIKQLISQLKEKQEIHDQESNNNDEIKVADDKLQALK 955
            ++  P  E  ISK  +E +   +E+     Q+KE +  + +  ++  ++ V    L+ L+
Sbjct: 883  RDHEPDLESQISKAEMEADSLASELTLAEQQVKEAEMAYVKAVSDKAQLNVVMKNLERLR 942

Query: 956  KEYYSLNDQTKVTKQEIEKLRQQIMDAGGIELKMQNSKVTSLVNQLKIVNSKQKNDKSAI 1015
             EY  L  +TK  K++I+ L+ +IM  GGI+L+MQNSKV S+  +L I+ +K K  KSA 
Sbjct: 943  GEYNDLQSETKTKKEKIKGLQDEIMKIGGIKLQMQNSKVESVCQKLDILVAKLKKVKSA- 1001

Query: 1016 XXXXXXXXXXXXXXXTTKDNSLEFKTNLENSKKKVTLLSEELAKLE-------------- 1061
                            +  + ++F+  L+NS++ V L S+EL  +E              
Sbjct: 1002 -------------SKKSGGDVVKFQKLLQNSERDVELSSDELKVIEEQLKHTKLALAEND 1048

Query: 1062 SDINDTQNAKEEILLNIDGNKEKAQELEEDSRNFKSFXXXXXXXXXXXXXXXXXXXXQIG 1121
            +++N+T N K E+    +  KE+ +++EE    FKS                     +I 
Sbjct: 1049 TNMNETLNLKVELKEQSEQLKEQMEDMEESINEFKSIEIEMKNKLEKLNSLLTYIKSEIT 1108

Query: 1122 KLDTELNALTIREISQNLESFDE-RLE--KYDISKNGATEDTQHTSSALNSVSNI----- 1173
            + +  LN L+IR+++  L   D+ +++  K D+ KN    D ++ S      S I     
Sbjct: 1109 QQEKGLNELSIRDVTHTLGMLDDNKMDSVKEDV-KNNQELDQEYRSCETQDESEIKDAET 1167

Query: 1174 ---NTDTMDIDSTDNEINPGIKRLSELEINELDIESLDAEIENLEEQLEHSTANIEILEE 1230
               N   M+ID T +E++ GI RLSE E+ ELD+E ++++I  L   +E +  +I +LEE
Sbjct: 1168 SCDNYHPMNIDETSDEVSRGIPRLSEDELRELDVELIESKINELSYYVEETNVDIGVLEE 1227

Query: 1231 YVRRLSEYKKRKSDLDESISEKETAKEETEVLKKKRLEEFTTGFDIISLTLKEMYQMITM 1290
            Y RRL+E+K+RK DL+ ++ +++  KE+  +LKKKR +EF  GF+IIS+TLKEMYQMITM
Sbjct: 1228 YARRLAEFKRRKLDLNNAVQKRDEVKEQLGILKKKRFDEFMAGFNIISMTLKEMYQMITM 1287

Query: 1291 GGNAELELVDSLDPFSEGVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPL 1350
            GGNAELELVDSLDPFSEGVTFSVMPPKKSWRNI+NLSGGEKTLSSLALVFALHKYKPTPL
Sbjct: 1288 GGNAELELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPL 1347

Query: 1351 YVMDEIDAALDFRNVSIVANYIKERTKDAQLIVISLRNNMFELSKQLVGIYKSENMTQSA 1410
            YVMDEIDAALDFRNVSIVANYIKERTK+AQ IVISLRNNMFEL++QLVG+YK +N T+S 
Sbjct: 1348 YVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGVYKRDNRTKST 1407

Query: 1411 TLVNNDMLNR 1420
            T+ N D+LNR
Sbjct: 1408 TIKNIDILNR 1417

>Suva_10.170 Chr10 (307316..311566) [4251 bp, 1416 aa] {ON} YLR086W
            (REAL)
          Length = 1416

 Score = 1237 bits (3201), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 695/1465 (47%), Positives = 939/1465 (64%), Gaps = 93/1465 (6%)

Query: 1    MPDSPISKKQKITESRDEDKKXXXXXXXXXXXXXXXRSHVDDADITIGPYQGQEKHIQPQ 60
            M DSP+SK+QK                         R   ++ +++I    G+++    +
Sbjct: 1    MYDSPLSKRQK-------------------------RKTAEEPELSINHGNGEQEPKAEK 35

Query: 61   SQDR---------------HGRSRTPRKLIVSSADHRFTMSQP-NLLSADSQTPSLQHP- 103
              DR               + +S TPRKL++SS ++R+  SQP N  ++    P+LQ P 
Sbjct: 36   QNDRTEKTPDPDSLSLESSYAKSHTPRKLVLSSGENRYAFSQPTNSATSSLHVPNLQPPE 95

Query: 104  SVSTGREHKFYXXXXXXXXXXXXXXXXKKALELIQLSPIKNNRAELQKMYELQQ-TQKRT 162
            + S GR++K Y                 + LEL+QLSP+KN+R ELQK+Y+  Q + ++ 
Sbjct: 96   APSRGRDYKAYSQSPPRSPGRSPT----RRLELLQLSPVKNSRIELQKLYDSHQPSGEQQ 151

Query: 163  IRLVIERLVLTNFKSYAGRQVVGPFHTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQ 222
             RL I++LVL NFKSYAG+QVVGPFHT+FSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQ
Sbjct: 152  GRLFIDKLVLENFKSYAGKQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQ 211

Query: 223  GKLKDLIHKSEKYPELSSCSVEIHFQYVIDDPNGGPSKIDESKEKLVVMRKAFKNNSSKY 282
             +L DLIHKSE++P L SCSV +HF+YV+D+P+G  S+IDE K  LV+ RKAF+NNSSKY
Sbjct: 212  DRLSDLIHKSEEFPNLQSCSVAVHFEYVVDEPSG-TSRIDEEKPGLVITRKAFRNNSSKY 270

Query: 283  YINDKESSFTQVTTLLKNEGIDLDHKRFLILQGEVENIAQMKPKSEKEGDDGLLEYLEDI 342
            YIN KES++TQVT LLKNEGIDLDHKRFLILQGEVENIAQMK K+EKE DDGLLEYLEDI
Sbjct: 271  YINGKESNYTQVTKLLKNEGIDLDHKRFLILQGEVENIAQMKSKAEKESDDGLLEYLEDI 330

Query: 343  IGTSHYKVQIEHNLSKVEALNEICIEKENRFNIVEKEKDSLVDGKNEALKYLANEKNLVL 402
            IGT++YK  IE  LS++E LNEIC+EKENRF IV +EK+SL  GK  AL++L  EK L L
Sbjct: 331  IGTANYKPLIEDRLSQIETLNEICLEKENRFEIVNREKNSLESGKETALEFLEKEKQLTL 390

Query: 403  AKSKKYQHQLYIDNKKLTSTLAKITDAQENYDKELEKYSTISKELKNLQDEEITLNKRLN 462
             KSK +Q +L   N KL STL K +   ++++ E +K+    KE+  ++ +   +  R++
Sbjct: 391  LKSKLFQFKLLQSNSKLASTLEKTSSLNKDFESEKKKFQESLKEVDEVESQRKEIKDRMS 450

Query: 463  ETKKYEEKLLSNQRKNNSELISTQEMIKNIEKKKDNAEKLVNTTEKSITQTNNKLETLNN 522
                 E+ L   +R+  S  +S +E  KN+  K   AEK++ +T  SI++  + LE L+ 
Sbjct: 451  SCASQEKTLALEKRELESTRVSLEERTKNLVNKMGKAEKILKSTNHSISEAEHLLEELHG 510

Query: 523  QQEDYTKQXXXXXXXXXXXXXXXXXXXXXXXGKTEQFSNEILKNEKELEPYQIQLQEKMX 582
            +Q ++  +                        KT+  S EI+++EK+LEP+ +QLQEK  
Sbjct: 511  EQTEHETEVKDLNQSLEEERRILDDIKLSLKDKTKDISAEIIQHEKDLEPWDLQLQEKKS 570

Query: 583  XXXXXXXXXXXXXXXKDNXXXXXXXXXXXXXXXXXXVVRMSEKITGWKQQLLEQRKEVES 642
                           +                       +   I   K+ L         
Sbjct: 571  QIQLAESELSLLEETQVKLKKNAEALEENIAAKKARKQELQGFILDLKKNLKSLIDGRSQ 630

Query: 643  GDIEFNKFTKKIQEMRDKLDSHRQKANDSRTSLSNVQNKNSVLTALFKLQKSGRISGFYG 702
            G+ +F+    K++EM+  L++HRQ+A ++R+SLS  +NK+ VLTAL +LQKSGRI+GF+G
Sbjct: 631  GEKDFSTAHLKLKEMQTILNAHRQRAMEARSSLSKAENKSKVLTALSRLQKSGRINGFHG 690

Query: 703  RLGDLGVIDEKYDVAISTACPRLEDLVVDSVDCGQQCIDYLRKNRLGYARFILLDKLRKF 762
            RLGDLGVID+ +DVAISTACPRL+D+VVD+V+C Q CIDYLRKN+LGYARFILLD+LR+F
Sbjct: 691  RLGDLGVIDDNFDVAISTACPRLDDVVVDTVECAQHCIDYLRKNKLGYARFILLDRLRQF 750

Query: 763  NLNRIETPDNAPRLFDLIQVREDKFLPAFYSVLRDTLVATNLLHANKVAYGKRRFRVVTL 822
            NL  ++TP+N PRLFDL++ ++ KF  AFYSVLRDTLVA +L  AN VAYGKRRFRVVT+
Sbjct: 751  NLQPVDTPENVPRLFDLVKPKDPKFSNAFYSVLRDTLVARDLKQANNVAYGKRRFRVVTI 810

Query: 823  DGKLIDISGTMSGGGNYVLRGLMKLGQDLPENDFEQTSPEEVQKLERELEILEKNFKVAY 882
            DGKLIDISGTMSGGGN+V++GLM++G++  +   +  +PEEV K+E EL   EKNF+VA 
Sbjct: 811  DGKLIDISGTMSGGGNHVVKGLMRIGKNQSDR-MDDYTPEEVNKIENELSEREKNFRVAN 869

Query: 883  NSLKEMNQEILHMKEQIPATELNISKTTIEIEYCENEIKQLISQLKEKQEIHDQESNNND 942
            +++ EM QE+  +++Q P  E  I +  +E +   +E+     Q+KE +  +D+  N+  
Sbjct: 870  DTVHEMEQELKKVRDQEPDMESQILRAEMEADSLASELALAEEQVKEAKMAYDKSVNDTA 929

Query: 943  EIKVADDKLQALKKEYYSLNDQTKVTKQEIEKLRQQIMDAGGIELKMQNSKVTSLVNQLK 1002
            ++      L+ L+ EY  L  +TK  K+ I+ L+ QIM  GG  L++QNSKV SL  ++ 
Sbjct: 930  QLNKIMKILEHLRGEYDDLQAETKTKKERIKALQDQIMKIGGTNLQIQNSKVESLSQRID 989

Query: 1003 IVNSKQKNDKSAIXXXXXXXXXXXXXXXTTKDNSLEFKTNLENSKKKVTLLSEELAKLE- 1061
            I+ +K K  KS I                +  +  +F+  L+N ++ + L S EL  +E 
Sbjct: 990  ILVAKLKKVKSGIKK--------------SVGDVTKFQKQLKNVERDIELSSNELKVIEE 1035

Query: 1062 -------------SDINDTQNAKEEILLNIDGNKEKAQELEEDSRNFKSFXXXXXXXXXX 1108
                         +D+    N K ++    +  KEK  E+E     FKS           
Sbjct: 1036 KSEQIKLDLIKNDTDVTGILNLKSDLEEQSEQLKEKVAEMEGKIDEFKSLEMEMKNKLEK 1095

Query: 1109 XXXXXXXXXXQIGKLDTELNALTIREISQNLESFDERLEKYDI-SKNGATEDTQHTS--- 1164
                       I + + ELN L+IR+++  L   D    + DI  K G  ED Q T+   
Sbjct: 1096 LNSLLTYIKSDIKQQEKELNELSIRDVTHTLLILDNN--QMDILDKEG--EDRQETNQED 1151

Query: 1165 --------SALNSVSNINTDTMDIDSTDNEINPGIKRLSELEINELDIESLDAEIENLEE 1216
                    +      N +   M+ID T +E++ GI RLSE E+ EL+IE L+ +I  L  
Sbjct: 1152 ISGEAKGETQGEEGDNDDRHCMNIDETSDEVSRGIPRLSEDELKELNIELLEGDIGELTC 1211

Query: 1217 QLEHSTANIEILEEYVRRLSEYKKRKSDLDESISEKETAKEETEVLKKKRLEEFTTGFDI 1276
             ++ +  +I +LEEY RRL+E+K+RK DL++++ +++  KE+ E+LKKKR +EF TGF+I
Sbjct: 1212 YIDATNVDIGVLEEYARRLAEFKRRKLDLNQAVQKRDEVKEQLEILKKKRFDEFMTGFNI 1271

Query: 1277 ISLTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNISNLSGGEKTLSSL 1336
            IS+TLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNI+NLSGGEKTLSSL
Sbjct: 1272 ISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSL 1331

Query: 1337 ALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKDAQLIVISLRNNMFELSKQ 1396
            ALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTK+AQ IVISLRNNMFEL++Q
Sbjct: 1332 ALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQ 1391

Query: 1397 LVGIYKSENMTQSATLVNNDMLNRD 1421
            LVG+YK +N T+S T+ N D+LNR+
Sbjct: 1392 LVGVYKRDNRTKSTTVKNIDILNRN 1416

>SAKL0H17094g Chr8 complement(1508021..1512289) [4269 bp, 1422 aa]
            {ON} similar to uniprot|Q12267 Saccharomyces cerevisiae
            YLR086W SMC4 Subunit of the condensin complex which
            reorganizes chromosomes during cell division forms a
            stable complex with Smc2p that has ATP-hydrolyzing and
            DNA- binding activity and promotes knotting of circular
            DNA potential Cdc28p substrate
          Length = 1422

 Score = 1236 bits (3197), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 691/1460 (47%), Positives = 944/1460 (64%), Gaps = 81/1460 (5%)

Query: 1    MPDSPISKKQKITESRDEDKKXXXXXXXXXXXXXXXRSHVDDADITIGPYQGQEKHIQPQ 60
            M DSP++KKQK   +R +D+                          I P  G        
Sbjct: 1    MSDSPLAKKQK---TRTDDRGQIQSNPTVS---------------PIPPVSGSSLMAVKS 42

Query: 61   SQDRHGR--SRTPRKLIVSSADHRFTMSQPNLLSADSQTPSLQHPSVSTGREHKFYXXXX 118
            S  R  R  S TPRKL++ S + ++  SQ    S+    P+LQ P+V   R  +FY    
Sbjct: 43   SPTRQDRLPSPTPRKLVLGSPEKKYAYSQ-PSTSSSLSVPNLQPPNVDGSRGRRFYSQSP 101

Query: 119  XXXXXXXXXXXXKKALELIQLSPIKNNRAELQKMYELQQTQKRTI--RLVIERLVLTNFK 176
                         + LELIQLSP+KNNRAELQK+Y+ +         RL I++L L NFK
Sbjct: 102  PRSPHRSPNRSPTRRLELIQLSPVKNNRAELQKIYDEKNKDGNQCVHRLCIDKLSLHNFK 161

Query: 177  SYAGRQVVGPFHTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLKDLIHKSEKYP 236
            SYAG Q++GPFHT+FSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKL DLIHKSE YP
Sbjct: 162  SYAGTQIIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLSDLIHKSEAYP 221

Query: 237  ELSSCSVEIHFQYVIDDPNGGPSKIDESKEKLVVMRKAFKNNSSKYYINDKESSFTQVTT 296
             L SCSV+IHF+YV+D+ +G  ++ D+ K  +V+ RKAF+NNSSKYYI+ KES++T+VT 
Sbjct: 222  NLESCSVDIHFRYVVDESDG-TTRSDDEKPPMVITRKAFRNNSSKYYIDGKESNYTEVTQ 280

Query: 297  LLKNEGIDLDHKRFLILQGEVENIAQMKPKSEKEGDDGLLEYLEDIIGTSHYKVQIEHNL 356
            LL+++GIDLDHKRFLILQGEVE+I+QMKPK+E+E DDGLLEYLEDIIGT+ YK  IE  L
Sbjct: 281  LLRDQGIDLDHKRFLILQGEVESISQMKPKAERESDDGLLEYLEDIIGTAKYKAGIEAGL 340

Query: 357  SKVEALNEICIEKENRFNIVEKEKDSLVDGKNEALKYLANEKNLVLAKSKKYQHQLYIDN 416
             +++ LN++C+EKENRF +VEKEK+SL  GK+EAL++L  EK+L L KSK  Q+ ++ D 
Sbjct: 341  VEIDTLNDVCVEKENRFELVEKEKNSLESGKDEALEFLEKEKSLTLLKSKLAQYHIWQDQ 400

Query: 417  KKLTSTLAKITDAQENYDKELEKYSTISKELKNLQDEEITLNKRLNETKKYEEKLLSNQR 476
            +KL+ TL KI++  E+  +E  KY    +E+  L++      K++ +  K  + L S +R
Sbjct: 401  RKLSETLGKISELNEHLGQEKAKYDQFQREVAQLRERCNDFKKQMVKLDKEHKDLTSKRR 460

Query: 477  KNNSELISTQEMIKNIEKKKDNAEKLVNTTEKSITQTNNKLETLNNQQEDYTKQXXXXXX 536
              + E  S +E  +N++KK+  AEKL+ +TE S+  + +KLE LNN Q+ Y ++      
Sbjct: 461  LMDREKTSMEEKQRNLDKKRLKAEKLLKSTENSMADSKHKLEELNNSQKQYKEKLLQLNE 520

Query: 537  XXXXXXXXXXXXXXXXXGKTEQFSNEILKNEKELEPYQIQLQEKMXXXXXXXXXXXXXXX 596
                              KT + S EI  +E++LEP+  QLQEK                
Sbjct: 521  SLLEERSKLDEIKLSLRDKTSEISAEIANHERDLEPWNAQLQEKKSQMKLTESQIAILKE 580

Query: 597  XKDNXXXXXXXXXXXXXXXXXXVVRMSEKITGWKQQ-----------LLEQR---KEVES 642
             K+                   ++++  +I  + ++             EQ    K ++ 
Sbjct: 581  SKE--------------KKVQNIIQLKTEIEAFAEKNNVQEIAIHKLQCEQANILKRIDI 626

Query: 643  GDIEFNKFTKKIQEMRDKLDSHRQKANDSRTSLSNVQNKNSVLTALFKLQKSGRISGFYG 702
            G+ E    + K+ EM++ L SHRQ+A ++R++LSNV+NKN VL+AL +LQ+SGRI+GF+G
Sbjct: 627  GEKECGSASSKLGEMKNVLISHRQRAMEARSTLSNVENKNKVLSALIRLQRSGRIAGFHG 686

Query: 703  RLGDLGVIDEKYDVAISTACPRLEDLVVDSVDCGQQCIDYLRKNRLGYARFILLDKLRKF 762
            RLGDLG ID+ YDVAISTACPRL+D+VVD+V+CGQQCI++LRKN+LGYARFI+LDKLRKF
Sbjct: 687  RLGDLGTIDDMYDVAISTACPRLDDIVVDNVECGQQCIEHLRKNKLGYARFIILDKLRKF 746

Query: 763  NLNRIETPDNAPRLFDLIQVREDKFLPAFYSVLRDTLVATNLLHANKVAYGKRRFRVVTL 822
            NL+ I+TP+  PRLFDL++ +  KFLPAFYSVLRDTLV ++L  AN+VAYGKRRFRVVTL
Sbjct: 747  NLSPIQTPETVPRLFDLVRSKNGKFLPAFYSVLRDTLVVSDLKQANRVAYGKRRFRVVTL 806

Query: 823  DGKLIDISGTMSGGGNYVLRGLMKLGQDLPENDFEQTSPEEVQKLERELEILEKNFKVAY 882
            DGKLID SGT+SGGG +V++GLMK  Q  P   +   +PEEVQ +E+EL   EKNF +A 
Sbjct: 807  DGKLIDTSGTLSGGGTHVMKGLMKSKQQ-PGAGY---TPEEVQNIEKELNEREKNFHIAI 862

Query: 883  NSLKEMNQEILHMKEQIPATELNISKTTIEIEYCENEIKQLISQLKEKQEIHDQESNNND 942
             +  +M + +   K++ P  E+ I+K  ++IE    E+K    QLKE +   D  S  + 
Sbjct: 863  ETFHDMEEALKKFKDREPEIEVEIAKRRLDIESSSTELKLKQEQLKELETDRDGGSVEDR 922

Query: 943  EIKVADDKLQALKKEYYSLNDQTKVTKQEIEKLRQQIMDAGGIELKMQNSKVTSLVNQLK 1002
            E+  A+ KLQ L +EY  + ++TK  +Q I  L+++IM  GG +L++QNSKV S+  Q+ 
Sbjct: 923  ELADAESKLQVLSEEYDEIENETKNKQQLINSLKEKIMKIGGTKLQLQNSKVNSINEQIN 982

Query: 1003 IVNSKQKNDKSAIXXXXXXXXXXXXXXXTTKDNSLEFKTNLENSKKKV--TLLSEELAKL 1060
            I++SKQK D++A                    N +E   NLE SK  V  T L  ++ KL
Sbjct: 983  IISSKQKKDRTATKKAENDLKRLENQCREA-SNDIE-SCNLEISKISVLNTELEAKIYKL 1040

Query: 1061 ESDINDTQNAKEEILLNIDGNKEKAQELEEDSRNFKSFXXXXXXXXXXXXXXXXXXXXQI 1120
            ++ +N+T++ KEE+    +  K   +E   ++ +FKS                     +I
Sbjct: 1041 DTSLNETESLKEEVEEEFERVKTNLEEKTNNTSDFKSVEIEINNRLEKLNGLTSHIKKEI 1100

Query: 1121 GKLDTELNALTIREISQNLESF------DERLEKYDISKNGATEDTQHTSSALNSV---- 1170
                 ELN+L IR+I+Q L++       +E  + +++       + +  SS  N++    
Sbjct: 1101 KYNKDELNSLKIRDITQTLQALNEGKLPEENEDDFEVQDEEVQREQREMSSDPNAMDIDE 1160

Query: 1171 -----------SNINTDTMDIDSTDNEINPGIKRLSELEINELDIESLDAEIENLEEQLE 1219
                       ++   D+MDID  +NE + G+ + SE ++  + IE ++ +I+ L   ++
Sbjct: 1161 EQAAEQFQVQQTDGEIDSMDIDEYENETSNGLPKFSEAQLQSIQIEDVELQIDELNHYVD 1220

Query: 1220 HSTANIEILEEYVRRLSEYKKRKSDLDESISEKETAKEETEVLKKKRLEEFTTGFDIISL 1279
            ++  +I++LEEY RRL+EYKKRK DL++++ +++  ++  E LKKKRL++F  GF IIS+
Sbjct: 1221 NAHVDIDVLEEYARRLAEYKKRKLDLNQAVLKRDEVRKNCEELKKKRLDKFMEGFSIISM 1280

Query: 1280 TLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNISNLSGGEKTLSSLALV 1339
            TLKEMYQMITMGGNAELELVDSLDPFSEGV FSVMPPKKSWRNISNLSGGEKTLSSLALV
Sbjct: 1281 TLKEMYQMITMGGNAELELVDSLDPFSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALV 1340

Query: 1340 FALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKDAQLIVISLRNNMFELSKQLVG 1399
            FALHKY+PTPLYVMDEIDAALDFRNVSIVANYIKERTK+AQ IVISLRNNMFEL++QLVG
Sbjct: 1341 FALHKYRPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVG 1400

Query: 1400 IYKSENMTQSATLVNNDMLN 1419
            IYK+ NMT+S TL N D+LN
Sbjct: 1401 IYKNNNMTRSTTLQNIDILN 1420

>KAFR0B02710 Chr2 (545337..549587) [4251 bp, 1416 aa] {ON} Anc_8.259
            YLR086W
          Length = 1416

 Score = 1232 bits (3188), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 682/1386 (49%), Positives = 920/1386 (66%), Gaps = 45/1386 (3%)

Query: 67   RSRTPRKLIVSSADHRFTMSQPNLLSADS-----QTPSLQHP--SVSTGREHKFYXXXXX 119
            +S TPRKL++ SAD+++ +SQP + S+       Q P+LQ P    S GR+ K Y     
Sbjct: 42   KSHTPRKLLLGSADNKYVLSQPIISSSSHGSSSLQVPNLQPPLSQPSRGRDKKAYSQSPP 101

Query: 120  XXXXXXXXXXXKKALELIQLSPIKNNRAELQKMYELQQTQKRTIRLVIERLVLTNFKSYA 179
                        + LELIQLSPIKNNR ELQK+Y  +   K  +RL I++LVL +FKSYA
Sbjct: 102  RSPGRSPV----RKLELIQLSPIKNNRIELQKLYNSKNQNK--VRLYIDKLVLQDFKSYA 155

Query: 180  GRQVVGPFHTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLKDLIHKSEKYPELS 239
            G Q+VGPF+T+FSA+VGPNGSGKSNVIDSMLFVFGFRANKMRQ +L DLIHKSE +P + 
Sbjct: 156  GTQIVGPFNTSFSAIVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLGDLIHKSEAFPNIQ 215

Query: 240  SCSVEIHFQYVIDDPNGGPSKIDESKEKLVVMRKAFKNNSSKYYINDKESSFTQVTTLLK 299
            SCSVE+HFQYVID+ N G SKI E ++ LVVMRKAFKNNSSKYYIN KES++T+VT LLK
Sbjct: 216  SCSVEVHFQYVIDE-NDGTSKIIEDRKPLVVMRKAFKNNSSKYYINGKESNYTEVTRLLK 274

Query: 300  NEGIDLDHKRFLILQGEVENIAQMKPKSEKEGDDGLLEYLEDIIGTSHYKVQIEHNLSKV 359
             EGIDLDHKRFLILQGEVENIAQMK K+EKEGDDGLLEYLEDIIGTS YK  IE  + ++
Sbjct: 275  EEGIDLDHKRFLILQGEVENIAQMKAKAEKEGDDGLLEYLEDIIGTSKYKTLIEDKMVEI 334

Query: 360  EALNEICIEKENRFNIVEKEKDSLVDGKNEALKYLANEKNLVLAKSKKYQHQLYIDNKKL 419
            EALNEIC+EKE RF IVE EK+SL   K+ AL+++A EK L L +SK  Q++LY  N KL
Sbjct: 335  EALNEICVEKEKRFEIVETEKNSLESDKDAALEFIAKEKQLTLLRSKLTQYKLYQTNTKL 394

Query: 420  TSTLAKITDAQENYDKELEKYSTISKELKNLQDEEITLNKRLNETKKYEEKLLSNQRKNN 479
             +TL KI++ +    +E  KY  I  E+     E    N+++N +   E +L+  +R+ +
Sbjct: 395  ATTLDKISNFKNALQEERSKYEKIQSEIDQSTRELREANEKINASVAQERELVQKKREYD 454

Query: 480  SELISTQEMIKNIEKKKDNAEKLVNTTEKSITQTNNKLETLNNQQEDYTKQXXXXXXXXX 539
             + +S +E IKN+ +KK  AEK ++     I +  + L+ L + Q +Y  +         
Sbjct: 455  GQCVSMEERIKNLTQKKTKAEKTLHDKRIEIQKNESILKDLQDYQMNYDSEFSNLQKELD 514

Query: 540  XXXXXXXXXXXXXXGKTEQFSNEILKNEKELEPYQIQLQEKMXXXXXXXXXXXXXXXXKD 599
                           KT+  S++I   EK++EP+  ++QEK                 + 
Sbjct: 515  KERSKLDDIKLSLKDKTKDISSQISLYEKDIEPWVSKIQEKQVQIQLAESEISLLKESQA 574

Query: 600  NXXXXXXXXXXXXXXXXXXVVRMSEKITGWKQQLLEQRKEVESGDIEFNKFTKKIQEMRD 659
                               +   +  I   K++ +  +KEV  G+ E ++  +K +EMR 
Sbjct: 575  KLKEGLGSLKVEIDDVRKEIDNKNSIIENLKKEQVSLKKEVSLGESECSRAKEKEKEMRV 634

Query: 660  KLDSHRQKANDSRTSLSNVQNKNSVLTALFKLQKSGRISGFYGRLGDLGVIDEKYDVAIS 719
             L+SHRQ+A D+R++L   +NK++VL+AL +LQKSGRI+GF+GRLGDLGVI +KYD+AIS
Sbjct: 635  ILNSHRQRAIDARSALHMAENKSTVLSALTRLQKSGRINGFHGRLGDLGVIADKYDIAIS 694

Query: 720  TACPRLEDLVVDSVDCGQQCIDYLRKNRLGYARFILLDKLRKFNLNRIETPDNAPRLFDL 779
            TAC RL+D+VVDSV+CGQQCI+YLRKN+LGYARFILLDKLR F L +++TP+N  RLFDL
Sbjct: 695  TACSRLDDIVVDSVECGQQCIEYLRKNKLGYARFILLDKLRNFQLGQLQTPENVLRLFDL 754

Query: 780  IQVREDKFLPAFYSVLRDTLVATNLLHANKVAYGKRRFRVVTLDGKLIDISGTMSGGGNY 839
            +Q  + KF  AFYSVLRDTLVAT++  AN+VAYGKRR+RVVTLDGKLIDISGTM+GGG++
Sbjct: 755  VQPIDLKFSNAFYSVLRDTLVATDIRQANRVAYGKRRYRVVTLDGKLIDISGTMTGGGSH 814

Query: 840  VLRGLMKLGQDLPENDFEQTSPEEVQKLERELEILEKNFKVAYNSLKEMNQEILHMKEQI 899
            V +GLMKL     E+  E     +V+K+ER+L   E NFK+A+++L+EMN E+  ++++ 
Sbjct: 815  VSKGLMKLKNSNMEH-LEVYEAGDVEKIERDLAERENNFKIAHDTLQEMNNELKRLQDKE 873

Query: 900  PATELNISKTTIEIEYCENEIKQLISQLKEKQEIHDQESNNNDEIKVADDKLQALKKEYY 959
            P  EL I+K  ++++   +++     QLKE ++ +    N  D +  A+  LQ L+ E+ 
Sbjct: 874  PEIELEIAKLLMDVDSLNDQLNLKEQQLKELEKNYTDVINKKDPLDRAEAFLQTLRNEHR 933

Query: 960  SLNDQTKVTKQEIEKLRQQIMDAGGIELKMQNSKVTSLVNQLKIVNSKQKNDKSAIXXXX 1019
            +L DQ++  K++I  L+++IM  GG EL++QNSKV+SL  ++ IVN+K K DK+ I    
Sbjct: 934  ALEDQSQSKKEKINTLKEEIMKIGGKELQIQNSKVSSLTERIGIVNAKHKKDKATIKRTE 993

Query: 1020 XXXXXXXXXXXTTKDNSLEFKTNLENSKKKVTLLSEELAKLESDINDTQNAKEEILLNID 1079
                         + ++     +LE  +  V  +   L + E++ +   N K+++    +
Sbjct: 994  KELQKVQRLFKQAELDNTACVNDLETLQTNVIAIRTRLQETEAEFDIILNEKDDLTGQCE 1053

Query: 1080 GNKEKAQELEEDSRNFKSFXXXXXXXXXXXXXXXXXXXXQIGKLDTELNALTIREISQNL 1139
              KEK +++EE    +KSF                     I  L+ EL +  +R+++Q+L
Sbjct: 1054 SLKEKIKDMEESMNEYKSFEIEIKNKLEKLNSLLDYCKKDIRSLNQELQSYHVRDVTQSL 1113

Query: 1140 E------------------------SFDERLEKYD--ISKNGATEDTQHTSSALNSVSNI 1173
            E                        S    ++K+D  IS   A  D+Q+           
Sbjct: 1114 EKIQNENANNSVGVKQSSNNLDVSSSHTPNVDKHDDEISMEDADNDSQNEIEEKEQ---- 1169

Query: 1174 NTDTMDIDSTDNEINPGIKRLSELEINELDIESLDAEIENLEEQLEHSTANIEILEEYVR 1233
            + D MD+D+   E++ GI +L++ ++  +D++SL++EI  L++ +E+S A+IE+LEEY+R
Sbjct: 1170 DADIMDLDNVTEEVSKGIPKLTDDDLKSIDLDSLESEINQLQDYVENSNADIELLEEYIR 1229

Query: 1234 RLSEYKKRKSDLDESISEKETAKEETEVLKKKRLEEFTTGFDIISLTLKEMYQMITMGGN 1293
            RL E+KKRK DL+ +++ ++  ++E E LKK R +EF  GF IISLTLKEMYQMITMGGN
Sbjct: 1230 RLEEFKKRKLDLNTTVARRDEVRDELEKLKKTRHDEFMEGFSIISLTLKEMYQMITMGGN 1289

Query: 1294 AELELVDSLDPFSEGVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVM 1353
            AELELVDSLDPFSEGVTFSVMPPKKSWRNI+NLSGGEKTLSSLALVFALHKYKPTPLYVM
Sbjct: 1290 AELELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVM 1349

Query: 1354 DEIDAALDFRNVSIVANYIKERTKDAQLIVISLRNNMFELSKQLVGIYKSENMTQSATLV 1413
            DEIDAALDFRNVSIVANYIKERTK+AQ IVISLRNNMFEL++QLVGIYK  NMTQSATL 
Sbjct: 1350 DEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKRSNMTQSATLK 1409

Query: 1414 NNDMLN 1419
            N D+LN
Sbjct: 1410 NKDILN 1415

>ZYRO0C01716g Chr3 complement(130331..134572) [4242 bp, 1413 aa] {ON}
            similar to uniprot|Q12267 Saccharomyces cerevisiae
            YLR086W SMC4 Subunit of the condensin complex which
            reorganizes chromosomes during cell division forms a
            stable complex with Smc2p that has ATP-hydrolyzing and
            DNA- binding activity and promotes knotting of circular
            DNA potential Cdc28p substrate
          Length = 1413

 Score = 1213 bits (3139), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 690/1377 (50%), Positives = 925/1377 (67%), Gaps = 25/1377 (1%)

Query: 61   SQDRHGRSRTPRKLIVSSADHRFTMSQPNLLSADSQTPSLQHPSVST-GREHKFYXXXXX 119
            SQ+    ++TPRKL+V + D+R+  S  ++ S+  Q P LQ P+ S+ GR  K Y     
Sbjct: 42   SQNTFAHAKTPRKLVVGNGDNRYAHSSQSISSSSLQVPPLQPPATSSRGRGSKTYSQSPP 101

Query: 120  XXXXXXXXXXXKKALELIQLSPIKNNRAELQKMYELQQTQKRTIRLVIERLVLTNFKSYA 179
                        + LELIQ+SP+KN+R ELQK+Y+ QQ Q R  RL I++L+L +FKSYA
Sbjct: 102  RSPGRSPT----RKLELIQISPLKNSRLELQKIYDAQQNQARHTRLCIDQLILQDFKSYA 157

Query: 180  GRQVVGPFHTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLKDLIHKSEKYPELS 239
            GRQVVGPF+T+FSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQ +L DLIHKSE+YP L 
Sbjct: 158  GRQVVGPFNTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEEYPSLP 217

Query: 240  SCSVEIHFQYVIDDPNGGPSKIDESKEKLVVMRKAFKNNSSKYYINDKESSFTQVTTLLK 299
            SCSVE+HF+YVID+P+G  ++IDE K  LVV RKAF+NN+SKYY+ND+E+++ +VT LLK
Sbjct: 218  SCSVEVHFKYVIDEPSG-ETRIDEEKPNLVVTRKAFRNNTSKYYVNDQETNYGEVTKLLK 276

Query: 300  NEGIDLDHKRFLILQGEVENIAQMKPKSEKEGDDGLLEYLEDIIGTSHYKVQIEHNLSKV 359
             EG+DLDHKRFLILQGEVENIAQMK K+E+EG+DGLLEYLEDIIGT+ YK  IE NL+ +
Sbjct: 277  KEGVDLDHKRFLILQGEVENIAQMKSKAEREGEDGLLEYLEDIIGTAKYKPLIEKNLADM 336

Query: 360  EALNEICIEKENRFNIVEKEKDSLVDGKNEALKYLANEKNLVLAKSKKYQHQLYIDNKKL 419
            E+LN+ICIEKENRF IV++EK+SL +GK EAL +L NE+ L ++KSK YQ+ +   N KL
Sbjct: 337  ESLNDICIEKENRFQIVDREKNSLENGKEEALLFLENERKLTVSKSKLYQYHILNSNMKL 396

Query: 420  TSTLAKITDAQENYDKELEKYSTISKELKNLQDEEITLNKRLNETKKYEEKLLSNQRKNN 479
             +TL KIT+  +  +KE +K +++ KEL  L+     L  +L      E++LL  +R+ +
Sbjct: 397  KNTLDKITNLNQKLEKESDKNASVKKELDKLRAFGDELESKLKNCNNEEKQLLGKKRELD 456

Query: 480  SELISTQEMIKNIEKKKDNAEKLVNTTEKSITQTNNKLETLNNQQEDYTKQXXXXXXXXX 539
             + +  +E IKN EKK+D AEK +++ ++SI+ +  +L  L   Q DY            
Sbjct: 457  GKNVLNEEKIKNFEKKRDKAEKTLSSMDRSISSSEARLSELKQLQVDYENSLKELNEQTE 516

Query: 540  XXXXXXXXXXXXXXGKTEQFSNEILKNEKELEPYQIQLQEKMXXXXXXXXXXXXXXXXKD 599
                           KT   S EI + EKELEP+  QLQEK                 + 
Sbjct: 517  VEKMKLEKIKFSLKDKTNGISLEIAQLEKELEPWNAQLQEKKTQIQLAESQISLIKEAEA 576

Query: 600  NXXXXXXXXXXXXXXXXXXVVRMSEKITGWKQQLLEQRKEVESGDIEFNKFTKKIQEMRD 659
                               +++ S+++     Q    ++E+ +G+ E      +++EM++
Sbjct: 577  KLAQEIDQFKQEIETRKQQILQGSKELDSLHSQHKSVKEEISTGEKECLNARIRLKEMQN 636

Query: 660  KLDSHRQKANDSRTSLSNVQNKNSVLTALFKLQKSGRISGFYGRLGDLGVIDEKYDVAIS 719
             L++ RQKA D+R++LSN +NK+ VLTAL +LQKSGRISGF+GRLGDLGVIDEKYDVAIS
Sbjct: 637  ILNTQRQKALDARSALSNAENKSKVLTALSRLQKSGRISGFHGRLGDLGVIDEKYDVAIS 696

Query: 720  TACPRLEDLVVDSVDCGQQCIDYLRKNRLGYARFILLDKLRKFNLNRIETPDNAPRLFDL 779
            TACPRLED+VV++V+CGQQCI+YLRKN+LGYARFILLDKLRKFNL+ I TP++ PRLFDL
Sbjct: 697  TACPRLEDIVVETVECGQQCIEYLRKNKLGYARFILLDKLRKFNLDSINTPESVPRLFDL 756

Query: 780  IQVREDKFLPAFYSVLRDTLVATNLLHANKVAYGKRRFRVVTLDGKLIDISGTMSGGGNY 839
            I  ++ KF  AF+SVL +TLVA +L  AN+VAYGK+RFRVVTLDG LIDISGTMSGGG+ 
Sbjct: 757  IHPKDPKFSSAFFSVLGNTLVANDLKQANRVAYGKKRFRVVTLDGNLIDISGTMSGGGSR 816

Query: 840  VLRGLMKLGQDLPENDFEQTSPEEVQKLERELEILEKNFKVAYNSLKEMNQEILHMKEQI 899
            V RGLM++ ++  E D E  S EEV +LE  L   EKNF+VA +++ +M +++  +KE+ 
Sbjct: 817  VSRGLMQINRNKTE-DIEIYSSEEVAQLEVNLVEREKNFQVASDTIYQMEEQLKDLKEKE 875

Query: 900  PATELNISKTTIEIEYCENEIKQLISQLKEKQEIHDQESNNNDEIKVADDKLQALKKEYY 959
            PA E NIS+ T+EIE   +EIK    Q+ E +  +    +NN E++     +Q+LK E+ 
Sbjct: 876  PAIENNISQLTMEIESWNSEIKIKEIQMLESERAYSATQDNNVELRETIQHVQSLKDEFK 935

Query: 960  SLNDQTKVTKQEIEKLRQQIMDAGGIELKMQNSKVTSLVNQLKIVNSKQKNDKSAIXXXX 1019
            S+ +QTK  K  IE L+ +IM+ GG ELK+Q+SKV S++ ++ IV SKQK ++S I    
Sbjct: 936  SIQNQTKSKKHRIETLKNEIMEIGGAELKIQSSKVDSVIQRIDIVVSKQKKERSVIKKTE 995

Query: 1020 XXXXXXXXXXXTTKDNSLEFKTNLENSKKKVTLLSEELAKLESDINDTQNAKEEILLNID 1079
                        T  +   F   ++  K  +  L + L K+   +   Q+ KE ++    
Sbjct: 996  NEINKSHKMKLETSRDLENFNQEIQTLKTTIEGLQDSLNKVHESVTSVQHTKEGLIEESR 1055

Query: 1080 GNKEKAQELEEDSRNFKSFXXXXXXXXXXXXXXXXXXXXQIGKLDTELNALTIREISQNL 1139
              ++K  ++ ED   FKSF                    +I   + +L  L IR+++Q L
Sbjct: 1056 TLEDKLNDINEDIAIFKSFEMEMKNELEKLNSLSFHLKKEIKHYEEKLGDLKIRDVTQIL 1115

Query: 1140 ESF-DERLEKYDISKNGATEDTQHTSSALNSVSNINTD----------------TMDIDS 1182
                DE     D S+N  + D + + S++    + N D                 MD++ 
Sbjct: 1116 HDLKDESNNASDPSENPVS-DVEESESSVGEGKDENKDLDAQDQVQDAEKQGDNQMDVED 1174

Query: 1183 TDNEINPGIKRLSELEINELDIESLDAEIENLEEQLEHSTANIEILEEYVRRLSEYKKRK 1242
                 + G+ + SE E++E++IE L+ EIE+L+  L+ S A+I++LEEY RRL E+K R+
Sbjct: 1175 GGEYSDRGLTQFSEDELHEIEIEELEKEIEDLQNFLDASNADIDVLEEYARRLIEFKSRR 1234

Query: 1243 SDLDESISEKETAKEETEVLKKKRLEEFTTGFDIISLTLKEMYQMITMGGNAELELVDSL 1302
             DL++++ E+   KE+ + LKKKR +EF  GF IIS+TLKEMYQMITMGGNAELELVD+L
Sbjct: 1235 LDLNQAVEERNKVKEKLDELKKKRFDEFMQGFGIISMTLKEMYQMITMGGNAELELVDTL 1294

Query: 1303 DPFSEGVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDF 1362
            DPFSEGVTFSVMPPKKSWRNI+NLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDF
Sbjct: 1295 DPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDF 1354

Query: 1363 RNVSIVANYIKERTKDAQLIVISLRNNMFELSKQLVGIYKSENMTQSATLVNNDMLN 1419
            RNVSIVANYIKERTK+AQ IVISLRNNMFEL++QLVGIYK +N T+SAT+ N D ++
Sbjct: 1355 RNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKRDNKTKSATIKNIDFVS 1411

>AGR089C Chr7 complement(901437..905549) [4113 bp, 1370 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YLR086W
            (SMC4)
          Length = 1370

 Score = 1197 bits (3098), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 664/1376 (48%), Positives = 888/1376 (64%), Gaps = 47/1376 (3%)

Query: 70   TPRKLIVSSADHRFTMSQPNLLSADS--QTPSLQHP---SVSTGREHKFYXXXXXXXXXX 124
            TP KL+ +S D +  +S+ + +S     + PSLQ P    +S GR               
Sbjct: 14   TPVKLLATSPDRKNVVSRGSSVSTTMGLRGPSLQPPVAHQISRGRSQ------YSQSPPR 67

Query: 125  XXXXXXKKALELIQLSPIKNNRAELQKMYELQQTQKRTIRLVIERLVLTNFKSYAGRQVV 184
                   +A+ELIQLSPIKN+R ELQ++Y+ +Q  K+  RL I  LVL NFKSYAGRQVV
Sbjct: 68   SPNRSPGRAVELIQLSPIKNSRLELQRLYDTKQ--KKVERLCIRTLVLENFKSYAGRQVV 125

Query: 185  GPFHTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLKDLIHKSEKYPELSSCSVE 244
            GPFH++FSAVVGPNGSGKSNVIDSMLF FGFRANKMRQGKL  LIHKSEKYP+L  CSVE
Sbjct: 126  GPFHSSFSAVVGPNGSGKSNVIDSMLFAFGFRANKMRQGKLSHLIHKSEKYPDLDFCSVE 185

Query: 245  IHFQYVIDDPNGGPSKIDESKEKLVVMRKAFKNNSSKYYINDKESSFTQVTTLLKNEGID 304
            I FQYV+D+P+G  +++   K +L VMRKAFKNN+SKYY+N KES++T+VT LL++EGID
Sbjct: 186  IQFQYVVDEPDGT-TRVLSGKPELSVMRKAFKNNTSKYYLNGKESTYTEVTRLLRDEGID 244

Query: 305  LDHKRFLILQGEVENIAQMKPKSEKEGDDGLLEYLEDIIGTSHYKVQIEHNLSKVEALNE 364
            LDHKRFLILQGEVE+IAQMKPK+E EGDDGLLEYLEDIIGT+ YK QIE  L +V++LN+
Sbjct: 245  LDHKRFLILQGEVESIAQMKPKAEHEGDDGLLEYLEDIIGTTKYKAQIEQALVEVDSLND 304

Query: 365  ICIEKENRFNIVEKEKDSLVDGKNEALKYLANEKNLVLAKSKKYQHQLYIDNKKLTSTLA 424
            IC+EKENRF++VEKEK SL  GK+EAL +L  EK+L L  SKKYQ+ L+ +  KL  TL+
Sbjct: 305  ICMEKENRFDLVEKEKLSLEPGKDEALAFLKKEKDLTLLMSKKYQYHLFHNGSKLAKTLS 364

Query: 425  KITDAQENYDKELEKYSTISKELKNLQDEEITLNKRLNETKKYEEKLLSNQRKNNSELIS 484
             +++     ++E  K     KE+  L D    L  RL       ++ L+  R+   EL+S
Sbjct: 365  NVSNTMNKLEQEKAKKVEAQKEIVELTDASEQLANRLVSMNNTNKESLAKMRQLERELVS 424

Query: 485  TQEMIKNIEKKKDNAEKLVNTTEKSITQTNNKLETLNNQQEDYTKQXXXXXXXXXXXXXX 544
             +E  K++ +K+  AEK +NT EKSI Q  NK+E   +Q ++Y                 
Sbjct: 425  NEEKQKSLLQKRSKAEKTLNTVEKSIKQCENKIEEYISQNQEYETSLTTLNHTIVDAQAE 484

Query: 545  XXXXXXXXXGKTEQFSNEILKNEKELEPYQIQLQEKMXXXXXXXXXXXXXXXXKDNXXXX 604
                      KT   + E+   EKELEP+  +++EK                        
Sbjct: 485  LEKMKLALSDKTGDITKEVAVLEKELEPWTNKVEEKKSEIKLVESEISIIKEADLKLESE 544

Query: 605  XXXXXXXXXXXXXXVVRMSEKITGWKQQLLEQRKEVESGDIEFNKFTKKIQEMRDKLDSH 664
                          +    E I     +    R  +  G+ E      K++EM+  L +H
Sbjct: 545  IANLSQEIEQLRGNISHREESIETLNVESSSIRDYILVGERECTSARSKLEEMKKVLVTH 604

Query: 665  RQKANDSRTSLSNVQNKNSVLTALFKLQKSGRISGFYGRLGDLGVIDEKYDVAISTACPR 724
            RQ+ ND+R+++S+ +NKN VLTAL +LQKSGRI G++GRLGDLG ID+KYD+AISTACPR
Sbjct: 605  RQRVNDARSAVSSAENKNKVLTALSRLQKSGRIDGYHGRLGDLGTIDDKYDIAISTACPR 664

Query: 725  LEDLVVDSVDCGQQCIDYLRKNRLGYARFILLDKLRKFNLNRIETPDNAPRLFDLIQVRE 784
            L+D+VVD+V+CGQQCI++LRKN+LGYARFILLDKLRKFNL    TP+N PRLFDL++ +E
Sbjct: 665  LDDIVVDTVECGQQCIEHLRKNKLGYARFILLDKLRKFNLQPAHTPENVPRLFDLVKPKE 724

Query: 785  DKFLPAFYSVLRDTLVATNLLHANKVAYGKRRFRVVTLDGKLIDISGTMSGGGNYVLRGL 844
             KF PAFYSVLRDTLV T+L  AN+VAYGK+R+RVVTLDGKLIDISGTM+GGG+    GL
Sbjct: 725  PKFAPAFYSVLRDTLVTTDLSQANRVAYGKKRYRVVTLDGKLIDISGTMTGGGDRAASGL 784

Query: 845  MKLGQDLPENDFEQTS---PEEVQKLERELEILEKNFKVAYNSLKEMNQEILHMKEQIPA 901
            MK  Q        Q+S   PEEVQ++E EL   EKNFKVA+ + +EM   + +  ++ P 
Sbjct: 785  MKSTQ--------QSSLYTPEEVQRMEEELNEREKNFKVAFETFQEMESALQNYLDRQPE 836

Query: 902  TELNISKTTIEIEYCENEIKQLISQLKEKQEIHDQESNNNDEIKVADDKLQALKKEYYSL 961
             E+ +SK  ++IE    E++  I +  E +  +     ++ E++ A++KL AL  +  S 
Sbjct: 837  IEVELSKQKMDIETISAELESKIERKLELERSNKTSIEDSSELRTAEEKLAALNADLNSF 896

Query: 962  NDQTKVTKQEIEKLRQQIMDAGGIELKMQNSKVTSLVNQLKIVNSKQKNDKSAIXXXXXX 1021
               ++   Q I++LR +IM+ GG+EL+  NSKV SL  Q+KIV +KQK DK+A       
Sbjct: 897  MSASESKNQRIKELRAKIMEIGGLELQTLNSKVDSLNQQIKIVAAKQKKDKTAQKKAELE 956

Query: 1022 XXXXXXXXXTTKDNSLEFKTNLENSKKKVTLLSEELAKLESDINDTQNAKEEILLNIDGN 1081
                     T KD+       ++  K     +S  + +L+  ++D Q   EEI    D +
Sbjct: 957  LKRARKQQITAKDDIEHCDIEIQKMKSSYDTISTGMQELQKQLSDLQ---EEIGTLTDEH 1013

Query: 1082 KEKAQELEEDSR---NFKSFXXXXXXXXXXXXXXXXXXXXQIGKLDTELNALTIREISQN 1138
                 EL++ +    ++ S                     ++ + D++L+ L +R++ Q 
Sbjct: 1014 AVTKHELDQKNEKIDSYSSIEIELTEQLQKLQNLANYLKKEMNEYDSKLSHLKLRDLGQV 1073

Query: 1139 LESFDERLEKYDISKNGATEDTQ-----------HTSSALNSVSNI----NTDTMDIDST 1183
            +   +E       S +  T DT+           H +S   +   I    N  +M++D  
Sbjct: 1074 MLDLEENKSLQSFS-HSPTPDTKRENIQSSMLETHLASPSPNERKISIAENNLSMEVDEQ 1132

Query: 1184 DNEINPGIKRLSELEINELDIESLDAEIENLEEQLEHSTANIEILEEYVRRLSEYKKRKS 1243
             + +  G+ +L + E+  +D+E L+ +I  L++ +++ST +IEIL+EY +RL+EY++R+ 
Sbjct: 1133 ASVLENGLPKLPDSELARVDLEDLERDIVQLQDYIDNSTVDIEILDEYAKRLAEYRRRRI 1192

Query: 1244 DLDESISEKETAKEETEVLKKKRLEEFTTGFDIISLTLKEMYQMITMGGNAELELVDSLD 1303
            DL+E+I +++  +   EVLKK+RL+EF  GF IIS+TLKEMYQMITMGGNAELELVDSLD
Sbjct: 1193 DLNEAIMKRDETRMHCEVLKKRRLDEFMEGFGIISITLKEMYQMITMGGNAELELVDSLD 1252

Query: 1304 PFSEGVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFR 1363
            PFSEGV FSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFR
Sbjct: 1253 PFSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFR 1312

Query: 1364 NVSIVANYIKERTKDAQLIVISLRNNMFELSKQLVGIYKSENMTQSATLVNNDMLN 1419
            NVSIVANYIKERTK+AQ IVISLRNNMFEL+++LVGIYK+ NMT+S TL N D++N
Sbjct: 1313 NVSIVANYIKERTKNAQFIVISLRNNMFELAQRLVGIYKNSNMTRSTTLQNRDIIN 1368

>NDAI0B01970 Chr2 (479208..483455) [4248 bp, 1415 aa] {ON} Anc_8.259
            YLR086W
          Length = 1415

 Score = 1187 bits (3071), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 671/1372 (48%), Positives = 892/1372 (65%), Gaps = 34/1372 (2%)

Query: 66   GRSRTPRKLIVSSADHRFTMSQPNLLSADSQTPSLQHPSVSTG-----REHKFYXXXXXX 120
             +S TPRKLI+  +D+R+  SQP + ++  Q PSLQ P  S+      R+ K Y      
Sbjct: 53   SKSHTPRKLILHQSDNRYAFSQPTVSASSLQVPSLQPPETSSSSSRGRRDIKVYSQSPPR 112

Query: 121  XXXXXXXXXXKKALELIQLSPIKNNRAELQKMYELQQTQKRTIRLVIERLVLTNFKSYAG 180
                       + LELIQLSP+KNNR  ++K+ EL  +Q +  RL I +LVL NFKSYAG
Sbjct: 113  SPGRSPT----RKLELIQLSPVKNNR--IRKLQELYNSQIKKERLFINKLVLNNFKSYAG 166

Query: 181  RQVVGPFHTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLKDLIHKSEKYPELSS 240
             QV+GPF+TNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQ +L DLIHKSE +P L S
Sbjct: 167  EQVIGPFNTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSESFPNLPS 226

Query: 241  CSVEIHFQYVIDDPNGGPSKIDESKEKLVVMRKAFKNNSSKYYINDKESSFTQVTTLLKN 300
            CSV++ FQYV+D  NG  SKID++K KL++ RKAFKNNSSKY+IN KESS+T+VT LLK 
Sbjct: 227  CSVDVEFQYVVDKSNGS-SKIDDNKPKLIITRKAFKNNSSKYFINGKESSYTEVTKLLKE 285

Query: 301  EGIDLDHKRFLILQGEVENIAQMKPKSEKEGDDGLLEYLEDIIGTSHYKVQIEHNLSKVE 360
            EGIDLDHKRFLILQGEVENIAQMKPK+E+EGDDGLLEYLEDIIGT+ YK  IE N  +V+
Sbjct: 286  EGIDLDHKRFLILQGEVENIAQMKPKAEREGDDGLLEYLEDIIGTADYKSSIEKNTIEVD 345

Query: 361  ALNEICIEKENRFNIVEKEKDSLVDGKNEALKYLANEKNLVLAKSKKYQHQLYIDNKKLT 420
             LNEICIEKENRF IVE+EK+SL   KN AL+++  E+ L L+KSK  Q+ +  +++KL 
Sbjct: 346  TLNEICIEKENRFEIVEREKNSLESSKNAALEFVKKERRLTLSKSKLLQYNILKEHEKLA 405

Query: 421  STLAKITDAQENYDKELEKYSTISKELKNLQDEEITLNKRLNETKKYEEKLLSNQRKNNS 480
            STL K++  QE Y  E  K+    +E   L+D    +NK++   K+  +   S +R+  +
Sbjct: 406  STLQKLSVLQEEYQNESTKFENTQRETNKLEDNFKQMNKKIVSIKEDMKNNTSKKRELQN 465

Query: 481  ELISTQEMIKNIEKKKDNAEKLVNTTEKSITQTNNKLETLNNQQEDYTKQXXXXXXXXXX 540
            +  S +E IK+  +KK+ A K +  ++K +    N++ETLN  Q++              
Sbjct: 466  KKASLEEKIKSYTRKKEKASKSIAQSKKLLKNYRNEIETLNVDQQERESNLQSLLSELKK 525

Query: 541  XXXXXXXXXXXXXGKTEQFSNEILKNEKELEPYQIQLQEKMXXXXXXXXXXXXXXXXKDN 600
                          KT   SNEI ++E+ELEP++ QLQEK                 +  
Sbjct: 526  EKNVLEEIKLSLKDKTTDISNEIAQHERELEPWKKQLQEKKLEIQVAESQISLLQENQSK 585

Query: 601  XXXXXXXXXXXXXXXXXXVVRMSEKITGWKQQLLEQRKEVESGDIEFNKFTKKIQEMRDK 660
                                   EK+   K Q      E + G+ E      KI++M+  
Sbjct: 586  LKDEIEKLKNDLKCQFENKKNQEEKLIDLKVQFSAISTEFDRGESECANAKSKIKDMQHV 645

Query: 661  LDSHRQKANDSRTSLSNVQNKNSVLTALFKLQKSGRISGFYGRLGDLGVIDEKYDVAIST 720
            L + RQK  D+R+ L+ V+NK+ VL+AL KLQKSGRISGFYGRLGDLGVID +YD+AIST
Sbjct: 646  LQTQRQKVMDARSRLATVENKSKVLSALHKLQKSGRISGFYGRLGDLGVIDNEYDIAIST 705

Query: 721  ACPRLEDLVVDSVDCGQQCIDYLRKNRLGYARFILLDKLRKFNLNRIETPDNAPRLFDLI 780
            A  RL+D+VVDSV+CGQ CI+YLRKN+LGYARFILL+KLR   L RI+TP+N  RLFDL+
Sbjct: 706  ASARLDDIVVDSVECGQHCIEYLRKNKLGYARFILLEKLRNLILKRIQTPENVKRLFDLV 765

Query: 781  QVREDKFLPAFYSVLRDTLVATNLLHANKVAYGKRRFRVVTLDGKLIDISGTMSGGGNYV 840
            +  +D F+PAFYSVLR+TLVA +L  AN+VAYG  RFRVVT+DGKLIDISGT++GGG   
Sbjct: 766  KPDKDIFIPAFYSVLRNTLVAKDLKQANRVAYGATRFRVVTMDGKLIDISGTITGGGKQT 825

Query: 841  LRGLMKLGQDLPENDFEQTSPEEVQKLERELEILEKNFKVAYNSLKEMNQEILHMKEQIP 900
             +GLMKL +   EN  +  S ++++K+E+EL   E NFK A ++  EM Q +  +K++ P
Sbjct: 826  AQGLMKLRKKGQEN-IDIYSNDDIEKIEKELVERENNFKFANDTYFEMEQALQRLKDRKP 884

Query: 901  ATELNISKTTIEIEYCENEIKQLISQLKEKQEIHDQESNNNDEIKVADDKLQALKKEYYS 960
              EL ISK  ++ +    E++    QLK+K   +++ + N DE+   + +L  L+KEY  
Sbjct: 885  ELELEISKCLMDTDISSKELESTQDQLKQKITFYERHTQNKDEVVEIEHQLNLLQKEYQL 944

Query: 961  LNDQTKVTKQEIEKLRQQIMDAGGIELKMQNSKVTSLVNQLKIVNSKQKNDKSAIXXXXX 1020
            L D TK   ++I+KL+++IM+ GGI+L+MQNSKV S++  + I+ SKQK   S++     
Sbjct: 945  LLDSTKNISEKIDKLKKRIMEIGGIDLQMQNSKVNSIIQNIDIIKSKQKRGISSMKKIEN 1004

Query: 1021 XXXXXXXXXXTTKDNSLEFKTNLENSKKKVTLLSEELAKLE---SDINDT----QNAKEE 1073
                        +   L+FKT      K++   S+E+  +E     I++T    +N   E
Sbjct: 1005 EIRRSEKALSGAE---LDFKT----CSKEMDSFSQEMESVERSLGSIDETFLKLENENSE 1057

Query: 1074 ILLNIDGNKEKAQELEEDSRNFKSFXXXXXXXXXXXXXXXXXXXXQIGKLDTELNALTIR 1133
            + +     KEK  E E +   FKS+                     I + D +L AL +R
Sbjct: 1058 LEIECCNLKEKINEAEIEGTKFKSYEIDVKDRLEKLNNLLKHIKRVIKEYDEQLRALELR 1117

Query: 1134 EISQNL--ESFDERLEKYDISKNGATEDTQHTSSAL--NSVSNINTDT---MDIDSTDNE 1186
              +     E  +  +   D + +G     Q  +  +  N++ N    T   M+ID   +E
Sbjct: 1118 NTTTIFGDEGDNNSINGVDRTSHGGGVPLQDQNKVVRENNMRNEKNSTEAEMEIDDVADE 1177

Query: 1187 INPGIKRLSELEINELDIESLDAEIENLEEQLEHSTANIEILEEYVRRLSEYKKRKSDLD 1246
             +PGI R+S+ ++ ++D+++L+AEI  LEE +  +  NI++LEEY RRL++Y  RK DL+
Sbjct: 1178 FSPGIPRISKAKLLQIDVQALEAEIGQLEEYVAITNVNIDVLEEYARRLADYNSRKLDLN 1237

Query: 1247 ESISEKETAKEETEVLKKKRLEEFTTGFDIISLTLKEMYQMITMGGNAELELVDSLDPFS 1306
            +++  +E  K+  + LKKKR +EF  GF IIS+TLKEMYQMITMGGNAELEL+DSLDPFS
Sbjct: 1238 QAVERREALKKLLDELKKKRYDEFMQGFGIISMTLKEMYQMITMGGNAELELIDSLDPFS 1297

Query: 1307 EGVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVS 1366
            EGVTFSVMPPKKSWRNI+NLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVS
Sbjct: 1298 EGVTFSVMPPKKSWRNIANLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVS 1357

Query: 1367 IVANYIKERTKDAQLIVISLRNNMFELSKQLVGIYKSENMTQSATLVNNDML 1418
            IVANYIKERTK+AQ IVISLRNNMFEL++QL+GIYK +N T+SA + N D L
Sbjct: 1358 IVANYIKERTKNAQFIVISLRNNMFELAQQLIGIYKRDNKTKSAAIRNKDFL 1409

>Kwal_56.23825 s56 complement(721498..725688) [4191 bp, 1396 aa] {ON}
            YLR086W (SMC4) - SMC chromosomal ATPase family member
            [contig 172] FULL
          Length = 1396

 Score = 1182 bits (3058), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 673/1409 (47%), Positives = 904/1409 (64%), Gaps = 95/1409 (6%)

Query: 64   RHGRSRTPRKLIVSSADHRFTMSQPNLLSADSQTPSLQ----HPSVSTGREHKFYXXXXX 119
            R  RSRTPRKL++ S D RF  SQP + S+ S  P LQ      S S GR +        
Sbjct: 30   RASRSRTPRKLVLGSPDKRFAFSQP-VSSSSSNVPHLQPLKNELSSSRGRVY-------S 81

Query: 120  XXXXXXXXXXXKKALELIQLSPIKNNRAELQKMYELQQTQKRTIRLVIERLVLTNFKSYA 179
                        + LELIQLSP+K +R E QK  E +       RL I+RLVL NFKSYA
Sbjct: 82   QSPPRSPNRSPTRKLELIQLSPMKKSRLESQKFQESRAMMGSIQRLCIDRLVLHNFKSYA 141

Query: 180  GRQVVGPFHTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLKDLIHKSEKYPELS 239
            G QVVGPFH +FSAVVGPNGSGKSNVIDS+LFVFGFRANKMRQGKL +LIHKSE +P+L 
Sbjct: 142  GTQVVGPFHNSFSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQGKLSELIHKSELHPDLD 201

Query: 240  SCSVEIHFQYVIDDPNGGPSKIDESKEKLVVMRKAFKNNSSKYYINDKESSFTQVTTLLK 299
            SC V+I FQYV D+P+G  S I + K  +V+ RKAF+NN+SKYY+N KESS+T +T LL+
Sbjct: 202  SCHVDIFFQYVQDEPDGTTSII-QQKPSMVIRRKAFRNNTSKYYLNGKESSYTIITQLLR 260

Query: 300  NEGIDLDHKRFLILQGEVENIAQMKPKSEKEGDDGLLEYLEDIIGTSHYKVQIEHNLSKV 359
            +EGIDLDHKRFLILQGEVE+IAQMKPK+EKE DDGLLEYLEDIIGT+ YK  IE+ LS++
Sbjct: 261  DEGIDLDHKRFLILQGEVESIAQMKPKAEKESDDGLLEYLEDIIGTAQYKPLIENTLSEI 320

Query: 360  EALNEICIEKENRFNIVEKEKDSLVDGKNEALKYLANEKNLVLAKSKKYQHQLYIDNKKL 419
              LN+IC EKENRF IVE+EK SL  GKNEAL+YL  EK L + +SK  Q+ L+ + +KL
Sbjct: 321  AKLNDICEEKENRFEIVEREKSSLEQGKNEALEYLEKEKTLTILRSKLLQYHLWKNEQKL 380

Query: 420  TSTLAKITDAQENYDKELEKYSTISKELKNLQDEEITLNKRLNETKKYEEKLLSNQRKNN 479
             ST  KI  AQE    E  K +  S+E+  ++ +  +L   L +  + E+KL   +R  +
Sbjct: 381  NSTKEKIAKAQEKLSAEKAKRTKHSEEMAAMKADLQSLKLILGDLGESEKKLTLEKRACD 440

Query: 480  SELISTQEMIKNIEKKKDNAEKLVNTTEKSITQTNNKLETLNNQQEDYTKQXXXXXXXXX 539
             + +S +E +KN+ +K+  + + + +   SI+ T  K+E L N QE + K          
Sbjct: 441  RDRVSLEEKLKNLTQKEVKSSRSLQSITSSISTTQAKMEELANDQEQHEKDLLELNGTMK 500

Query: 540  XXXXXXXXXXXXXXGKTEQFSNEILKNEKELEPYQIQLQEKMXXXXXXXXXXXXXXXXKD 599
                           K    S +I + EKELEP+ ++LQEK                   
Sbjct: 501  EEKEKLDEIKSSLKDKISLISEQIREIEKELEPWNVKLQEKKAQVKLEETTISVFKES-- 558

Query: 600  NXXXXXXXXXXXXXXXXXXVVRMSEKITGWKQQLLEQRKEVES--------------GDI 645
                               ++ +++ I   + ++ EQR  V S              G  
Sbjct: 559  ------------HAKIEQDIILVNKGIDELRNKMNEQRGSVFSLEKEQVDIGRQLTVGQS 606

Query: 646  EFNKFTKKIQEMRDKLDSHRQKANDSRTSLSNVQNKNSVLTALFKLQKSGRISGFYGRLG 705
            E +   KKI+EM+  L +HRQ++ D+R+SLS  +NKN VL AL +LQ+SGRISGF+GRLG
Sbjct: 607  ECDNAVKKIKEMKGILTAHRQRSIDARSSLSTFENKNKVLAALLRLQRSGRISGFHGRLG 666

Query: 706  DLGVIDEKYDVAISTACPRLEDLVVDSVDCGQQCIDYLRKNRLGYARFILLDKLRKFNLN 765
            DLG ID+KYDVAISTACPRL+D+VV++V+CGQQCI+YLRKN+LGYARFILLDKLR FNL+
Sbjct: 667  DLGTIDDKYDVAISTACPRLDDIVVETVECGQQCIEYLRKNKLGYARFILLDKLRNFNLS 726

Query: 766  RIETPDNAPRLFDLIQVREDKFLPAFYSVLRDTLVATNLLHANKVAYGKRRFRVVTLDGK 825
             I+TP+N PRL+DL++    KF  AFYSVLRDTLVA +L  ANKVAYGK+R+RVVTLDGK
Sbjct: 727  PIKTPENVPRLYDLVRPNNPKFRNAFYSVLRDTLVAKDLKEANKVAYGKQRYRVVTLDGK 786

Query: 826  LIDISGTMSGGGNYVLRGLMKLGQDLPENDFEQTSPEEVQKLERELEILEKNFKVAYNSL 885
            LID+SGTMSGGGN+  RG+MK  Q    + F   + EEVQ++++EL   E NF++A ++L
Sbjct: 787  LIDLSGTMSGGGNFKARGMMKSEQQ-SNSAF---TAEEVQQIDKELSEREHNFQIAADTL 842

Query: 886  KEMNQEILHMKEQIPATELNISKTTIEIEYCENEIKQLISQLKEKQEIHDQESNNNDEIK 945
             EM + +  +K++ P  EL+ISK  ++I+   +E+K    +L+   +   Q+ ++N+E+ 
Sbjct: 843  HEMEEALQKLKDREPEIELDISKRKLDIDSLSSEMKASEGRLEYLLQEKAQKESSNEELS 902

Query: 946  VADDKLQALKKEYYSLNDQTKVTKQEIEKLRQQIMDAGGIELKMQNSKVTSLVNQLKIVN 1005
             A+ KL++LK EY  L ++ +  K+E++ L++QIM  GG +L+MQ+S V S+  ++ IV 
Sbjct: 903  TAEVKLKSLKSEYRELENEMQSKKKEMKVLQEQIMKVGGTKLQMQSSMVDSVNQRITIVL 962

Query: 1006 SKQKNDKSAIXXXX--------XXXXXXXXXXXTTKDNSLEFKTNLENSKKKVTLLSEEL 1057
            +K K  K+ +                        +++ SL  + NL++S KKV  LSE +
Sbjct: 963  AKSKKTKTDLKKAQNDIKRYQKQAEQLAEELKSCSQEKSL-IENNLDSSSKKVDELSESI 1021

Query: 1058 AKLESDINDTQNAKEEILLNIDGNKEKAQELEEDSRNFKSFXXXXXXXXXXXXXXXXXXX 1117
             KL+ ++  T+    +   +ID   EK  E     R+F++                    
Sbjct: 1022 NKLKDELELTEERVRKAEESID---EKTVE----GRDFEALEIQCVAQLDKLKELFAILN 1074

Query: 1118 XQIGKLDTELNALTIREISQNLESFDERLE---KYDIS-KNGATEDTQHTSSALNSVSNI 1173
             +  +    LN+L IR+++  L++ DE LE   K +++ +    ED +H+SS        
Sbjct: 1075 KEAAEFLHSLNSLKIRDVTATLQALDESLENESKNEVAAETPGEEDGEHSSSL------- 1127

Query: 1174 NTDTMDID----------------------STDNEINPGIKRLSELEINELDIESLDAEI 1211
              D MD+D                      +T+  +  G+ +L E E+   ++E+++ EI
Sbjct: 1128 -HDPMDVDENQGESTSTTEAQLQAGEAERRNTEESLPNGLPKLLEDELENFEVETVELEI 1186

Query: 1212 ENLEEQLEHSTANIEILEEYVRRLSEYKKRKSDLDESISEKETAKEETEVLKKKRLEEFT 1271
              L++ +E++ A+IEILEEY RRL EYK RK DL+ ++ E++  ++  E LKKKRL+EF 
Sbjct: 1187 HQLQDYVENAYADIEILEEYARRLIEYKARKVDLNHAVQERDKVRQSNENLKKKRLDEFM 1246

Query: 1272 TGFDIISLTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNISNLSGGEK 1331
             GF+ I + LKEMYQMITMGGNAELELVDSLDPFSEGV FSVMPPKKSWRNI+NLSGGEK
Sbjct: 1247 EGFNAICMILKEMYQMITMGGNAELELVDSLDPFSEGVLFSVMPPKKSWRNITNLSGGEK 1306

Query: 1332 TLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKDAQLIVISLRNNMF 1391
            TLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTK+AQ IVISLRNNMF
Sbjct: 1307 TLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMF 1366

Query: 1392 ELSKQLVGIYKSENMTQSATLVNNDMLNR 1420
            EL+KQLVG+YK++NMT+S  L N D+++R
Sbjct: 1367 ELAKQLVGVYKNKNMTKSVALQNTDLIDR 1395

>TPHA0J00720 Chr10 (161017..165198) [4182 bp, 1393 aa] {ON} Anc_8.259
            YLR086W
          Length = 1393

 Score = 1165 bits (3013), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 686/1389 (49%), Positives = 906/1389 (65%), Gaps = 39/1389 (2%)

Query: 49   PYQGQEKHIQP-QSQDRHGRSRTPRKLIVSSADHRFTMSQ--PNLLSADSQTPSLQHPSV 105
            P   Q ++  P Q  +   +S TP K+I+S+ +H  ++S     L+S+ +Q PSLQHPS 
Sbjct: 26   PKIAQSRNDSPLQVANDPLKSYTPMKVIISN-NHSNSISPLPSQLMSSSTQPPSLQHPSS 84

Query: 106  ST-GREHKFYXXXXXXXXXXXXXXXXKKALELIQLSPIKNNRAELQKMYELQQTQKRTIR 164
            S+ GR  K Y                 + LELIQLSPIKN+R+ELQK+Y  +Q +K   R
Sbjct: 85   SSRGRAVKAYSQSPPRSPDRSPVRSPTRKLELIQLSPIKNSRSELQKIYSSKQEEKIE-R 143

Query: 165  LVIERLVLTNFKSYAGRQVVGPFHTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGK 224
            + + +LVL NFKSYAG Q +GPFH++FSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGK
Sbjct: 144  ICLNKLVLHNFKSYAGTQTIGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGK 203

Query: 225  LKDLIHKSEKYPELSSCSVEIHFQYVIDDPNGGPSKIDESKEKLVVMRKAFKNNSSKYYI 284
            L DLIHKSE+YP+L+SC+V++HF+Y+ID P+   +KI+ SK+ L++ R+AFKN++SKYY+
Sbjct: 204  LADLIHKSEEYPDLTSCAVDVHFEYLIDYPDDT-TKINPSKQPLIITRRAFKNSTSKYYL 262

Query: 285  NDKESSFTQVTTLLKNEGIDLDHKRFLILQGEVENIAQMKPKSEKEGDDGLLEYLEDIIG 344
            N KES++  +T LLK EGIDLDH RFLILQGEVENIAQMKPK+EKEGDDGLLEYLEDIIG
Sbjct: 263  NGKESNYKTITALLKEEGIDLDHNRFLILQGEVENIAQMKPKAEKEGDDGLLEYLEDIIG 322

Query: 345  TSHYKVQIEHNLSKVEALNEICIEKENRFNIVEKEKDSLVDGKNEALKYLANEKNLVLAK 404
            T+ YK  I+    ++EALN+ICIE+ENRF+I+++EK+SL   K  AL+YL+ EK  V+ K
Sbjct: 323  TTKYKELIDKKFIEIEALNDICIERENRFDIIDREKESLESEKESALEYLSKEKEQVIVK 382

Query: 405  SKKYQHQLYIDNKKLTSTLAKITDAQENYDKELEKYSTISKELKNLQDEEITLNKR---- 460
            SK  Q++++ +N KL++TL KIT  ++ Y++E  K +    ELKN  DE   L  +    
Sbjct: 383  SKLIQYKIWQNNIKLSNTLEKITKLEDEYNQEKNKNT----ELKNKIDELRKLYTKNQDE 438

Query: 461  LNETKKYEEKLLSNQRKNNSELISTQEMIKNIEKKKDNAEKLVNTTEKSITQTNNKLETL 520
            L    K E++L++ +R  +S+ +S  E +KNIEKK     K +    K+I+ +N +L+  
Sbjct: 439  LQALLKDEKELVNAKRSLDSDNVSNTEQLKNIEKKLKKTAKEIEEDLKTISSSNVRLKNF 498

Query: 521  NNQQEDYTKQXXXXXXXXXXXXXXXXXXXXXXXGKTEQFSNEILKNEKELEPYQIQLQEK 580
            ++ ++ +  Q                        KT   S EILK EK+LEP+ I+L E 
Sbjct: 499  HDNKKLFETQLIELDNNLVTESQLLENIKLDLKDKTVGLSEEILKTEKDLEPWNIKLDEL 558

Query: 581  MXXXXXXXXXXXXXXXXKDNXXXXXXXXXXXXXXXXXXVVRMSEKITGWKQQLLEQRKEV 640
                             K+                        +++     +L    KEV
Sbjct: 559  KSEIQIKESEKALFEESKNKLKANIEALEKDVNEKSKLTEDRRKEVKNLMTKLENVSKEV 618

Query: 641  ESGDIEFNKFTKKIQEMRDKLDSHRQKANDSRTSLSNVQNKNSVLTALFKLQKSGRISGF 700
              G  E  K  +K+ EM+  L   RQKAND+RTSLSNV+N++ VL AL KLQKSGRI+GF
Sbjct: 619  IFGTNELKKANEKLCEMQKILIQDRQKANDARTSLSNVENRSKVLRALLKLQKSGRINGF 678

Query: 701  YGRLGDLGVIDEKYDVAISTACPRLEDLVVDSVDCGQQCIDYLRKNRLGYARFILLDKLR 760
            +GRLG+LGVIDEKYDVAISTACPRL D+VVDSV+CGQQCI+YLRKN LG+ARFILLDKL 
Sbjct: 679  HGRLGNLGVIDEKYDVAISTACPRLNDIVVDSVECGQQCIEYLRKNNLGHARFILLDKLN 738

Query: 761  KFNLNRIETPDNAPRLFDLIQVREDKFLPAFYSVLRDTLVATNLLHANKVAYGKRRFRVV 820
            KF++ +I TP N PRLFDLI+V ++KFLPAFYSVLR+TLVA +L  AN VAYGK R+RVV
Sbjct: 739  KFSMEKISTPRNVPRLFDLIKVNDEKFLPAFYSVLRNTLVANDLKEANAVAYGKTRYRVV 798

Query: 821  TLDGKLIDISGTMSGGGNYVLRGLMKLGQDLPENDFEQTSPEEVQKLERELEILEKNFKV 880
            TL G LIDISGTMSGGGN   +G M+L     + +    S EEV ++E+EL I EKN++ 
Sbjct: 799  TLKGNLIDISGTMSGGGNQASKGAMQLSNSTSK-EKSTYSSEEVMEIEKELSIREKNYQN 857

Query: 881  AYNSLKEMNQEILHMKEQIPATELNISKTTIEIEYCENEIKQLISQLKEKQEIHDQESNN 940
            AYN+++EM  E+ ++KE  P  EL ISK   EI+  ENE      QL E       E N 
Sbjct: 858  AYNTVQEMEIELRNLKESEPKIELEISKLNFEIDSLENECSLKRKQLNEPNASFSIEDNM 917

Query: 941  NDEIKVADDKLQALKKEYYSLNDQTKVTKQEIEKLRQQIMDAGGIELKMQNSKVTSLVNQ 1000
            + +I   D+ L  L ++   +  Q K  K  I++L+ +IM  GGI+L+MQNSKV SL  Q
Sbjct: 918  SADITEMDNALYTLNEKQKLIESQMKSKKDRIKELQDKIMKIGGIKLQMQNSKVDSLQEQ 977

Query: 1001 LKIVNSKQKNDKSAIXXXXXXXXXXXXXXXTTKDNSLEF---KTNLENSKKKVTLLSEEL 1057
             KI+  KQK++K+ I                ++ ++ +    K  LEN  K +    E L
Sbjct: 978  KKILIKKQKSEKAGIMKIESDVRKLSKKLKESESDNTKLNEKKIALENELKNI---EELL 1034

Query: 1058 AKLESDINDTQNAK------EEILLNIDGNKEKAQELEEDSRNFKSFXXXXXXXXXXXXX 1111
            A+ E+++N  Q+ K       EI +N      +  E+E     FK+              
Sbjct: 1035 AQNENNMNCIQDKKFTLREKSEITMN------ELTEMEGLLSEFKTLEVEYKIKSEKLAS 1088

Query: 1112 XXXXXXXQIGKLDTELNALTIREISQNLESFDERLEKYDISKNGATEDTQHTSSALNSVS 1171
                    +  L+ + ++L+IRE++ +L+  + + ++    K     D +   S  N V 
Sbjct: 1089 LLNQIKKILKALEEDHSSLSIREVAYDLDLLNIKEQEAQKIKTELYADFEQNQS--NDVI 1146

Query: 1172 NINTDTMDIDSTDNEINPGIKRLSELEINELDIESLDAEIENLEEQLEHSTANIEILEEY 1231
            N   D M I+  +NEI  GI    E +  + DI SL+AE+  L++  E +  +++ILEEY
Sbjct: 1147 N---DEMIIEDNNNEIAKGIPSYMESDFKQFDISSLEAELVQLQDYFEIAKVDLDILEEY 1203

Query: 1232 VRRLSEYKKRKSDLDESISEKETAKEETEVLKKKRLEEFTTGFDIISLTLKEMYQMITMG 1291
             RR+ EY++RK DL++S+ +++  ++E E LKK R  EF   F+IIS+TLKEMYQ+ITMG
Sbjct: 1204 TRRMIEYRQRKYDLNQSVEQRDKVRKELEDLKKCRFNEFMESFNIISMTLKEMYQIITMG 1263

Query: 1292 GNAELELVDSLDPFSEGVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLY 1351
            GNAELELVDSLDPFSEGVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLY
Sbjct: 1264 GNAELELVDSLDPFSEGVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLY 1323

Query: 1352 VMDEIDAALDFRNVSIVANYIKERTKDAQLIVISLRNNMFELSKQLVGIYKSENMTQSAT 1411
            VMDEIDAALDFRNVSIVANYIKERTK+AQ IVISLRNNMFEL++QLVGIYK+ N T+SAT
Sbjct: 1324 VMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAEQLVGIYKNVNQTKSAT 1383

Query: 1412 LVNNDMLNR 1420
            L NND+L R
Sbjct: 1384 LKNNDILCR 1392

>Ecym_4311 Chr4 complement(666871..671001) [4131 bp, 1376 aa] {ON}
            similar to Ashbya gossypii AGR089C
          Length = 1376

 Score = 1164 bits (3010), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 656/1378 (47%), Positives = 873/1378 (63%), Gaps = 46/1378 (3%)

Query: 70   TPRKLIVSSADHRFTMSQPNLLSADSQT----PSLQHPSVS-TGREHKFYXXXXXXXXXX 124
            TP KL+  S   +   SQ    S++S T    PSLQ P+ S   R    Y          
Sbjct: 15   TPSKLMFGSPGRKHVASQA---SSNSTTALRGPSLQPPTYSQLSRGRSVYSQSPPRSPNR 71

Query: 125  XXXXXXKKALELIQLSPIKNNRAELQKMYELQQTQKRTIRLVIERLVLTNFKSYAGRQVV 184
                   + +ELIQLSPIKN+R ELQK+Y+ +QT   T RL I+ L+L NFKSYAG QVV
Sbjct: 72   SPA----RRIELIQLSPIKNSRLELQKIYDGKQTT--TKRLSIKNLILNNFKSYAGVQVV 125

Query: 185  GPFHTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLKDLIHKSEKYPELSSCSVE 244
            GPFH++FSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKL +LIHKSE +  LS CSVE
Sbjct: 126  GPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLSNLIHKSENHENLSFCSVE 185

Query: 245  IHFQYVIDDPNGGPSKIDESKEKLVVMRKAFKNNSSKYYINDKESSFTQVTTLLKNEGID 304
            I FQYV+DD +G  +K+    ++L VMRK FKNN+SKYYIN KESS+T+VT  L+NEGID
Sbjct: 186  ITFQYVMDDADGN-TKVLPDVQELSVMRKVFKNNTSKYYINGKESSYTEVTQFLRNEGID 244

Query: 305  LDHKRFLILQGEVENIAQMKPKSEKEGDDGLLEYLEDIIGTSHYKVQIEHNLSKVEALNE 364
            LDHKRFLILQGEVE+IAQMKPK++ EGDDGLLEYLEDIIGT+ YK QI   L +++ LN+
Sbjct: 245  LDHKRFLILQGEVESIAQMKPKADHEGDDGLLEYLEDIIGTAKYKSQIRDALVEMDTLND 304

Query: 365  ICIEKENRFNIVEKEKDSLVDGKNEALKYLANEKNLVLAKSKKYQHQLYIDNKKLTSTLA 424
            IC+EKE RF +VEKEK SL  GK +AL+++A EK L L KSK+ Q  +  + KKL  TL 
Sbjct: 305  ICMEKEIRFELVEKEKRSLEAGKEQALEFIAKEKQLTLLKSKQLQWDINKETKKLAVTLD 364

Query: 425  KITDAQENYDKELEKYSTISKELKNLQDEEITLNKRLNETKKYEEKLLSNQRKNNSELIS 484
            KI+   E  + E  KY  + KE+ +L++    L +++ +    + +L+ ++ +   EL+S
Sbjct: 365  KISAFTEKLENERNKYGELQKEITDLRELSDNLEEQITKINAEKSQLVKDKLQLQRELVS 424

Query: 485  TQEMIKNIEKKKDNAEKLVNTTEKSITQTNNKLETLNNQQEDYTKQXXXXXXXXXXXXXX 544
            ++E +K++ +K+  AEK +   EK+I    N +  LN  Q ++                 
Sbjct: 425  SEEKLKSLNQKRTKAEKTLQVAEKNIRHCENNIRRLNEAQTEFENSLLELNESLHSERSE 484

Query: 545  XXXXXXXXXGKTEQFSNEILKNEKELEPYQIQLQEKMXXXXXXXXXXXXXXXXKDNXXXX 604
                      KT   S E+   EKELEP+  +L+ K                 K      
Sbjct: 485  LDAIKMSLRDKTSSISEEVASLEKELEPWTTKLEAKNSQIKLAESEILIIKESKLKLEQE 544

Query: 605  XXXXXXXXXXXXXXVVRMSEKITGWKQQLLEQRKEVESGDIEFNKFTKKIQEMRDKLDSH 664
                          +    +KI   +++       + +   E +   KK+ +M+  L +H
Sbjct: 545  ISQLRKDIESYKDRIENHKKKINKLEKESAAITSFISTAQGECDSAKKKLVDMKQVLTNH 604

Query: 665  RQKANDSRTSLSNVQNKNSVLTALFKLQKSGRISGFYGRLGDLGVIDEKYDVAISTACPR 724
            RQ+  D+R +LSNV+NKN VL AL +LQKSGRI GF+GRLGDLG ID+KYD+AIS ACPR
Sbjct: 605  RQRMTDARVALSNVENKNKVLGALCRLQKSGRIHGFHGRLGDLGTIDDKYDIAISVACPR 664

Query: 725  LEDLVVDSVDCGQQCIDYLRKNRLGYARFILLDKLRKFNLNRIETPDNAPRLFDLIQVRE 784
            L+D+VV++V+C QQCI++LRKN+LGYARFILLDKL+KFN+ ++ TP+N PRLFDL   + 
Sbjct: 665  LDDIVVETVECAQQCIEHLRKNKLGYARFILLDKLKKFNMAKVTTPENVPRLFDLTTPKN 724

Query: 785  DKFLPAFYSVLRDTLVATNLLHANKVAYGKRRFRVVTLDGKLIDISGTMSGGGNYVLRGL 844
            + F PA YSVLRDTLVA +L  AN+VAYG RRFRVVTLDGKLIDISGTMSGGG+ V++GL
Sbjct: 725  EIFAPALYSVLRDTLVAKDLAQANRVAYGTRRFRVVTLDGKLIDISGTMSGGGDRVVKGL 784

Query: 845  MKLGQDLPENDFEQTSPEEVQKLERELEILEKNFKVAYNSLKEMNQEILHMKEQIPATEL 904
            MK  Q    ND    + EEVQ++E EL   E NFK+A ++ +EM   +   K++ P  ++
Sbjct: 785  MKSKQR--SNDM--YTSEEVQRMEAELTDRETNFKIATDTFQEMEAALQKYKDRQPNIDV 840

Query: 905  NISKTTIEIEYCENEIKQLISQLKEKQEIHDQESNNNDEIKVADDKLQALKKEYYSLNDQ 964
             ISK  I+I+   +E++     L E +   +    +N  ++  +++L AL  E  +L D+
Sbjct: 841  EISKHKIDIDTLSSELQSKKDTLIELESTAENNQRDNGPLEDIENQLVALNSELVALKDE 900

Query: 965  TKVTKQEIEKLRQQIMDAGGIELKMQNSKVTSLVNQLKIVNSKQKNDKSAIXXXXXXXXX 1024
            +KV  ++I +LR QIM  GG++L+ QNSKV SL  QL+I+ +KQK +++ +         
Sbjct: 901  SKVKNEQISELRAQIMKIGGLKLQSQNSKVDSLTQQLQIIVAKQKKNRTELKKNELEMNR 960

Query: 1025 XXXXXXTTKDNSLEFKTNLENSKKKVTLLSEELAKLESDINDTQNAKEEILLNIDGNKEK 1084
                    +++    +  L  +      L E L + E  I   ++ KE++    +  K+ 
Sbjct: 961  ASKQKLGAENDINHCEIELSKTNNSHEALQEGLRETEHLIEVIEDKKEQLNQEHETAKKN 1020

Query: 1085 AQELEEDSRNFKSFXXXXXXXXXXXXXXXXXXXXQIGKLDTELNALTIREISQNLESFDE 1144
              +       FKS                     +I + D ELN L +R++ Q L+  DE
Sbjct: 1021 LDDKAAYVEKFKSEEIEMCTHLEKLKNLEHHIKAEISRTDEELNTLKLRDVEQLLQKLDE 1080

Query: 1145 R-----------------------LEKYDISKNGATEDTQHTSSALNSVSNINTDTMDID 1181
                                    +E +D   N    + +  S   NS +  + ++MD+D
Sbjct: 1081 HNLPLESLTDRAVTPSNQCIPEMTVEDHDADMNDG--EAKLISEDPNSFN--DQESMDVD 1136

Query: 1182 STDNEINPGIKRLSELEINELDIESLDAEIENLEEQLEHSTANIEILEEYVRRLSEYKKR 1241
               + I PG+ +L+E E++ +DIE L  EI  L+E ++ + A+I+ILEEY  RL+EYK+R
Sbjct: 1137 QDASYIGPGLPKLTEAELDNIDIEELALEIAQLKEYMDTAYADIDILEEYALRLAEYKRR 1196

Query: 1242 KSDLDESISEKETAKEETEVLKKKRLEEFTTGFDIISLTLKEMYQMITMGGNAELELVDS 1301
            K DL+ES+ ++E  +   E+LKK RLEEF  GF IIS+T+KE+YQMITMGGNAELELVDS
Sbjct: 1197 KLDLNESVEKREEIRNRYEMLKKSRLEEFMDGFGIISMTVKEIYQMITMGGNAELELVDS 1256

Query: 1302 LDPFSEGVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALD 1361
            LDPFSEGV FSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALD
Sbjct: 1257 LDPFSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALD 1316

Query: 1362 FRNVSIVANYIKERTKDAQLIVISLRNNMFELSKQLVGIYKSENMTQSATLVNNDMLN 1419
            FRNVSIVANYIKERTK+AQ IVISLRNNMFEL++QL+GIYKS NMT+S TL N D+LN
Sbjct: 1317 FRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLIGIYKSSNMTKSTTLQNIDILN 1374

>KLTH0G13750g Chr7 complement(1184169..1188368) [4200 bp, 1399 aa]
            {ON} similar to uniprot|Q12267 Saccharomyces cerevisiae
            YLR086W SMC4 Subunit of the condensin complex which
            reorganizes chromosomes during cell division forms a
            stable complex with Smc2p that has ATP-hydrolyzing and
            DNA- binding activity and promotes knotting of circular
            DNA potential Cdc28p substrate
          Length = 1399

 Score = 1152 bits (2980), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 670/1456 (46%), Positives = 912/1456 (62%), Gaps = 97/1456 (6%)

Query: 3    DSPISKKQKITESRDEDKKXXXXXXXXXXXXXXXRSHVDDADITIGPYQGQEKHIQPQSQ 62
            +SP+SKKQK   +RDED                     +  D+T                
Sbjct: 2    ESPLSKKQKTFVNRDEDFSQTE----------------ESVDVT---------------- 29

Query: 63   DRHGRSRTPRKLIVSSADHRFTMSQPNLLSADSQTPSLQ----HPSVSTGREHKFYXXXX 118
             R  RSRTPRKL++ S D RF  SQP + S+ S  P LQ      S S GR +       
Sbjct: 30   -RASRSRTPRKLVLGSPDKRFAFSQP-VTSSSSNVPYLQPLKSELSSSRGRVY------- 80

Query: 119  XXXXXXXXXXXXKKALELIQLSPIKNNRAELQKMYELQQTQKRTIRLVIERLVLTNFKSY 178
                         + LELIQLSP K  R E QK  +++   +   RL I RL L NFKSY
Sbjct: 81   SQSPPRSPTRSPTRKLELIQLSPTKKTRLESQKTEQVRGLAQPIERLCINRLSLHNFKSY 140

Query: 179  AGRQVVGPFHTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLKDLIHKSEKYPEL 238
            AG QVVGPFH++FSAVVGPNGSGKSNVIDS+LFVFGFRANKMRQGKL DLIHKSE +P L
Sbjct: 141  AGTQVVGPFHSSFSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQGKLSDLIHKSEAHPNL 200

Query: 239  SSCSVEIHFQYVIDDPNGGPSKIDESKEKLVVMRKAFKNNSSKYYINDKESSFTQVTTLL 298
             SC VE+ FQYV D+ +G  + + + +  LVV RKAFKNN+SKYY+N KESS+TQVT LL
Sbjct: 201  DSCHVEVFFQYVQDELDGRTT-VRQDRPGLVVTRKAFKNNTSKYYVNGKESSYTQVTELL 259

Query: 299  KNEGIDLDHKRFLILQGEVENIAQMKPKSEKEGDDGLLEYLEDIIGTSHYKVQIEHNLSK 358
            + EGIDLDHKRFLILQGEVE+IAQMKPK+EKEGDDGLLEYLEDIIGT+ YK  IE  L +
Sbjct: 260  RKEGIDLDHKRFLILQGEVESIAQMKPKAEKEGDDGLLEYLEDIIGTAKYKPLIEQTLVQ 319

Query: 359  VEALNEICIEKENRFNIVEKEKDSLVDGKNEALKYLANEKNLVLAKSKKYQHQLYIDNKK 418
            ++ LN++C EKENR+ IVE+EK SL  GK+EAL++L  EK L   +SK  QH+L+ ++ K
Sbjct: 320  IDQLNDVCQEKENRYEIVEREKSSLESGKDEALEFLEKEKKLTFLRSKLLQHKLWKNSFK 379

Query: 419  LTSTLAKITDAQENYDKELEKYSTISKELKNLQDEEITLNKRLNETKKYEEKLLSNQRKN 478
             T+T  KI   +E    E  KY+   +E+K L+ E  +LN  +   K  E  L S +R  
Sbjct: 380  STNTQEKIKTLEEKLSAERAKYTEHKREIKQLESESKSLNVTIRGIKDSESSLTSEKRTC 439

Query: 479  NSELISTQEMIKNIEKKKDNAEKLVNTTEKSITQTNNKLETLNNQQEDYTKQXXXXXXXX 538
            + + +S +E +KNI +KK  AEK  + T  SI  T  KLE L   Q  Y K+        
Sbjct: 440  DRDRVSLEEKLKNISQKKVKAEKTHHATVNSINATQAKLEELFKDQVQYEKELDELNKSL 499

Query: 539  XXXXXXXXXXXXXXXGKTEQFSNEILKNEKELEPYQIQLQEKMXXXXXXXXXXXXXXXXK 598
                           GKT   S +I + E+ELEP+ ++LQEK                  
Sbjct: 500  LVEKTKLDEIKISLKGKTGAISVQIGEIEQELEPWNVKLQEKRSQIKLEETKISVLKESL 559

Query: 599  DNXXXXXXXXXXXXXXXXXXVVRMSEKITGWKQQLLEQRKEVESGDIEFNKFTKKIQEMR 658
                                V    + I G +++  + ++++  G  E +  + K++EM+
Sbjct: 560  AKIAEEISKSENDISNNRKKVAEQHQAIEGLEKEHTDIQRQIIIGQTECDNASNKMKEMK 619

Query: 659  DKLDSHRQKANDSRTSLSNVQNKNSVLTALFKLQKSGRISGFYGRLGDLGVIDEKYDVAI 718
              L +HRQ++ D+++SLS  +NKN VL+AL +LQ+SGRISGF+GRLGDLG ID+KYDVAI
Sbjct: 620  AVLTTHRQRSLDAKSSLSTFENKNKVLSALQRLQRSGRISGFHGRLGDLGTIDDKYDVAI 679

Query: 719  STACPRLEDLVVDSVDCGQQCIDYLRKNRLGYARFILLDKLRKFNLNRIETPDNAPRLFD 778
            STACPRL+D+VV++V+CGQQCI++LRKN+LGYARFILLDKLR FN+N I+TP+N  RLFD
Sbjct: 680  STACPRLDDVVVETVECGQQCIEHLRKNKLGYARFILLDKLRSFNMNTIQTPNNVSRLFD 739

Query: 779  LIQVREDKFLPAFYSVLRDTLVATNLLHANKVAYGKRRFRVVTLDGKLIDISGTMSGGGN 838
            L+   ++KF  AFYSVLRDTLVA +L  AN+VAYGK+RFRVVTLDGKLID+SGTMSGGGN
Sbjct: 740  LVHPIDNKFRNAFYSVLRDTLVAKDLKEANRVAYGKQRFRVVTLDGKLIDLSGTMSGGGN 799

Query: 839  YVLRGLMKLGQDLPENDFEQTSPEEVQKLERELEILEKNFKVAYNSLKEMNQEILHMKEQ 898
            +   G+MK  + L  N     + EEV++++ EL   E+NFK+A ++L EM   +  +K++
Sbjct: 800  HRASGMMK-SERL--NTGASFTAEEVRQIDEELTERERNFKIATDTLHEMEDALQSLKDR 856

Query: 899  IPATELNISKTTIEIEYCENEIKQL---ISQLKEKQEIHDQESNNNDEIKVADDKLQALK 955
             P  E +ISK  +EI+   +EIK      + LK++Q++++   +++D +  A+ +L +LK
Sbjct: 857  EPEIETDISKRRMEIDSLLSEIKLCEDRAASLKKEQKLNE---SSDDTLIEANSRLDSLK 913

Query: 956  KEYYSLNDQTKVTKQEIEKLRQQIMDAGGIELKMQNSKVTSLVNQLKIVNSKQKNDKSAI 1015
             E   L  + K  K +I++L++QIM  GG +L++Q S V S+  ++ I   KQK DK+A+
Sbjct: 914  AECKLLEGEMKSKKNKIKELQEQIMKIGGTKLQLQGSLVDSIGQRISITLGKQKRDKTAV 973

Query: 1016 XXXXXXXXXXXXXXXTTKDNSLEFKTNLENSKKKVTLLSEELAKLESDINDTQNAKEEIL 1075
                               +  +    LE+ K+ ++    ++ +LE+ I+  Q   EEI 
Sbjct: 974  KKAENDLKRYEKQAGQLSVDIDQCTNELESIKELISSSDNKILELEASIDKLQKEGEEI- 1032

Query: 1076 LNIDGNKEKAQELEE-------DSRNFKSFXXXXXXXXXXXXXXXXXXXXQIGKLDTELN 1128
                  +EK +E+E        + ++F  F                        L  +L 
Sbjct: 1033 ------EEKVREIERLIEEKSSEGQDFAVFEVDINNQLEKLNDLLNHIGKDGHDLLKQLE 1086

Query: 1129 ALTIREISQNLESFDERLEKYDISKNGATEDTQHTSSALNSVSNINTDTMDIDSTDN--- 1185
            +L IR+++  L++ ++ L    +S++ + ++    SS   S    N D M++D+ +    
Sbjct: 1087 SLKIRDVTATLQTLNKLL----LSESRSGDELHGQSSEARSQEPSNGDLMEVDTVEGCMG 1142

Query: 1186 --------------------EINPG-IKRLSELEINELDIESLDAEIENLEEQLEHSTAN 1224
                                E +P  + +L+E ++ EL++E ++ EI  L + +E++ A+
Sbjct: 1143 NEPTASQPEDQMDVDEPEEMETSPSDLPKLTEAQLKELNVEEVELEIGQLNDFVENAYAD 1202

Query: 1225 IEILEEYVRRLSEYKKRKSDLDESISEKETAKEETEVLKKKRLEEFTTGFDIISLTLKEM 1284
            IE+LEEY +RL +++ RK +L++++ ++++ ++  + L+KKRL+EF  GF+ IS+TLKEM
Sbjct: 1203 IEVLEEYTKRLVDFQARKLELNKAVEQRDSVRQNCDNLRKKRLDEFMNGFNTISMTLKEM 1262

Query: 1285 YQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHK 1344
            YQMITMGGNAELELVDSLDPFSEGV FSVMPPKKSWRNISNLSGGEKTLSSLALVFALHK
Sbjct: 1263 YQMITMGGNAELELVDSLDPFSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHK 1322

Query: 1345 YKPTPLYVMDEIDAALDFRNVSIVANYIKERTKDAQLIVISLRNNMFELSKQLVGIYKSE 1404
            YKPTPLYVMDEIDAALDFRNVSIVANYIKERTK+AQ IVISLRNNMFEL++QLVGIYK+ 
Sbjct: 1323 YKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKNR 1382

Query: 1405 NMTQSATLVNNDMLNR 1420
            NMT+S  L N D++NR
Sbjct: 1383 NMTKSVALENKDLINR 1398

>KNAG0G02020 Chr7 (449115..453449) [4335 bp, 1444 aa] {ON} Anc_8.259
            YLR086W
          Length = 1444

 Score = 1151 bits (2978), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 647/1383 (46%), Positives = 879/1383 (63%), Gaps = 35/1383 (2%)

Query: 67   RSRTPRKLIVSSADHRFTMSQPNLLSADS-QTPSLQHPSV-----STGREHKFYXXXXXX 120
            ++ TPRKLI+  +++++ +SQP   ++ S Q P+LQ   V     S GR  K Y      
Sbjct: 64   KTVTPRKLIIGPSENKYALSQPTTSASSSLQVPALQQKLVPLSQDSRGRRIKMYSQSPPR 123

Query: 121  XXXXXXXXXXKKALELIQLSPIKNNRAELQKMYELQQTQ-KRTIRLVIERLVLTNFKSYA 179
                       + LELIQLSPIKN+R ELQK+Y+    +  +  RL I +LVL NFKSYA
Sbjct: 124  SPGRSPNRSPVRKLELIQLSPIKNSRLELQKLYDAHNAKIGKMNRLYIHKLVLHNFKSYA 183

Query: 180  GRQVVGPFHTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLKDLIHKSEKYPELS 239
            G Q +GPF  +FSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQ +L DLIHKSE++  L+
Sbjct: 184  GEQTIGPFDASFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSERFTNLN 243

Query: 240  SCSVEIHFQYVIDD---PNGGPSKIDESKEKLVVMRKAFKNNSSKYYINDKESSFTQVTT 296
             CSVE+HF+YV D+   P  G +   E++  LV+ RKAFKNNSSKY+IN KES+FT+VT 
Sbjct: 244  FCSVEVHFRYVKDEYTAPTDGDTM--EAENTLVITRKAFKNNSSKYFINGKESNFTEVTK 301

Query: 297  LLKNEGIDLDHKRFLILQGEVENIAQMKPKSEKEGDDGLLEYLEDIIGTSHYKVQIEHNL 356
            LLK +GIDLDHKRFLILQGEVENIAQMK K+EK+ +DGLLEYLEDIIGT HYK  IE   
Sbjct: 302  LLKEQGIDLDHKRFLILQGEVENIAQMKAKAEKDNEDGLLEYLEDIIGTKHYKPLIEQKT 361

Query: 357  SKVEALNEICIEKENRFNIVEKEKDSLVDGKNEALKYLANEKNLVLAKSKKYQHQLYIDN 416
             ++EA+NE+CIEKENRF IV+ EK+SL   K+ AL++L  EK L L KSK  Q+ LY++N
Sbjct: 362  VEIEAMNELCIEKENRFRIVDDEKNSLEKDKDAALEFLEKEKQLTLLKSKLTQYHLYVNN 421

Query: 417  KKLTSTLAKITDAQENYDKELEKYSTISKELKNLQDEEITLNKRLNETKKYEEKLLSNQR 476
             K+ +TL +I   + ++++E +++S   KE++ LQ+        L      E+ L+  +R
Sbjct: 422  DKIKTTLGQIDSLRTDFEQEKQRHSQFMKEVETLQNSIDESKNNLTSLTTEEKSLIQRKR 481

Query: 477  KNNSELISTQEMIKNIEKKKDNAEKLVNTTEKSITQTNNKLETLNNQQEDYTKQXXXXXX 536
            + N++ +S +E  KN+++K   A+  V +++  I++  ++L+  +  QE+Y  +      
Sbjct: 482  EINTQSVSLEETTKNLDQKLKKAKATVESSKSLISKNEHELQEQSQLQEEYEAEVNDLSK 541

Query: 537  XXXXXXXXXXXXXXXXXGKTEQFSNEILKNEKELEPYQIQLQEKMXXXXXXXXXXXXXXX 596
                              KT  FS+EI   EKELEP   ++QEK                
Sbjct: 542  QREVEEKILLDIKLQLKDKTVTFSDEIASIEKELEPSNTEIQEKKSQIKLVEMEIDLIRD 601

Query: 597  XKDNXXXXXXXXXXXXXXXXXXVVRMSEKITGWKQQLLEQRKEVESGDIEFNKFTKKIQE 656
             K                    +    + +T   +      KE + GD E      K+ E
Sbjct: 602  SKRKVGAEIESLKEELLKLQKDLEDNEKDVTDLNKSKRNLVKEKQEGDKECKDAGVKLNE 661

Query: 657  MRDKLDSHRQKANDSRTSLSNVQNKNSVLTALFKLQKSGRISGFYGRLGDLGVIDEKYDV 716
            M+  L+SHRQK  ++R+++S  QNKN VLT+L ++Q+SGRI+GF+GRLGDLG+I ++YDV
Sbjct: 662  MKAILNSHRQKTMEARSTVSTAQNKNKVLTSLMRMQQSGRINGFHGRLGDLGIIADQYDV 721

Query: 717  AISTACPRLEDLVVDSVDCGQQCIDYLRKNRLGYARFILLDKLRKFNLNRIETPDNAPRL 776
            AISTACPRL+D+VV+SV+CGQ CI++LRKN+LGYARF++LDKL++F+++ I+TP+N PRL
Sbjct: 722  AISTACPRLDDMVVESVECGQTCIEFLRKNKLGYARFVVLDKLKRFDMSPIQTPENVPRL 781

Query: 777  FDLIQVREDKFLPAFYSVLRDTLVATNLLHANKVAYGKRRFRVVTLDGKLIDISGTMSGG 836
            FDL++ +E +F PA YSVLRDTLVA +L  AN+VAYGKRRFRVVTLDG+LIDISGTMSGG
Sbjct: 782  FDLVKPKEKRFAPAIYSVLRDTLVAKDLKQANRVAYGKRRFRVVTLDGQLIDISGTMSGG 841

Query: 837  GNYVLRGLMKLGQDLPENDFEQTSPEEVQKLERELEILEKNFKVAYNSLKEMNQEILHMK 896
            G+ V +GLM L   +     E  S E+++KLE EL   EK F VA  +   M QE+  + 
Sbjct: 842  GSRVFKGLMNLTTKVSGTS-EIFSLEDMKKLEMELAAREKQFDVASETFHSMEQELRKLC 900

Query: 897  EQIPATELNISKTTIEIEYCENEIKQLISQLKEKQEIHDQESNNNDEIKVADDKLQALKK 956
            ++ P  EL ISK  I+I+    +I+   SQL EK   +++   + D++ +    L+AL +
Sbjct: 901  DREPQLELEISKKLIDIDALTQQIQLTRSQLTEKSNDYEKSIKDTDDLDLLLGNLEALNQ 960

Query: 957  EYYSLNDQTKVTKQEIEKLRQQIMDAGGIELKMQNSKVTSLVNQLKIVNSKQKNDKSAIX 1016
            E   L DQ+K + + +  L+ +IM  GG EL++QNSKV+SL  ++ I+ +K K  K+ + 
Sbjct: 961  ELKYLQDQSKTSSERVSFLKDEIMRIGGSELQLQNSKVSSLNQRIDILQAKLKKSKTVVK 1020

Query: 1017 XXXXXXXXXXXXXXTTKDNSLEFKTNLENSKKKVTLLSEELAKLESDINDTQNAKEEILL 1076
                           + + S      + ++K +  +    L  +   +   Q+ K  +  
Sbjct: 1021 KLNTELKKARKSLIASTEESTNSTEEIAHAKARAEVAKNSLLDINKSLESIQDEKINLEQ 1080

Query: 1077 NIDGNKEKAQELEEDSRNFKSFXXXXXXXXXXXXXXXXXXXXQIGKLDTELNALTIREIS 1136
             ++   +K  E  E+   FK+                     + G+L  ELN   +R+++
Sbjct: 1081 ELENFSDKLHESNENVNEFKTIQLELENKIERANSILSYLKKENGQLLEELNNFRLRDVT 1140

Query: 1137 QNLESF----------------DERLEKYDISKNGATE---DTQHTSSALNSVSNINTD- 1176
              L+                  DE     D    GA +   +  +TSS  NSV  + +D 
Sbjct: 1141 HTLDLLREEEGTEANQQPTTGTDETTSNVDNEMLGAADAGVENMNTSSLSNSVK-VASDE 1199

Query: 1177 -TMDIDSTDNEINPGIKRLSELEINELDIESLDAEIENLEEQLEHSTANIEILEEYVRRL 1235
             +MD+D   + ++ GI RLS+ E++ +D ++L+ EI  L+  + + + NIEILEEY +RL
Sbjct: 1200 ISMDVDDCGDLVSQGIPRLSDKELSTIDTDNLNEEINQLQSFINNVSINIEILEEYAKRL 1259

Query: 1236 SEYKKRKSDLDESISEKETAKEETEVLKKKRLEEFTTGFDIISLTLKEMYQMITMGGNAE 1295
             E+KKRK DL+ S+ E+       E LKKKR  EF  GF IIS+TLKEMYQMITMGGNAE
Sbjct: 1260 VEFKKRKIDLNNSVGERNQLTSIMEELKKKRYNEFMEGFSIISMTLKEMYQMITMGGNAE 1319

Query: 1296 LELVDSLDPFSEGVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDE 1355
            LELVDSLDPFSEGVTFSVMPPKKSWRNI+NLSGGEKTLSSLALVFALHKYKPTPLYVMDE
Sbjct: 1320 LELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDE 1379

Query: 1356 IDAALDFRNVSIVANYIKERTKDAQLIVISLRNNMFELSKQLVGIYKSENMTQSATLVNN 1415
            IDAALDFRNVSIVANYIKERTK+AQ IVISLRNNMFEL+KQLVGIYK ENMT++AT+ N 
Sbjct: 1380 IDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAKQLVGIYKHENMTKNATIRNR 1439

Query: 1416 DML 1418
            + L
Sbjct: 1440 EDL 1442

>CAGL0L12188g Chr12 (1310968..1315164) [4197 bp, 1398 aa] {ON} similar
            to uniprot|Q12267 Saccharomyces cerevisiae YLR086w Stable
            Maintenance of Chromosomes
          Length = 1398

 Score = 1086 bits (2809), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 640/1381 (46%), Positives = 874/1381 (63%), Gaps = 45/1381 (3%)

Query: 67   RSRTPRKLIVSSADHRFTMSQPNLLSADSQTPSLQHP---SVSTGREHKFYXXXXXXXXX 123
            R+ TPR L+   +++R  +  P   S + Q PSL  P     + GR+ K Y         
Sbjct: 35   RAITPRNLL--GSENRNVL--PTGGSQNLQIPSLLPPESLGSARGRDFKSYSQSPPRSPG 90

Query: 124  XXXXXXXKKALELIQLSPIKNNRAELQKMYELQQTQKRTIRLVIERLVLTNFKSYAGRQV 183
                    + L+LI+LSPIKN+RAELQK+YE ++   +  RL I +LVL +FKSYAGRQV
Sbjct: 91   RSPT----RRLKLIELSPIKNSRAELQKLYESKKLDVKKERLFIHQLVLNDFKSYAGRQV 146

Query: 184  VGPFHTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLKDLIHKSEKYPELSSCSV 243
            +GPFHT+FSA+VGPNGSGKSNVIDSMLFVFGFRANKMRQ +L DLIHKSE +P+L SCSV
Sbjct: 147  IGPFHTSFSAIVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSETFPDLKSCSV 206

Query: 244  EIHFQYVIDDPNGGPSKIDESKEKLVVMRKAFKNNSSKYYINDKESSFTQVTTLLKNEGI 303
            E+HF+YVID  +G  + IDE+K  LVV RKAFKNN+SKY++N KES++T+VTTLLK EGI
Sbjct: 207  EVHFKYVIDKDDGSTT-IDETKGNLVVTRKAFKNNASKYFVNGKESNYTEVTTLLKKEGI 265

Query: 304  DLDHKRFLILQGEVENIAQMKPKSEKEGDDGLLEYLEDIIGTSHYKVQIEHNLSKVEALN 363
            DLDHKRFLILQGEVENIAQMK K+EKE DDGLLEYLEDIIGTS YK  IE    ++E+LN
Sbjct: 266  DLDHKRFLILQGEVENIAQMKAKAEKENDDGLLEYLEDIIGTSKYKESIEKLSMEIESLN 325

Query: 364  EICIEKENRFNIVEKEKDSLVDGKNEALKYLANEKNLVLAKSKKYQHQLYIDNKKLTSTL 423
            EIC+EKENRF+IVE+EK+SL  GK EAL++L  EK LVL KSK YQ+ L  DNKKL   L
Sbjct: 326  EICVEKENRFSIVEREKNSLESGKEEALQFLNKEKELVLEKSKLYQYNLMQDNKKLDDVL 385

Query: 424  AKITDAQENYDKELEKYSTISKELKNLQDEEITLNKRLNETKKYEEKLLSNQRKNNSELI 483
             K T+ Q+   K+ +++   +  + ++      L   L +    E  L   +R   ++ +
Sbjct: 386  NKKTNVQQEQTKQEDEFRKANSHISDITASLNVLKADLEKVHTEEVNLSKTKRTLENKKV 445

Query: 484  STQEMIKNIEKKKDNAEKLVNTTEKSITQTNNKLETLNNQQEDYTKQXXXXXXXXXXXXX 543
              ++++ N++ K+   E+     +  I  T+ +++T+  +Q    +              
Sbjct: 446  ENEQIVNNLDSKRKEFEEQSKILQDKINSTDQEIQTIIEEQSSLAEGTTVLSTNLDIEKE 505

Query: 544  XXXXXXXXXXGKTEQFSNEILKNEKELEPYQIQLQEKMXXXXXXXXXXXXXXXXKDNXXX 603
                       KTE  + +I + EKEL P+  Q Q+                  +     
Sbjct: 506  KLENIKLKLREKTEHLTIQIAEYEKELSPWNEQSQQLKKEIKITESELSIIEENRKGLEN 565

Query: 604  XXXXXXXXXXXXXXXVVRMSEKITGWKQQLLEQRKEV----ESGDIEFNKFTKKIQEMRD 659
                           +    ++I    + LLEQ+ +V    E G+ E       +  +R+
Sbjct: 566  DIAGLENAILSQKRDLEVQEQEI----KSLLEQKTKVIQERELGERECKNAQATLANVRE 621

Query: 660  KLDSHRQKANDSRTSLSNVQNKNSVLTALFKLQKSGRISGFYGRLGDLGVIDEKYDVAIS 719
            K+++ RQKA + R++ S  +N N VL+AL +LQKSGR++GF+GRLGDL VID KYDVAIS
Sbjct: 622  KVEALRQKAIEIRSTYSATENNNKVLSALLRLQKSGRLNGFHGRLGDLAVIDPKYDVAIS 681

Query: 720  TACPRLEDLVVDSVDCGQQCIDYLRKNRLGYARFILLDKLRKFNLNRIETPDNAPRLFDL 779
            TACPRL DLVVD+V+ GQQCI+YLRKN+LGYARFILLDKL  FN NRI+TPD + RLFDL
Sbjct: 682  TACPRLNDLVVDTVESGQQCIEYLRKNKLGYARFILLDKLNTFNTNRIDTPDQSQRLFDL 741

Query: 780  IQVREDKFLPAFYSVLRDTLVATNLLHANKVAYGKRRFRVVTLDGKLIDISGTMSGGGNY 839
            I V+E +F  AFYSVLRDTLV  N+  AN+VAYGK+R+RVVTLDG LID+SGTM+GGG  
Sbjct: 742  ITVKEKRFNNAFYSVLRDTLVCQNMEQANRVAYGKKRYRVVTLDGNLIDLSGTMTGGGRN 801

Query: 840  VLRGLMKLGQDLPENDFEQTSPEEVQKLERELEILEKNFKVAYNSLKEMNQEILHMKEQI 899
            V +GLMKL +   +      SPEEVQ +E EL   E  +K A ++  EM +E+  ++++ 
Sbjct: 802  VSKGLMKLSKSSSKGS-AFFSPEEVQAIENELNQKENQYKSALDAYHEMEEELRRLRDRA 860

Query: 900  PATELNISKTTIEIEYCENEIKQLISQLKEKQEIHDQESNNNDEIKVADDKLQALKKEYY 959
            P  +  +SK  ++IE   N+I   I+ L+EK++  +   N ND       KL+ LK +  
Sbjct: 861  PEIDNLVSKKEMDIETAHNDINSNINVLEEKRKKLESMKNQNDPSITLLAKLKELKSKLD 920

Query: 960  SLNDQTKVTKQEIEKLRQQIMDAGGIELKMQNSKVTSLVNQLKIVNSKQKNDKSAIXXXX 1019
             ++ QTK TK +I+ ++ +I++ GG ELK Q+  VT + N++   NS++     +     
Sbjct: 921  DIDVQTKSTKDKIKTIKDKIIELGGDELKNQSLLVTDITNKIS-ENSRRLKKIKSNKLKK 979

Query: 1020 XXXXXXXXXXXTTKDNSL-EFKTNLENSKKKVTLLSEELAKLESDINDTQNAKEEILLNI 1078
                       T  +  L  F  N EN+  +   +  +L  ++  I + +  + ++   I
Sbjct: 980  ESLLKKFNKELTEANEELTNFSKNAENADIESKEIESKLLDIKESIENLKENEVKLEHEI 1039

Query: 1079 DGNKEKAQELEEDSRNFKSFXXXXXXXXXXXXXXXXXXXXQIGKLDTELNALTIREISQN 1138
            +    + +  ++   ++KS                      I + +  L+ LTIR+++Q 
Sbjct: 1040 EMKHNELESHQKVVSDYKSISLEYNNKLEKLEASEASLKKSIKRYNDLLSELTIRDVTQV 1099

Query: 1139 LESFDERLEKYDISKNGATEDTQHTSSALNS-------VS------------NINTDTMD 1179
            L +    + + + S + +    ++TS+ +N+       VS            +I+++ M+
Sbjct: 1100 LNTI---MTEENASVDKSDPKLENTSAVINADDDGISAVSENQSFNHNDENDDIDSNKME 1156

Query: 1180 IDSTDNEINPGIKRLSELEINELDIESLDAEIENLEEQLEHSTANIEILEEYVRRLSEYK 1239
            IDS    INPGI  LS  E+ ++D + ++  I +L++ +  S AN+++LEEY  R  E+ 
Sbjct: 1157 IDSQGGFINPGIPVLSASELAKVDPQEVELLITSLDDFITSSEANVDVLEEYALRFVEFN 1216

Query: 1240 KRKSDLDESISEKETAKEETEVLKKKRLEEFTTGFDIISLTLKEMYQMITMGGNAELELV 1299
            KRK+DL+ ++  +++ K+  E +K+KR +EF  GF IIS+TLKEMYQMIT+GGNAELELV
Sbjct: 1217 KRKNDLNSAVQSRDSVKDRLEGIKRKRYDEFMEGFKIISMTLKEMYQMITLGGNAELELV 1276

Query: 1300 DSLDPFSEGVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAA 1359
            DSLDPFSEGVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAA
Sbjct: 1277 DSLDPFSEGVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAA 1336

Query: 1360 LDFRNVSIVANYIKERTKDAQLIVISLRNNMFELSKQLVGIYKSENMTQSATLVNNDMLN 1419
            LDFRNVSIVANYIKERTK+AQ IVISLRNNMFEL+KQLVGIYK ENMT+SA LVN D++ 
Sbjct: 1337 LDFRNVSIVANYIKERTKNAQFIVISLRNNMFELTKQLVGIYKHENMTKSAALVNEDLVG 1396

Query: 1420 R 1420
            R
Sbjct: 1397 R 1397

>KLLA0F19085g Chr6 (1758111..1762229) [4119 bp, 1372 aa] {ON} similar
            to uniprot|Q12267 Saccharomyces cerevisiae YLR086W SMC4
            subunit of the condensin complex which reorganizes
            chromosomes during cell division
          Length = 1372

 Score = 1075 bits (2781), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 649/1411 (45%), Positives = 878/1411 (62%), Gaps = 77/1411 (5%)

Query: 43   ADITIGPYQGQEKHIQPQSQDRHGRSRTPRKLIVSSADHRFTMSQPNLLSADSQT---PS 99
            AD ++ P+ G    I+ Q   +   +RTPRKL++ S + ++ +S     +A S T   PS
Sbjct: 3    ADSSV-PHLGDSPEIKRQRVSQ-SPTRTPRKLVLGSPEKKYAVSNSQATTAASNTMDPPS 60

Query: 100  LQHPSVST--GREHKFYXXXXXXXXXXXXXXXXKKALELIQLSPIKNNRAELQKMYELQ- 156
            LQ P+     GRE   Y                 + LELI+LSP K+ R ELQKM+E   
Sbjct: 61   LQPPTAHAVRGRE---YSQSPPRSPTRSPTRSPTRKLELIRLSPKKSTRLELQKMHEANT 117

Query: 157  QTQKRTIRLVIERLVLTNFKSYAGRQVVGPFHTNFSAVVGPNGSGKSNVIDSMLFVFGFR 216
            QT +R   L I++LVL NFKSYAG Q +GPFHT+FSAVVGPNGSGKSNVIDSMLFVFGFR
Sbjct: 118  QTSQR---LCIDKLVLNNFKSYAGIQEIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFR 174

Query: 217  ANKMRQGKLKDLIHKSEKYPELSSCSVEIHFQYVIDDPNGGPSKIDESKEKLVVMRKAFK 276
            ANKMRQGKL +LIHKSE++P L+SCSV+IHF YV D  NG  +KI  S   +VV R+AFK
Sbjct: 175  ANKMRQGKLSELIHKSEQFPSLASCSVQIHFHYVHDTDNG-ETKILPSAGTMVVERRAFK 233

Query: 277  NNSSKYYINDKESSFTQVTTLLKNEGIDLDHKRFLILQGEVENIAQMKPKSEKEGDDGLL 336
            NNSSKYY+N KES++T+VT LLK EGIDLDHKRFLILQGEVE+IAQMK K+EK+ DDGLL
Sbjct: 234  NNSSKYYVNGKESNYTEVTRLLKEEGIDLDHKRFLILQGEVESIAQMKAKAEKDNDDGLL 293

Query: 337  EYLEDIIGTSHYKVQIEHNLSKVEALNEICIEKENRFNIVEKEKDSLVDGKNEALKYLAN 396
            EYLEDIIGT+ +K QIE  L ++E LNE+C+EKENRF +V+KEK +L  GK EAL++L  
Sbjct: 294  EYLEDIIGTAKFKPQIEKCLEEIETLNEVCMEKENRFELVDKEKQNLESGKEEALEFLDK 353

Query: 397  EKNLVLAKSKKYQHQLYIDNKKLTSTLAKITDAQENYDKELEKYSTISKELKNLQDEEIT 456
            E+   + K++  Q Q+Y  N+KL ++  KI+     + +E  +Y       ++LQ E  T
Sbjct: 354  ERKHTILKAQLLQRQIYDSNRKLATSCDKISALNMEFQEEKSQY-------EHLQKEAET 406

Query: 457  LNKRLNETKKYEEKLLSNQRKNNS-------ELISTQEMIKNIEKKKDNAEKLVNTTEKS 509
            L   +N TKK    L +  +  NS       + I+T E +K+I +K   AEK  + +E +
Sbjct: 407  LTHEINNTKKESTALETESKNVNSKKRSLEKDFIATDEKLKSIARKLKAAEKAFSQSESN 466

Query: 510  ITQTNNKLETLNNQQEDYTKQXXXXXXXXXXXXXXXXXXXXXXXGKTEQFSNEILKNEKE 569
                 N++E+L    +D   +                        KT+  S E+   E++
Sbjct: 467  GKAAVNEIESLKKNHDDCEIELHNLNHSISIEKEKLNEIKIHLHEKTKDLSQEMESLERQ 526

Query: 570  LEPYQIQLQEKMXXXXXXXXXXXXXXXXKDNXXXXXXXXXXXXXXXXXXVVRMSEKITGW 629
            LEP++ Q+QEK                   N                   ++  E  T  
Sbjct: 527  LEPFRDQIQEKQSEIKLSETKITMLKSSHSNLLKEKATIESKIEDLQLEELKQKETETSL 586

Query: 630  KQQLLEQRKEVESGDIEFNKFTKKIQEMRDKLDSHRQKANDSRTSLSNVQNKNSVLTALF 689
            + +  +    + +   E  +  K+  EMRD L   RQ   +++ +L+  QNKN VL AL 
Sbjct: 587  RNEKSKVEARISTAQKECEEAQKQTNEMRDVLIQQRQIVEEAKANLNGFQNKNRVLLALT 646

Query: 690  KLQKSGRISGFYGRLGDLGVIDEKYDVAISTACPRLEDLVVDSVDCGQQCIDYLRKNRLG 749
            KLQ SGRI+GF+GRLGDLG ID++YD+AISTACPRL+D+VV++V+CGQQCID+LRKN+LG
Sbjct: 647  KLQNSGRITGFHGRLGDLGTIDDQYDIAISTACPRLDDIVVETVECGQQCIDHLRKNKLG 706

Query: 750  YARFILLDKLRKFNLNRIETPDNAPRLFDLIQVREDKFLPAFYSVLRDTLVATNLLHANK 809
            Y RFILLDKLRK NL+RI TP+N PRLFDLI    D F PAFYSVLRDTLVA +L  AN+
Sbjct: 707  YGRFILLDKLRKCNLDRIATPENVPRLFDLITPVRDLFRPAFYSVLRDTLVARDLQQANR 766

Query: 810  VAYGKRRFRVVTLDGKLIDISGTMSGGGNYVLRGLMKLGQDLPENDFEQTSPEEVQKLER 869
            VAYGKRRFRVVTLDGKLIDISGTMSGGG+    GLM+           Q S +EV+K+E 
Sbjct: 767  VAYGKRRFRVVTLDGKLIDISGTMSGGGSSPQSGLMRSKATTAS----QYSRDEVEKMEV 822

Query: 870  ELEILEKNFKVAYNSLKEMNQEILHMKEQIPATELNISKTTIE-------IEYCENEIKQ 922
            +L   E N++ A + + EM   +  + +++P  ++ ISK  +E       +E     + Q
Sbjct: 823  QLSTKETNYRSALSMVHEMESALQKLTDRLPEIDIQISKIQLEKGSRVAEVESYHQRLSQ 882

Query: 923  LISQL----KEKQEIHDQESNNNDEIKVADDKLQALKKEYYSLNDQTKVTKQEIEKLRQQ 978
            L  +L    K +Q + D+E            KL  L++      D +K ++ +I+ L+ +
Sbjct: 883  LARELSMNEKNQQPLLDEEK-----------KLDILRQHLQQTIDASKFSQDKIDDLKDR 931

Query: 979  IMDAGGIELKMQNSKVTSLVNQLKIVNSKQKNDKSAIXXXXXXXXXXXXXXXTTKDNSLE 1038
            IM  GGIELKMQ +KV SL   ++I++ KQK +K+                 T + N  +
Sbjct: 932  IMQKGGIELKMQIAKVASLEQHIEILHEKQKKEKT-----RSKKLDIDLARATREKN--K 984

Query: 1039 FKTNLENSKKKVTLLSEELA-------KLESDINDTQNAKEEILLNIDGNKEKAQELEED 1091
            +   +    K +++LSE+L        ++E  + +    K E+  +++  K++   +E D
Sbjct: 985  YSEEVLVCNKDISILSEQLESIRLEKERIEEQVIENNERKAELNSSVEKLKQELLSIERD 1044

Query: 1092 SRNFKSFXXXXXXXXXXXXXXXXXXXXQIGKLDTELNALTIREISQNLESFDERL--EKY 1149
            S  FK+                     Q+   +T L +L IR++S+ L   ++ +     
Sbjct: 1045 SNEFKAKELEYSDRLEKLHGLQEYVKKQLRSYETSLQSLKIRDVSKLLSQLNDGIIESCT 1104

Query: 1150 DISKNGATEDTQHTSSALNSVSNI-NTDTMDIDSTDNEINPGIKRLSELEINELDIESLD 1208
            D++      D   T     S++++ N D M+ DS +   + G+  L+E E+  LD+E+L+
Sbjct: 1105 DVTAKVMNGDIVQT----QSITDVGNNDAME-DSGEAATHSGLPSLTETELENLDLETLE 1159

Query: 1209 AEIENLEEQLEHSTANIEILEEYVRRLSEYKKRKSDLDESISEKETAKEETEVLKKKRLE 1268
             E+  L++ L++   +IE+LEEY RRL+EY++RK DL+++++++E  + + E  K +RLE
Sbjct: 1160 LELHQLQDYLDNFNGDIEVLEEYARRLAEYQRRKLDLNQAVAKREEVRNKCESFKNERLE 1219

Query: 1269 EFTTGFDIISLTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNISNLSG 1328
            +F  GF IIS+TLKEMYQMITMGGNAELELVDSLDPFSEGV FSVMPPKKSWRNISNLSG
Sbjct: 1220 KFMEGFGIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVLFSVMPPKKSWRNISNLSG 1279

Query: 1329 GEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKDAQLIVISLRN 1388
            GEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTK+AQ IVISLRN
Sbjct: 1280 GEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRN 1339

Query: 1389 NMFELSKQLVGIYKSENMTQSATLVNNDMLN 1419
            NMFEL++ LVGIYK+ NMT+S TL N D+L+
Sbjct: 1340 NMFELAQNLVGIYKNNNMTKSTTLQNIDILH 1370

>CAGL0F02079g Chr6 (201002..204673) [3672 bp, 1223 aa] {ON} similar to
            uniprot|P32908 Saccharomyces cerevisiae YFL008w SMC1
            chromosome segregation protein
          Length = 1223

 Score =  192 bits (489), Expect = 7e-49,   Method: Compositional matrix adjust.
 Identities = 196/740 (26%), Positives = 356/740 (48%), Gaps = 102/740 (13%)

Query: 712  EKYDVAISTACPR-LEDLVVDSVDCGQQCIDYLRKNRLGYARFILLDKLRKFNLNRIETP 770
            +KY +A+ST   +  + ++VDS+   Q+CI +L+K R G   FI LD +      R+  P
Sbjct: 540  DKYKLAVSTVLGKNFDSVIVDSLSVAQECISFLKKQRAGVISFIPLDTIDAAT-PRMPVP 598

Query: 771  DNAPRLFDLIQVR-EDKFLPAFYSVLRDTLVATNLLHANKVAYGKR-RFRVVTLDGKLID 828
            ++      +  V  +D  + A Y V  DT++  NL  A  + + K    ++VTLDG LI+
Sbjct: 599  ESETYTLAINTVEYKDDLVRAMYYVCSDTIICDNLDIARDLKWNKNANVKIVTLDGALIN 658

Query: 829  ISGTMSGG-----GNYVLRGLMKLGQDLPEN---DFEQTSPEEVQK--LERELEILEKNF 878
             +G M+GG      N   +   +   DL +    D E+ + +  Q   + RELEI     
Sbjct: 659  KTGLMTGGITSDSANRWDKDEYQSLLDLKDKLIVDVEEAANKSRQSTLIARELEI----- 713

Query: 879  KVAYNSLKEMNQEILHMKEQIPATELNISKTTIEIEYCENEI-KQLISQLKEKQEIHDQE 937
                 SL  +  EI +++ QI  T+  + +T  EI +  N I ++ I Q+K+   + ++ 
Sbjct: 714  -----SLSSLTSEISYIRTQITQTKRAVEETETEINHHNNLIDREFIPQVKD---LENKI 765

Query: 938  SNNNDEIKVADDKLQALKKEYYS-LNDQTKVTKQEIEKLRQQIMDAGGIELKMQNSKVTS 996
            S   DEI+  + K +AL+++ ++ L ++   T ++ E    +++     EL++   ++ +
Sbjct: 766  SGLEDEIRDWNTKREALQEKCFARLTEKVGFTMKDYESHTGEMIRKQTKELQILQKQILN 825

Query: 997  LVNQLKIVNSKQKNDKSAIXXXXXXXXXXXXXXXTTKDNSLEFKTNLENSKK-KVTLLSE 1055
            L                                    +N +EF+T   N+ K ++  + E
Sbjct: 826  L------------------------------------ENKVEFETGRCNATKDRLQNVQE 849

Query: 1056 ELAKLESDINDTQNAKEEILLNIDGNKEKAQELEEDSRNFKSFXXXXXXXXXXXXXXXXX 1115
                ++ ++N+  + ++ I L+I+  + +     E+ ++ K+                  
Sbjct: 850  TKNSVQHELNELVDQEKSIKLSIETLEGELDGKNEELKSIKAAFDSKQKDASATEDIISE 909

Query: 1116 XXXQIGKLDTELNALTIREISQNLESFDERLEKYDISKNGATEDTQHTSSALNSVSNINT 1175
               ++  ++++ N     EI  ++   D  LEK  I KN      Q +   +  VS +  
Sbjct: 910  YNNRLASIESDRN-----EIKDDITRLD--LEKMSILKN-----CQVSGIIVPVVSEVGL 957

Query: 1176 DTMDIDSTDNEINPGIKRLSELEINELDIESLDAEIENLEEQLEHSTANIE-ILEEY--- 1231
            + +     D+E     K++ E++ ++L  +  +A    +++ L +   +I+ +LEE    
Sbjct: 958  EELPASKVDDEAIEIAKKI-EIDFSKLPRKYKEATSAAVKQDLNNQIRDIDDVLEELQPN 1016

Query: 1232 VRRLSEYKKRKSDLDESISEKETAK-EETEV------LKKKRLEEFTTGFDIISLTLKEM 1284
             R +  +   KS  DE   E E  K EE +V      +K+KR E F   F+ I+  L  +
Sbjct: 1017 ARAVERFDDAKSRFDEVDKETEGLKTEERKVFDEFLKVKQKRKELFENAFEKINEHLDAI 1076

Query: 1285 YQMITM---------GGNAELELVDSLDPFSEGVTFSVMPPKKSWRNISNLSGGEKTLSS 1335
            Y  +T          GG+A + + D  +PF+ G+ +   PP K ++++  LSGGEKT+++
Sbjct: 1077 YSELTRNVNSTSILGGGSASMTIEDEDEPFNAGIRYHATPPMKRFKDMEYLSGGEKTVAA 1136

Query: 1336 LALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKER-TKDAQLIVISLRNNMFELS 1394
            LAL+FA++ Y P+P +++DE+DAALD  NV  +A YI+     D Q IVISL+N MFE S
Sbjct: 1137 LALLFAINSYNPSPFFILDEVDAALDISNVQRIAAYIRRHGNPDLQFIVISLKNTMFEKS 1196

Query: 1395 KQLVGIYK--SENMTQSATL 1412
              LVG+++   EN ++  TL
Sbjct: 1197 DALVGVFRQQQENSSKIVTL 1216

 Score = 83.2 bits (204), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 60/189 (31%), Positives = 100/189 (52%), Gaps = 19/189 (10%)

Query: 170 LVLTNFKSYAGRQVVGPFHTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLKDLI 229
           L L NFKSY G   V    +NF++++GPNGSGKSN++D++ FV G R++ +R   LKDLI
Sbjct: 7   LELYNFKSYKGTVNVDFGDSNFTSIIGPNGSGKSNLMDAISFVLGIRSSSLRSSALKDLI 66

Query: 230 HKSEKYPELSSCSVEIHFQYVIDDPNGGPS----KIDESKEKLV-VMRKAFKNNSSKYYI 284
           ++     E +    +       +D NG  +       E   K+V +MR   +   + Y +
Sbjct: 67  YRDIISRENTPTGAD-------NDENGNRTAYVKAFYEYDGKVVELMRLISRLGDTSYKL 119

Query: 285 NDKESSFTQVTTLLKNEGIDLDHKRFLILQGEVENIAQMKPKSEKEGDDGLLEYLEDIIG 344
           +    ++ + +  L+++ I +  K FL+ QG+VE IA   P        GL + +E++ G
Sbjct: 120 DGNTVTYKEYSQFLESQNILIKAKNFLVFQGDVEQIASQSPL-------GLTKLIEEVSG 172

Query: 345 TSHYKVQIE 353
           +  YK + E
Sbjct: 173 SMQYKKEYE 181

>NDAI0G03320 Chr7 (781468..785163) [3696 bp, 1231 aa] {ON} 
          Length = 1231

 Score =  179 bits (453), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 204/771 (26%), Positives = 355/771 (46%), Gaps = 137/771 (17%)

Query: 699  GFYGRLGDLGVID-EKYDVAISTACPR-LEDLVVDSVDCGQQCIDYLRKNRLGYARFILL 756
            G  G + DL     +KY +A+ST   +  + ++VD+++  Q+CI + +K R G A FI L
Sbjct: 534  GVRGLVHDLCRPKKDKYGLAVSTILGKNFDSIIVDNLNVAQECIAFFKKQRSGTASFIPL 593

Query: 757  DKLRKFNLNRIETPD-NAPRLFDLI-QVREDKFLP----AFYSVLRDTLVATNLLHANKV 810
            D +        E P  N P   D I  +   ++ P    A   V  D+++  +L  A  +
Sbjct: 594  DTISS------EQPTLNLPSSQDYILTINAIEYDPEYERAMQYVCSDSIICNSLDIARDL 647

Query: 811  AYGKR-RFRVVTLDGKLIDISGTMSGG---------GNYVLRGLMKLGQDLPENDFEQTS 860
             + K  R ++VT++G LI  +G M+GG              + LM L   L     E ++
Sbjct: 648  KWNKGVRSKLVTIEGALIHKAGLMTGGISKDSNNRWDKEEYQSLMTLKDKLLLQVEEIST 707

Query: 861  PEEVQKLE-RELEILEKNFKVAYNSLKEMNQEILHMKEQIPATELNISKTTIEIEYCENE 919
               +     R++EI           L  +N EI  ++ Q+   + ++ +   EI +    
Sbjct: 708  KSRLSSTRARDVEI----------ELSTLNAEISSLRMQLSQVQRSLDENKTEINHQNTL 757

Query: 920  IKQL----ISQLKEKQEIHDQESNNNDEIKVADDKLQALKKEYYSLNDQTKVTKQEIEKL 975
            + Q     +  LKEK +  D+  N   E+K   +KLQ   + +  L D+   T +E E+ 
Sbjct: 758  LDQQYNPKLKSLKEKVDEFDKSWN---ELKSNKEKLQ--NEIFKELTDKVGFTIEEYERH 812

Query: 976  RQQIMDAGGIELKMQNSKVTSLVNQLKIVNSKQKNDKSAIXXXXXXXXXXXXXXXTTKDN 1035
              +++     EL+    ++ ++ N+L+    + +N +  +               T+ ++
Sbjct: 813  SGELLRKQSKELQQLQKEILNIENKLQFEIERLENTQKRL---------------TSAES 857

Query: 1036 SLE-FKTNLENSKKKVTLLSEELAKLESDINDTQNAKEEI-------LLNIDGNKEKAQE 1087
            +LE     L++ +K    L+E++ ++ES+IN  +N  + +        L+I+  +E   E
Sbjct: 858  NLEKAHETLKSLQKDENELAEQVKQIESEINSARNELDSVNKVFTAQQLDINRMEESLGE 917

Query: 1088 LEEDSRNFKSFXXXXXXXXXXXXXXXXXXXXQIGKLDTELNALTIREISQNLESFDERLE 1147
            L ++S+  K                                        +N +   E + 
Sbjct: 918  LNDNSQTLK----------------------------------------RNRDEIKEDIA 937

Query: 1148 KYDISKNGATEDTQHTSSALNSVSNINTDTMDIDSTD-------NEINPGIKRLS---EL 1197
            K D+ + G  ++ + T+  +  +S  N   + ID  D       NEI+     L    + 
Sbjct: 938  KNDLERIGILKNAKVTNIDIPVISETNLSDLPIDRIDEDTISVSNEIDVDYTALPAKYKE 997

Query: 1198 EINELDIESLDAEIENLEEQLEHSTANIEILEEYVRRLSEYKKRKSDLD---ESISEKE- 1253
            E+       LD +I+N+E+ L+    N    +    R +E ++R   +D   E I   E 
Sbjct: 998  EMGSATKNELDTKIKNVEDLLDVLQPNARAAD----RFTEAQERFEIIDGETEKIKTTER 1053

Query: 1254 TAKEETEVLKKKRLEEFTTGFDIISLTLKEMYQMIT---------MGGNAELELVDSLDP 1304
             A ++   +KKKR E F   FD +S  L  +Y+ +T          GGNA L L D  +P
Sbjct: 1054 KALQQFLKIKKKRKELFENAFDFVSEHLDNIYRELTRNPNSSADLAGGNASLTLEDEDEP 1113

Query: 1305 FSEGVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRN 1364
            F+ GV +   PP K ++++  LSGGEKT+++LAL+FA++ Y+P+P +V+DE+DAALD  N
Sbjct: 1114 FNAGVRYHATPPLKRFKDMEYLSGGEKTVAALALLFAINAYQPSPFFVLDEVDAALDITN 1173

Query: 1365 VSIVANYIKER-TKDAQLIVISLRNNMFELSKQLVGIYK--SENMTQSATL 1412
            V  +A YI+     + Q IVISL+N MFE S  LVG+++   EN ++  TL
Sbjct: 1174 VERIAAYIRRHGNPNLQFIVISLKNTMFEKSDALVGVFRQQQENSSKIVTL 1224

 Score =  104 bits (259), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 105/385 (27%), Positives = 191/385 (49%), Gaps = 42/385 (10%)

Query: 170 LVLTNFKSYAGRQVVGPFHTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLKDLI 229
           L L NFKSY G   VG   +NF++++GPNGSGKSN++D++ FV G R++ +R   +KDLI
Sbjct: 7   LELNNFKSYKGITKVGFGDSNFTSIIGPNGSGKSNMMDAISFVLGVRSSHLRSNIVKDLI 66

Query: 230 HK--------SEKYPELSSCSVEIHFQYVIDDPNGGPSKIDESKEKLVVMRKAFKNNSSK 281
           ++        + ++ +++S  V+  ++   +  + G +  D+ +  + +MR    N  + 
Sbjct: 67  YRGVINDNGDTNEHGKVTSAYVKAFYEK--NTADDGDNDDDDDERPVELMRAISTNGDTT 124

Query: 282 YYINDKESSFTQVTTLLKNEGIDLDHKRFLILQGEVENIAQMKPKSEKEGDDGLLEYLED 341
           Y IN K  ++ + +  L+ E I +  K FL+ QG+VE IA   P         L +  E+
Sbjct: 125 YKINGKTVTYKEYSEFLERENILIKAKNFLVFQGDVEQIASQSPMD-------LSKLFEE 177

Query: 342 IIGTSHYKVQIEHNLSKVEALNEICIEKENRFNIVEKEKDSLVDGKNEALKYLANEKNLV 401
           + G+  YK + +    ++E LN+   E       +  E  +  +G  +  +Y    KN +
Sbjct: 178 VSGSIQYKKEYDELKEQIEKLNQSAAESIRNRRRIHGELKTYKEGITKDEEY----KNNI 233

Query: 402 LAKSKKYQH----QLY-IDNKKLTSTLAKITDAQENYDKELEKY-STISKELKNLQ---- 451
             + K Y +    QLY ++N+K      K  D  +N   E+ +  + I+ E KNLQ    
Sbjct: 234 EKRKKYYMYLVLWQLYHLENEK-----KKSLDNLKNAKSEISQLKNKITNEEKNLQRSKS 288

Query: 452 ---DEEITLNKR---LNETKKYEEKLLSNQRKNNSELISTQEMIKNIEKKKDNAEKLVNT 505
               E + +NK+   LN   K ++KLL +         +  + I NIEK+ ++ +K +  
Sbjct: 289 SFLKENLKVNKKREQLNYQLKEKDKLLEDLNSIKIPQRAASKRINNIEKRIESIQKDIER 348

Query: 506 TEKSITQTNNKLETLNNQQEDYTKQ 530
            +  I    N+L+ +   +E + ++
Sbjct: 349 QQGYINTFENQLKVVTKAKESFERE 373

>ZYRO0F03828g Chr6 (318190..321843) [3654 bp, 1217 aa] {ON} similar to
            uniprot|P32908 Saccharomyces cerevisiae YFL008W SMC1
            Subunit of the multiprotein cohesin complex essential
            protein involved in chromosome segregation and in
            double-strand DNA break repair SMC chromosomal ATPase
            family member binds DNA with a preference for DNA with
            secondary structure
          Length = 1217

 Score =  177 bits (449), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 201/765 (26%), Positives = 353/765 (46%), Gaps = 125/765 (16%)

Query: 699  GFYGRLGDLGVID-EKYDVAISTACPR-LEDLVVDSVDCGQQCIDYLRKNRLGYARFILL 756
            G  G + DL     +KY +AIST   +  + ++VD+V   Q+CI YL+K R G A FI L
Sbjct: 520  GVRGLVCDLCQPKKDKYALAISTILGKNFDSVIVDNVMVAQECIAYLKKQRAGIASFIPL 579

Query: 757  DKLRKFNLNRIETPDNAPRLFDLIQV-REDKFLPAFYSVLRDTLVATNLLHANKVAYGKR 815
            D +    +  +   D+      +  +  E ++  A   V  D+++  ++  A  + + K 
Sbjct: 580  DTI-DVEIPTLTLSDSQGCTLAINAIDYEQEYERALQYVCSDSIICDDMNIAKDLKWNKG 638

Query: 816  -RFRVVTLDGKLIDISGTMSGG---------GNYVLRGLM----KLGQDLPENDFEQTSP 861
             R ++VTL+G LI  +G M+GG              + LM    KL Q + E   E    
Sbjct: 639  VRSKLVTLEGALIHKAGLMTGGISKNTSNRWDKEEYQSLMTLKDKLLQQVEEAALE---G 695

Query: 862  EEVQKLERELEILEKNFKVAYNSLKEMNQEILHMKEQIPATELNISKTTIEIEYCENEIK 921
            +    + RELE          ++L  +N EI  ++ Q+  T+  + + T+E +Y E  IK
Sbjct: 696  KNASLMARELE----------STLSLLNTEISELRTQLTLTQRTLKENTVERDYHEKLIK 745

Query: 922  QLISQLKEKQEIHDQESNNNDEIKVADDKLQALKKEYYS-LNDQTKVTKQEIEKLRQQIM 980
            +      E   + ++  N N  ++  D + + L+ E +    ++   T ++ E    +IM
Sbjct: 746  EEYE--PELLNLEERIQNFNFALQELDSQKEKLQNEIFEEFTNRVGFTVKDYESHSGEIM 803

Query: 981  DAGGIELKMQNSKVTSLVNQLKIVNSKQKNDKSAIXXXXXXXXXXXXXXXTTKDNSLEF- 1039
                   + Q+ ++  L  Q +I+N                            +N L+F 
Sbjct: 804  -------RQQSKELQQL--QRQILNV---------------------------ENKLQFE 827

Query: 1040 KTNLENSKKKVTLLSEELAKLESDINDTQNAKEEILLNIDGNKEKAQELEEDSRNFKSFX 1099
            K  L  ++++     E++AK+E ++   +  ++E    I+   +  QEL +  +  + F 
Sbjct: 828  KDRLSTTERRFGKAHEDMAKIEFELTQLERQEKETESRIN---QIDQELADQKKELEQFQ 884

Query: 1100 XXXXXXXXXXXXXXXXXXXQIGKLDTELNALTIREISQNLESFD-------ERLEKYDIS 1152
                                 G +D+  +AL   E++ NL++         E +EK D+ 
Sbjct: 885  KKLDAKH--------------GDIDSTEDAL--HEVTANLQALKRHKDELKEDVEKVDME 928

Query: 1153 KNGATEDTQHTSSALNSVSNINTDTMDIDSTDNEINPGIKRLSELEINELDIESLDAEIE 1212
            K    ++ + ++  +  +S+ + D + ID  D E    I    E++ +EL  +  ++  E
Sbjct: 929  KVCVLKNCKLSNITIPVLSDTDLDQLPIDRIDEE-TIAIAHEIEIDFHELPAKYKESGAE 987

Query: 1213 NLEEQLEHSTANIE-ILEEYV------RRLSEYKKRKSDLDESISEKETAKEETEVL--- 1262
             + E  E S  + E IL +         R SE + +   +D     +E   EE  V+   
Sbjct: 988  TIREDFEKSIKHAEDILNDLQPNAKANERFSEAQNKFEAID--YETEELKSEEKRVIAQF 1045

Query: 1263 ---KKKRLEEFTTGFDIISLTLKEMYQMIT---------MGGNAELELVDSLDPFSEGVT 1310
               KKKR   F   F+  S  +  +Y+ +T          GG+A L L D  +PF+ G+ 
Sbjct: 1046 LKIKKKRKALFERAFEYASEHIDPIYRELTKNPGSTNELAGGSASLTLEDEDEPFNAGIR 1105

Query: 1311 FSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVAN 1370
            +   PP K ++++  LSGGEKT+++LAL+F ++ ++P+P +V+DE+DAALD  NV  +A 
Sbjct: 1106 YHATPPFKRFKDMEYLSGGEKTVAALALLFTINSFQPSPFFVLDEVDAALDSTNVDRIAA 1165

Query: 1371 YI-KERTKDAQLIVISLRNNMFELSKQLVGIYK--SENMTQSATL 1412
            YI +   +D Q IVISL+N MFE S  LVG+Y+   EN ++  TL
Sbjct: 1166 YISRHGNRDLQFIVISLKNTMFEKSDALVGVYRQQQENSSKIVTL 1210

 Score = 90.1 bits (222), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 67/199 (33%), Positives = 103/199 (51%), Gaps = 15/199 (7%)

Query: 170 LVLTNFKSYAGRQVVGPFHTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLKDLI 229
           L L NFKSY G   VG   +NF +++GPNGSGKSN++D++ FV G +++ +R   LKDLI
Sbjct: 7   LELYNFKSYRGTVRVGFGDSNFISIIGPNGSGKSNMMDAISFVLGVKSSHLRSQILKDLI 66

Query: 230 HKSEKYPELSSCSVEIHFQYVIDDPNGGPSKIDESKEKLVVMRKAFKNNSSKYYINDKES 289
           ++  +  E      E    YV         K D + E   + R   +N  ++Y +N K  
Sbjct: 67  YRGVE-GEEDEEDGEGRTAYV----KAFYLKSDSTVE---LSRSISRNGDTQYKMNGKNC 118

Query: 290 SFTQVTTLLKNEGIDLDHKRFLILQGEVENIAQMKPKSEKEGDDGLLEYLEDIIGTSHYK 349
            + Q    L+ E I +  + FL+ QG+V  IA     S+   D  L +  E+I G+  YK
Sbjct: 119 GYKQYAEFLEEENILIKAQNFLVFQGDVVQIA-----SQSATD--LTKLFEEISGSIQYK 171

Query: 350 VQIEHNLSKVEALNEICIE 368
            + +    KV++LN+   E
Sbjct: 172 KEYDSLKGKVDSLNQSAAE 190

>TDEL0C00960 Chr3 (153572..157240) [3669 bp, 1222 aa] {ON} Anc_8.68
            YFL008W
          Length = 1222

 Score =  161 bits (407), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 213/811 (26%), Positives = 365/811 (45%), Gaps = 145/811 (17%)

Query: 659  DKLDSHRQKANDSRTSLSNVQNKNSVLTALFKLQKSGRISGFYGRLGDLGVID-EKYDVA 717
            D L + +++ N  R    NV    S L   F         G  G + DL     E+Y +A
Sbjct: 497  DDLSASQRETNKERKLRENV----STLKKFF--------PGIRGLVSDLCQPKKERYALA 544

Query: 718  ISTACPR-LEDLVVDSVDCGQQCIDYLRKNRLGYARFILLDKLRKFNLNRIETPDNAPRL 776
            +ST   R  + ++VD++   Q+CI YL+K R G A FI LD + +   + +   +++  +
Sbjct: 545  VSTILGRNFDSIIVDNLAVAQECIAYLKKQRAGIASFIPLDTI-EVETSTLPASESSGCI 603

Query: 777  FDLIQVRED-KFLPAFYSVLRDTLVATNLLHANKVAYGKR-RFRVVTLDGKLIDISGTMS 834
              +  +  D ++  A   V  D+++   L  A  + + +  R ++VTL+G LI  +    
Sbjct: 604  LAINAIEYDPEYERAMRYVCSDSIICNTLEIARDMKWKRNVRSKLVTLEGTLIHRA---- 659

Query: 835  GGGNYVLRGLMKLGQDLPENDFEQTSPEEVQKLERELEILEKNFKVAYNSLKEMNQEILH 894
                    GLM  G           S +   + ++E           Y SL  +  +IL 
Sbjct: 660  --------GLMTGG----------ISKDSSNRWDKE----------EYQSLMTLKDKILV 691

Query: 895  MKEQIPATELNISKTTIEIE------YCE-NEIKQLISQLKEKQEIH--DQESNNNDEIK 945
              E++ +     S    E+E      Y E + I+  ISQLK   E    D E + N   +
Sbjct: 692  QIEEVGSHSRACSIRARELEGNISLIYSEASSIRTQISQLKRALEDTNTDIEYHQNLIKQ 751

Query: 946  VADDKLQALKKEYYSLNDQTKVTKQEIEKLRQQIM----DAGGIELK-----------MQ 990
              D K+Q L+++   +ND  K  ++E + L+ Q      D  G  +K            Q
Sbjct: 752  EYDPKIQELEQKLAIINDSRKQLEEEKDSLQTQTFKEFTDKLGFSMKEYETHSGDAKRQQ 811

Query: 991  NSKVTSLVNQLKIVNSKQKNDKSAIXXXXXXXXXXXXXXXTTKDNSLEFKTNLENSKKKV 1050
            + ++  L  Q+  V +K + +K  +               T+  N LE KT  E   KKV
Sbjct: 812  SKELQQLQKQILNVENKLEFEKERL---------------TSTSNRLE-KT--ETDMKKV 853

Query: 1051 TLLSEELAKLESDINDTQNAKEEILLNIDGNKEKAQELEEDSRNFKSFXXXXXXXXXXXX 1110
             +  + L K E D+   Q  K E    I  +K K +++EE+ +N                
Sbjct: 854  FIELQSLQKQEEDVG-VQTKKVEKA--IKDHKIKLKKVEEELKN--------------KQ 896

Query: 1111 XXXXXXXXQIGKLDTELNALTIREISQNLESFDERLEKYDISKNGATEDTQHTSSALNSV 1170
                    Q+ + ++ L +L      +  +   + +EK D+ +    ++ + ++  +  V
Sbjct: 897  RTMNLNDEQLIEYNSSLQSL-----KRERDEVKDVIEKGDLERICVLKNCKISNMQIPIV 951

Query: 1171 SNINTDTMDIDSTDNEINPGIKRLSELEINELDIESLDAEI-ENLEEQLEHSTAN-IEIL 1228
            S+++  ++ ID  D E    I+  +E+EI   D ++L A+  EN  E +E      ++ +
Sbjct: 952  SDVDLQSLPIDRIDAE---AIRTSNEIEI---DYDALPAKYKENGGEAVEKGFERELKQV 1005

Query: 1229 EEYVRRLSEYKKRKSDLDESISEKETAKEETEVLKK--------------KRLEEFTTGF 1274
            +E +  L    K     +E+  +  +  +ETE LKK              KR   F   F
Sbjct: 1006 DEILNVLQPNAKATDRFNEAQQKFGSINDETEQLKKDEKKVLAQFIKIKRKRKSLFEEAF 1065

Query: 1275 DIISLTLKEMYQMIT---------MGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNISN 1325
            + ++  +  +Y+ +T          GG+A L L D  +PF+ G+ +   PP K ++++  
Sbjct: 1066 EYVTEHIDPIYRELTKNPNSTSELAGGSASLTLEDEDEPFNAGIRYHATPPLKRFKDMEY 1125

Query: 1326 LSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKER-TKDAQLIVI 1384
            LSGGEKT+++LAL+F ++ Y+P+P +V+DE+DAALD  NV  VA YI+     D Q IVI
Sbjct: 1126 LSGGEKTVAALALLFTVNSYQPSPFFVLDEVDAALDTTNVERVATYIRRHGNPDLQFIVI 1185

Query: 1385 SLRNNMFELSKQLVGIYKSENMTQSATLVNN 1415
            SL+N MFE S  LVG+Y+ + +  S  +  N
Sbjct: 1186 SLKNTMFEKSDALVGVYRQQELNTSKIVTLN 1216

 Score = 94.4 bits (233), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 62/201 (30%), Positives = 100/201 (49%), Gaps = 14/201 (6%)

Query: 170 LVLTNFKSYAGRQVVGPFHTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLKDLI 229
           L L NFKSY G   VG   +NF++++GPNGSGKSN++D++ FV G R+  +R   LKDLI
Sbjct: 7   LELHNFKSYKGTVKVGFGDSNFTSIIGPNGSGKSNMMDAISFVLGVRSRHLRSNVLKDLI 66

Query: 230 HKSEKYPELSSCSVEIHFQYVIDDPNGGPSKIDESK--EKLVVMRKAFKNNSSKYYINDK 287
           ++     E      +     V+++P     K   SK    + + R   K   + Y +N K
Sbjct: 67  YRGVASEEEGDGESD-----VVNNPTTAYVKAFYSKGDSTIELSRSISKGGDTTYRMNGK 121

Query: 288 ESSFTQVTTLLKNEGIDLDHKRFLILQGEVENIAQMKPKSEKEGDDGLLEYLEDIIGTSH 347
              + +  + L++E I +  K FL+ QG+V  IA             L ++ E+  G+  
Sbjct: 122 VVDYKRYASFLEDENILIRAKNFLVFQGDVVQIASQSAME-------LTQFFEEFSGSIQ 174

Query: 348 YKVQIEHNLSKVEALNEICIE 368
           YK + +    K++ L +   E
Sbjct: 175 YKKEYDMLKEKLQTLGQSTAE 195

>NCAS0C04000 Chr3 (807106..810777) [3672 bp, 1223 aa] {ON} Anc_8.68
            YFL008W
          Length = 1223

 Score =  157 bits (397), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 102/306 (33%), Positives = 170/306 (55%), Gaps = 28/306 (9%)

Query: 1132 IREISQNLESFDERLEKYDISKNGATEDTQHTSSALNSVSNINTDTMDIDSTDNEINPGI 1191
            ++ +  N     E +EK D+ + G  ++ + T+  +  +S+IN   + ID  D E    I
Sbjct: 914  LQSLKHNRNQIREDMEKIDLERVGVLKNCKITNMEIPILSDINLSNLPIDKID-EDTIAI 972

Query: 1192 KRLSELEINELDIESLDAEIENLEEQLEHSTANIE----ILEEYVRRLSEYKKRKSDLDE 1247
                +++ N+L  +  ++    + E+LE+   +IE    +L+   R +  +   +   + 
Sbjct: 973  SNEIDVDYNDLPAKYKESSATTIREELENHIRSIEDTLNVLQPNARAVERFDDAQERFE- 1031

Query: 1248 SISEKET----AKEETEV-----LKKKRLEEFTTGFDIISLTLKEMYQMITM-------- 1290
             + EKET    A+E+  +     +KK+R E F   FD ++  L  +Y+ +T         
Sbjct: 1032 -VVEKETEDLKAREKKALTQFLKIKKRRRELFENAFDFVNEHLDPIYRELTRNPNSSALL 1090

Query: 1291 -GGNAELELVDSLDPFSEGVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTP 1349
             GGNA L L D  +PF+ G+ +  MPP K ++++  LSGGEKT+++LAL+FA++ Y+P+P
Sbjct: 1091 SGGNASLTLEDEDEPFNAGIKYHAMPPLKRFKDMEYLSGGEKTVAALALLFAINAYQPSP 1150

Query: 1350 LYVMDEIDAALDFRNVSIVANYIKER-TKDAQLIVISLRNNMFELSKQLVGIYK--SENM 1406
             +V+DE+DAALD  NV  +A YI+     D Q IVISL+N MFE S  LVG+Y+   EN 
Sbjct: 1151 FFVLDEVDAALDITNVERIAAYIRRHGNPDLQFIVISLKNTMFEKSDALVGVYRQQQENS 1210

Query: 1407 TQSATL 1412
            ++  TL
Sbjct: 1211 SKIVTL 1216

 Score = 98.2 bits (243), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 68/190 (35%), Positives = 101/190 (53%), Gaps = 29/190 (15%)

Query: 170 LVLTNFKSYAGRQVVGPFHTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLKDLI 229
           L L+NFKSY G   +G   +NF++++GPNGSGKSN++D++ FV G R++ +R   LKDLI
Sbjct: 7   LELSNFKSYRGVTKIGFGDSNFTSIIGPNGSGKSNMMDAISFVLGVRSSHLRSNILKDLI 66

Query: 230 HK------SEKYP----ELSSCSVEIHFQYVIDDPNGGPSKIDESKEKLVVMRKAFKNNS 279
           ++      SE+ P    E    S  +   Y +D       K+ E      +MR    N  
Sbjct: 67  YRGVIRDFSEEDPEDGEEQHPTSAYVKAFYEMD------GKVVE------LMRTININGD 114

Query: 280 SKYYINDKESSFTQVTTLLKNEGIDLDHKRFLILQGEVENIAQMKPKSEKEGDDGLLEYL 339
           + Y I++K  S+ Q    L+ E I +  K FL+ QG+VE IA     S+   D  L +  
Sbjct: 115 TTYKIDNKTVSYKQYAAFLEKENILIKAKNFLVFQGDVEQIA-----SQSALD--LSKLF 167

Query: 340 EDIIGTSHYK 349
           E+I G+  YK
Sbjct: 168 EEISGSIQYK 177

 Score = 56.6 bits (135), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 35/128 (27%), Positives = 66/128 (51%), Gaps = 4/128 (3%)

Query: 712 EKYDVAISTACPR-LEDLVVDSVDCGQQCIDYLRKNRLGYARFILLDKLRKFNLNRIETP 770
           EKY +A+S    +  + ++V+++   ++CI +L+K R G A FI LD +       +  P
Sbjct: 540 EKYGLAVSVMLGKNFDSIIVENLSVARECISFLKKQRAGTASFIPLDTIDS-EQPTLSAP 598

Query: 771 DNAPRLFDLIQVRED-KFLPAFYSVLRDTLVATNLLHANKVAYGKR-RFRVVTLDGKLID 828
            +   +  +  +  D  +  A   V  D+++   L  A  + + +  R ++V+LDG LI 
Sbjct: 599 PSQEYILTINAIEYDLAYERAMQYVCGDSIICDTLDIARDLKWNRGVRSKLVSLDGSLIH 658

Query: 829 ISGTMSGG 836
            +G M+GG
Sbjct: 659 KAGLMTGG 666

>TPHA0P00340 Chr16 (65711..69370) [3660 bp, 1219 aa] {ON} Anc_8.68
            YFL008W
          Length = 1219

 Score =  154 bits (388), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 103/303 (33%), Positives = 167/303 (55%), Gaps = 40/303 (13%)

Query: 1141 SFDERLEKYDISKNGATEDTQHTSSALNSVSNINTDTMDIDSTDNEINPGIKRLSELEIN 1200
            S  E +EK D+ K G   + + ++  +   S I+ + + I   DN+    I   +E+   
Sbjct: 919  SIKEEIEKKDLEKLGILTNCKISNIQVPVASKIDLNNLPIGKIDND---AILISNEIS-- 973

Query: 1201 ELDIESLDAEIE-----NLEEQLEHSTANIEILEEYVRRLSEYKKRKSDLDESISEKETA 1255
             LD ++L A+ +      +   LEH    IE++E+ ++ L    +     DE+    ++A
Sbjct: 974  -LDYKTLPAKYKESSSSKIRSALEHE---IEVVEDLLQDLQPNARAVDRFDEAKERFDSA 1029

Query: 1256 KEETEVLKK--------------KRLEEFTTGFDIISLTLKEMYQMIT---------MGG 1292
             +ETE LKK              KR E F   FD +S  ++ +Y+ +T          GG
Sbjct: 1030 SDETETLKKQERKLLTQFLAIKKKRREVFEKAFDYVSEHIEPIYRELTKNPNSTAELSGG 1089

Query: 1293 NAELELVDSLDPFSEGVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYV 1352
            NA L L D  +PF  G+ +   PP K ++++  LSGGEKT+++LAL+FA++ Y+P+P ++
Sbjct: 1090 NASLTLEDEDEPFDAGIKYHATPPLKRFKDMEYLSGGEKTVAALALLFAINSYQPSPFFI 1149

Query: 1353 MDEIDAALDFRNVSIVANYIKERT-KDAQLIVISLRNNMFELSKQLVGIYK--SENMTQS 1409
            +DE+DAALD  N+  +ANYI++ +  D Q IVISL+N+MFE S  LVGI++   EN ++ 
Sbjct: 1150 LDEVDAALDVTNIERIANYIRKHSNSDIQFIVISLKNSMFEKSDALVGIHRQQQENSSRV 1209

Query: 1410 ATL 1412
             TL
Sbjct: 1210 VTL 1212

 Score = 98.2 bits (243), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 59/165 (35%), Positives = 90/165 (54%), Gaps = 12/165 (7%)

Query: 164 RLVIERLVLTNFKSYAGRQVVGPFHTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQG 223
           RLV   L L NFKSY G   VG   +NF++++GPNGSGKSN++D++ FV GF+++ +R  
Sbjct: 3   RLV--GLELFNFKSYKGVTKVGFGESNFTSIIGPNGSGKSNMMDAISFVLGFQSSNLRSS 60

Query: 224 KLKDLIHKSEKYPELSSCSVEIHFQYVIDDPNGGPSKIDESKEKLVV--MRKAFKNNSSK 281
            LKDL+     Y +++S       ++  D       K    K+  VV  MR       S 
Sbjct: 61  TLKDLV-----YRDIASAD---ENEFGEDGERSAYVKAFYEKDGTVVELMRAITAGRDSV 112

Query: 282 YYINDKESSFTQVTTLLKNEGIDLDHKRFLILQGEVENIAQMKPK 326
           Y I++K +++   +  L  E I +  + FL+ QG+VE IA   P+
Sbjct: 113 YKIDNKTTTYKHYSDFLAAENILIKARNFLVFQGDVEQIAAQSPR 157

 Score = 60.5 bits (145), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 89/318 (27%), Positives = 137/318 (43%), Gaps = 64/318 (20%)

Query: 699  GFYGRLGDLG-VIDEKYDVAISTACPR-LEDLVVDSVDCGQQCIDYLRKNRLGYARFILL 756
            G  G + DL     EKY +A+ST   +  + +VVD++   Q+CI YL+K R G   FI L
Sbjct: 522  GVKGLVSDLCHPKKEKYALAVSTILGKNFDSVVVDTLSVAQECITYLKKQRAGIISFIPL 581

Query: 757  DKLRKF-------NLNRIETPDNAPRLFDLIQVREDKFLPAFYSVLRDTLVATNLLHANK 809
            D +  F       N+  I    NA    D  Q    ++  A   V  D+++   L  A  
Sbjct: 582  DTIDAFVPTLPTTNIQGITLVLNA---IDYDQ----EYDKAMQYVCSDSIMCDTLSIAKS 634

Query: 810  VAYGKR-RFRVVTLDGKLIDISGTMSGGGNYVLRGLMKLGQDLPENDFEQTSPEEVQKLE 868
            + +      ++VTL+G LI  +G M+GG                       S E+  + +
Sbjct: 635  LKWKHNVTSKLVTLEGTLIHRAGLMTGG----------------------VSKEQGNRWD 672

Query: 869  RELEILEKNFKVAYNSLKEMNQEILHMKEQIPATELNISKT-TIEIEYCENEIKQL---I 924
            +E           Y  L  +  ++L   EQ+     N SKT  IE    E+ I QL   I
Sbjct: 673  KE----------EYQGLVTLKDKLLIQIEQLS----NNSKTFAIEARDLESNISQLNSSI 718

Query: 925  SQLKEK-QEIHDQESNNNDEIKVADDKLQALKKEYYSLNDQTKVTKQEIEKLRQQIMDAG 983
            S L+ +  +I+     N  E++  +D    LKKEY    +Q     + IEK + +I+  G
Sbjct: 719  SDLRTQISQINRSIEENKAEVQYHED---MLKKEYEPKQNQLNTKLESIEKSKSEII--G 773

Query: 984  GIELKMQNSKVTSLVNQL 1001
              EL +QN+      N+L
Sbjct: 774  QKEL-LQNTVFKEFHNKL 790

>YFL008W Chr6 (119429..123106) [3678 bp, 1225 aa] {ON}  SMC1Subunit of
            the multiprotein cohesin complex, essential protein
            involved in chromosome segregation and in double-strand
            DNA break repair; SMC chromosomal ATPase family member,
            binds DNA with a preference for DNA with secondary
            structure
          Length = 1225

 Score =  149 bits (376), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 99/294 (33%), Positives = 160/294 (54%), Gaps = 28/294 (9%)

Query: 1144 ERLEKYDISKNGATEDTQHTSSALNSVSNINTDTMDIDSTDNEINPGIKRLSELEINELD 1203
            E +EK+D+ +  A ++ + ++  +   S    D + I STDNE    I   + ++IN   
Sbjct: 928  EDIEKFDLERVTALKNCKISNINIPISSETTIDDLPISSTDNE---AITISNSIDINYKG 984

Query: 1204 I-------------ESLDAEIENLEEQLEHSTANIEILEEYVRRLSEYKKRKSDLDESIS 1250
            +             + L+ +I  +EE L     N   LE Y      ++   ++ ++  +
Sbjct: 985  LPKKYKENNTDSARKELEQKIHEVEEILNELQPNARALERYDEAEGRFEVINNETEQLKA 1044

Query: 1251 EKETAKEETEVLKKKRLEEFTTGFDIISLTLKEMYQMIT---------MGGNAELELVDS 1301
            E++    +   +KKKR E F   FD +S  L  +Y+ +T          GGNA L + D 
Sbjct: 1045 EEKKILNQFLKIKKKRKELFEKTFDYVSDHLDAIYRELTKNPNSNVELAGGNASLTIEDE 1104

Query: 1302 LDPFSEGVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALD 1361
             +PF+ G+ +   PP K ++++  LSGGEKT+++LAL+FA++ Y+P+P +V+DE+DAALD
Sbjct: 1105 DEPFNAGIKYHATPPLKRFKDMEYLSGGEKTVAALALLFAINSYQPSPFFVLDEVDAALD 1164

Query: 1362 FRNVSIVANYI-KERTKDAQLIVISLRNNMFELSKQLVGIYK--SENMTQSATL 1412
              NV  +A YI + R  D Q IVISL+N MFE S  LVG+Y+   EN ++  TL
Sbjct: 1165 ITNVQRIAAYIRRHRNPDLQFIVISLKNTMFEKSDALVGVYRQQQENSSKIITL 1218

 Score =  105 bits (262), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 62/164 (37%), Positives = 89/164 (54%), Gaps = 16/164 (9%)

Query: 170 LVLTNFKSYAGRQVVGPFHTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLKDLI 229
           L L+NFKSY G   VG   +NF++++GPNGSGKSN++D++ FV G R+N +R   LKDLI
Sbjct: 7   LELSNFKSYRGVTKVGFGESNFTSIIGPNGSGKSNMMDAISFVLGVRSNHLRSNILKDLI 66

Query: 230 HK-------SEKYPELSSCSVEIHFQYVIDDPNGGPSKIDESKEKLV-VMRKAFKNNSSK 281
           ++       S+ Y    + S      YV            +   KLV +MR   +N  + 
Sbjct: 67  YRGVLNDENSDDYDNEGAASSNPQSAYV--------KAFYQKGNKLVELMRIISRNGDTS 118

Query: 282 YYINDKESSFTQVTTLLKNEGIDLDHKRFLILQGEVENIAQMKP 325
           Y I+ K  S+   +  L+NE I +  K FL+ QG+VE IA   P
Sbjct: 119 YKIDGKTVSYKDYSIFLENENILIKAKNFLVFQGDVEQIAAQSP 162

 Score = 67.8 bits (164), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 78/309 (25%), Positives = 151/309 (48%), Gaps = 33/309 (10%)

Query: 712  EKYDVAISTACPR-LEDLVVDSVDCGQQCIDYLRKNRLGYARFILLDKLRKFNLNRIETP 770
            EKY +A+ST   +  + ++V+++   Q+CI +L+K R G A FI LD +    L  +  P
Sbjct: 542  EKYGLAVSTILGKNFDSVIVENLTVAQECIAFLKKQRAGTASFIPLDTIET-ELPTLSLP 600

Query: 771  DNAPRLFDLIQV-REDKFLPAFYSVLRDTLVATNLLHANKVAYGKR-RFRVVTLDGKLID 828
            D+   +  +  +  E ++  A   V  D+++   L  A  + + K  R ++VT++G LI 
Sbjct: 601  DSQDYILSINAIDYEPEYEKAMQYVCGDSIICNTLNIAKDLKWKKGIRGKLVTIEGALIH 660

Query: 829  ISGTMSGG--GNYVLR-------GLMKLGQDLPENDFEQTSPEEVQKLE-RELEILEKNF 878
             +G M+GG  G+   R        LM L   L     E ++ +    +  RE+E      
Sbjct: 661  KAGLMTGGISGDANNRWDKEEYQSLMSLKDKLLIQIDELSNGQRSNSIRAREVE------ 714

Query: 879  KVAYNSLKEMNQEILHMKEQIPATELNISKTTIEIEY----CENEIKQLISQLKEKQEIH 934
                NS+  +N +I +++ Q+   + ++ +  +EI+Y     E EI+  I++LK+K  + 
Sbjct: 715  ----NSVSLLNSDIANLRTQVTQQKRSLDENRLEIKYHNDLIEKEIQPKITELKKK--LD 768

Query: 935  DQESNNNDEIKVADDKLQALKKEYYSLNDQTKVTKQEIEKLRQQIMDAGGIELKMQNSKV 994
            D E+  ++ +K  +     + KE+ S   +   T +E E    ++M     EL+    ++
Sbjct: 769  DLENTKDNLVKEKEALQNNIFKEFTS---KIGFTIKEYENHSGELMRQQSKELQQLQKQI 825

Query: 995  TSLVNQLKI 1003
             ++ N+L+ 
Sbjct: 826  LTVENKLQF 834

>TBLA0G03530 Chr7 complement(941941..945639) [3699 bp, 1232 aa] {ON}
            Anc_8.68 YFL008W
          Length = 1232

 Score =  148 bits (373), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 102/310 (32%), Positives = 171/310 (55%), Gaps = 35/310 (11%)

Query: 1132 IREISQNLESFDERLEKYDISKNGATEDTQHTSSALNSVSNINTDTMDIDSTDNE---IN 1188
            +  I + +++ +E + K D+ + G  ++ + ++  +   S +N + + ID  D++   I+
Sbjct: 922  LNSIQKKIDALNENISKIDLERIGILKNCKISNIEIPITSAVNLNNLPIDKIDDDAILIS 981

Query: 1189 PGIKRLSELEINELDIESLDAEIENLEEQLEHSTANIEILEEYVRRLSEYKKRKSDLDES 1248
              IK    +  NEL  +    + ++ E+ LE  +  I+  E+ +  L    K    LDE+
Sbjct: 982  NDIK----VSFNELSKKY--KKKQDYEKNLEDISNEIKETEDILLELQPNAKAHDRLDEA 1035

Query: 1249 ISEKETAKEETEVLK--------------KKRLEEFTTGFDIISLTLKEMYQMITM---- 1290
              + E    ETE LK              KKR E F + FD ++  ++ +Y+ +T     
Sbjct: 1036 KDKFEVIDNETETLKTEEKEILTKFLNIKKKRKELFESCFDFVNEHIEPIYKELTKDPNS 1095

Query: 1291 -----GGNAELELVDSLDPFSEGVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKY 1345
                 GG A L L D  +PF+ GV +   PP K ++++  LSGGEKT+++LAL+FA++ Y
Sbjct: 1096 TTELGGGQATLTLEDEDEPFNGGVKYHATPPLKRFKDMEYLSGGEKTVAALALLFAINSY 1155

Query: 1346 KPTPLYVMDEIDAALDFRNVSIVANYI-KERTKDAQLIVISLRNNMFELSKQLVGIYK-- 1402
            +P+P +V+DE+DAALD  NV  +A YI K   KD Q I+ISL+N MFE S  LVG+++  
Sbjct: 1156 QPSPFFVLDEVDAALDHTNVERIAAYIRKHGNKDLQFIIISLKNTMFEKSDALVGVFRQQ 1215

Query: 1403 SENMTQSATL 1412
            +EN +++ TL
Sbjct: 1216 TENSSKALTL 1225

 Score =  108 bits (271), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 73/218 (33%), Positives = 113/218 (51%), Gaps = 27/218 (12%)

Query: 164 RLVIERLVLTNFKSYAGRQVVGPFHTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQG 223
           RLV   L L+NFKSY G   +G   +NF++++GPNGSGKSN++D++ FV G R+N +R  
Sbjct: 3   RLV--GLELSNFKSYKGTVKIGFGDSNFTSIIGPNGSGKSNMMDAISFVLGVRSNDLRSS 60

Query: 224 KLKDLIHKSEKYPELSSCSVEIHFQYVIDDPNGGPS----KIDESKEKLVVMRKAFKNNS 279
            +KDLIH+S +  + S+           DDP         K+ ++ E   +MR    +  
Sbjct: 61  GMKDLIHRSVRDSQSSN-----------DDPTSAYVKAFYKVTDASEITELMRIVNLSGE 109

Query: 280 SKYYINDKESSFTQVTTLLKNEGIDLDHKRFLILQGEVENIAQMKPKSEKEGDDGLLEYL 339
           + Y IN K +SF   +  L  E I +  K FL+ QG+VE IA        +    L +  
Sbjct: 110 TIYKINGKTTSFKNYSDWLAKENILIKAKNFLVFQGDVETIAS-------QSSLELTKLF 162

Query: 340 EDIIGTSHYKVQ---IEHNLSKVEALNEICIEKENRFN 374
           E + G+  YK +   ++ +L+K+  L    I+   R N
Sbjct: 163 EQVSGSIQYKKEYDLLKEDLNKINRLTNDAIKNRRRIN 200

 Score = 58.2 bits (139), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 60/242 (24%), Positives = 111/242 (45%), Gaps = 23/242 (9%)

Query: 699 GFYGRLGDLG-VIDEKYDVAISTACPR-LEDLVVDSVDCGQQCIDYLRKNRLGYARFILL 756
           G  G + DL     +KY +AI T   +    ++VDS+   Q+CI YL+K R G   FI L
Sbjct: 522 GVRGLVHDLCHPKKDKYALAILTILGKNFNSVIVDSLSVAQECISYLKKQRAGIISFIPL 581

Query: 757 DKLRKFNLNRIETPDNAPRLFD----LIQVREDKFLPAFYSVLR----DTLVATNLLHAN 808
           D +     +      N P+  +    ++ +   ++ P F   ++    ++++  NL  A 
Sbjct: 582 DTIEAQIPSLPTIIQNNPKYNNDSNCILTINAIEYEPEFERAMQYICSNSIICDNLDIAK 641

Query: 809 KVAYGK--RRFRVVTLDGKLIDISGTMSGGGNYVLRGLMKLGQDLPENDFEQTSPEEVQK 866
            + + +  +  + VTLDG +I  S  M+GG +   +  M+      ++++      +   
Sbjct: 642 DLKWNQNVKNVKFVTLDGSIIHKSNLMTGGAS---KNSMQSNNRWDKDEYSSLMTLK-DN 697

Query: 867 LERELEILEKNFKVAYNSLKE-------MNQEILHMKEQIPATELNISKTTIEIEYCENE 919
           L  E+E + K  K+A  + +E       +N EI ++K Q+     N+     E+ Y +N 
Sbjct: 698 LILEIETISKENKLASINSRELETEISLLNSEITNLKTQLTQLTRNLKDNNTELLYHQNL 757

Query: 920 IK 921
           IK
Sbjct: 758 IK 759

>KNAG0G00910 Chr7 (172759..176439) [3681 bp, 1226 aa] {ON} Anc_8.68
            YFL008W
          Length = 1226

 Score =  147 bits (372), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 105/304 (34%), Positives = 170/304 (55%), Gaps = 34/304 (11%)

Query: 1134 EISQNLESFDERLEKYDISKNGATEDTQHTSSALNSVSNINTDTMDIDSTDNEINPGIKR 1193
            EIS ++E+ D  LE+  I +N      + ++  L  +S   T+  D+  T NE    IK 
Sbjct: 925  EISTDIENLD--LERIGILRN-----CKISNRDLPILSE--TNLADVPITSNEQGDAIKM 975

Query: 1194 LSELEIN--ELDIESLDAEIENLEEQLEHSTANI----EILEEYVRRLSEYKKRKSDLDE 1247
             +E++I+  EL  +  ++  + LE++L  S   +    EIL+   R +  + + +   + 
Sbjct: 976  SNEIDIDYEELPTKYKESSSKQLEKELTRSIEEVNEMLEILQPNARAVGRFDEAQERFNA 1035

Query: 1248 SISEKETAKEETEVL-------KKKRLEEFTTGFDIISLTLKEMYQMIT---------MG 1291
              +E E  K E   +       KKKR E F   FD +S  +  +Y+ +T          G
Sbjct: 1036 IDNETERLKSEERKIYAQFLKTKKKRKELFDRAFDYVSTHIDGIYRELTKDPNSTAELAG 1095

Query: 1292 GNAELELVDSLDPFSEGVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLY 1351
            G+A L L D  +PF+ G+ +   PP K ++++  LSGGEKT+++LAL+FA++ Y+P+P +
Sbjct: 1096 GSASLTLEDEDEPFNAGIKYHATPPLKRFKDMEYLSGGEKTVAALALLFAINSYQPSPFF 1155

Query: 1352 VMDEIDAALDFRNVSIVANYIKERTKDA-QLIVISLRNNMFELSKQLVGIYK--SENMTQ 1408
            V+DEIDAALD +NV  +A YI++    + Q IVISL+N+MFE S  LVG+Y+   EN ++
Sbjct: 1156 VLDEIDAALDIKNVERIAAYIRKHGNPSLQFIVISLKNSMFEKSDALVGVYRRQQENSSR 1215

Query: 1409 SATL 1412
              TL
Sbjct: 1216 LVTL 1219

 Score =  108 bits (271), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 103/364 (28%), Positives = 175/364 (48%), Gaps = 29/364 (7%)

Query: 170 LVLTNFKSYAGRQVVGPFHTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLKDLI 229
           L L NFKSY G   VG   +NF++++GPNGSGKSN++D++ FV G R++ +R   + DLI
Sbjct: 7   LELYNFKSYRGVVKVGFGESNFTSIIGPNGSGKSNMMDAISFVLGVRSSYLRSSAVADLI 66

Query: 230 HKS----EKYPELSSCSVEIHFQYVIDDPNGGPSKIDESKEKLVVMRKAF-KNNSSKYYI 284
           ++     E+         + H  YV    + GP      +E  V +++   KN  S Y I
Sbjct: 67  YRGVVPEEEDDGEGEGDGDAHRAYVSAFYSKGP------QESTVELKRTISKNGDSTYQI 120

Query: 285 NDKESSFTQVTTLLKNEGIDLDHKRFLILQGEVENIAQMKPKSEKEGDDGLLEYLEDIIG 344
           + ++ ++ Q +  L+++ I +  K FL+ QG+VE +A   P         L +  E++ G
Sbjct: 121 DRRQVTYKQYSEFLESQNILIKAKNFLVFQGDVEQVASQSPLQ-------LTKLFEEVSG 173

Query: 345 TSHYKVQIEHNLSKVEALNEICIEKENRFNIVEKEKDSLVDGKNEALKY---LANEKNL- 400
           ++ YK + +    ++E L+    E       V  E  S  +G ++  +Y   L N+K L 
Sbjct: 174 SAQYKKEYDLLKDQLEQLSHSATESIKDRRRVHSELKSYREGVSKDEEYKKNLENKKELE 233

Query: 401 -VLAKSKKYQHQLYIDNKKLTSTLAKITDAQENYDKELE-KYSTISKELKNLQDEEITLN 458
            + A  K Y  Q+  D  KL + +A          KE+  + +T+ K   +   E   L 
Sbjct: 234 KIFAMWKLYHLQMGKD--KLLADMANTESTMSKLRKEIRTREATLQKSKASFASETAALL 291

Query: 459 K---RLNETKKYEEKLLSNQRKNNSELISTQEMIKNIEKKKDNAEKLVNTTEKSITQTNN 515
           K   +L+   +  EK+LS+ R       +T   I+NIEK+ D  +  +   E  + +   
Sbjct: 292 KLKNKLDYKVRDREKVLSDIRLIKLPQRATANRIRNIEKRIDLLQNELRRQESYVARFET 351

Query: 516 KLET 519
           +LE 
Sbjct: 352 QLEV 355

>Suva_6.52 Chr6 (91156..94950) [3795 bp, 1264 aa] {ON} YFL008W (REAL)
          Length = 1264

 Score =  147 bits (371), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 100/294 (34%), Positives = 164/294 (55%), Gaps = 28/294 (9%)

Query: 1144 ERLEKYDISKNGATEDTQHTSSALNSVSNINTDTMDIDSTDNEINPGIKRLSELEINELD 1203
            E +EK+D+ +  A ++ + ++  L  +S    D + I S D+E    I   + ++++   
Sbjct: 967  EDIEKFDLERVTALKNCKISNINLPILSETTIDDLPISSGDSE---AISISNNIDVDYQG 1023

Query: 1204 I------ESLDAEIENLEEQLEHSTANIEILEEYVRRLSEYKKRKSDLDESISEKETAK- 1256
            +       S D+  + LE+++  +   +  L+   R +  Y + +   D   +E E  K 
Sbjct: 1024 LPKKYKENSNDSARKELEQKITEADEILNELQPNARAVERYDEAEERFDVINNETEELKS 1083

Query: 1257 EETEVL------KKKRLEEFTTGFDIISLTLKEMYQMIT---------MGGNAELELVDS 1301
            EE ++L      KKKR E F   FD +S  L  +Y+ +T          GGNA L + D 
Sbjct: 1084 EEKKILNQFLKIKKKRKELFEKTFDYVSDHLDAIYRELTKNPNSTVELAGGNASLTIEDE 1143

Query: 1302 LDPFSEGVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALD 1361
             +PF+ G+ +   PP K ++++  LSGGEKT+++LAL+FA++ Y+P+P +V+DE+DAALD
Sbjct: 1144 DEPFNAGIKYHATPPLKRFKDMEYLSGGEKTVAALALLFAINSYQPSPFFVLDEVDAALD 1203

Query: 1362 FRNVSIVANYI-KERTKDAQLIVISLRNNMFELSKQLVGIYK--SENMTQSATL 1412
              NV  +A YI + R  D Q IVISL+N MFE S  LVG+Y+   EN +++ TL
Sbjct: 1204 ITNVQRIAAYIRRHRNPDLQFIVISLKNTMFEKSDALVGVYRQQQENSSKTVTL 1257

 Score =  102 bits (255), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 69/205 (33%), Positives = 107/205 (52%), Gaps = 16/205 (7%)

Query: 170 LVLTNFKSYAGRQVVGPFHTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLKDLI 229
           L L+NFKSY G   VG   +NF++++GPNGSGKSN++D++ FV G R+N +R   LKDLI
Sbjct: 43  LELSNFKSYRGITKVGFGESNFTSIIGPNGSGKSNMMDAISFVLGVRSNHLRSNILKDLI 102

Query: 230 HKS----EKYPELSSCSVEIHFQYVIDDPNGGPSKIDESK-EKLV-VMRKAFKNNSSKYY 283
           ++          + S + +     +  +PN    K    K  KLV + R   +N  + Y 
Sbjct: 103 YRGVLDDGNDENIDSGADD---NAITSNPNSAYVKAFYQKGNKLVELTRLISRNGDTTYK 159

Query: 284 INDKESSFTQVTTLLKNEGIDLDHKRFLILQGEVENIAQMKPKSEKEGDDGLLEYLEDII 343
           I+ K  ++   +  L+NE I +  K FL+ QG+VE IA   P         L    E++ 
Sbjct: 160 IDGKTVTYKDYSIFLENENILIKAKNFLVFQGDVEQIAAQSPTD-------LSRMFEEVS 212

Query: 344 GTSHYKVQIEHNLSKVEALNEICIE 368
           G+  YK + +    K+E L++   E
Sbjct: 213 GSIQYKKEYDELKEKIEKLSKSATE 237

>Skud_6.64 Chr6 (121616..125308) [3693 bp, 1230 aa] {ON} YFL008W
            (REAL)
          Length = 1230

 Score =  145 bits (365), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 100/292 (34%), Positives = 161/292 (55%), Gaps = 24/292 (8%)

Query: 1144 ERLEKYDISKNGATEDTQHTSSALNSVSNINTDTMDIDSTD-------NEINPGIKRLSE 1196
            E  EK+D+ +  A ++ + ++  L  +S    D + I S D       N+I+   K L +
Sbjct: 933  EDTEKFDLERVTALKNCKISNINLPILSETTIDDLPIASGDSEAISISNKIDVDYKGLPK 992

Query: 1197 LEINELDIES----LDAEIENLEEQLEHSTANIEILEEYVRRLSEYKKRKSDLDESISEK 1252
             +  E + +S    LD +I  +EE L     N    E Y      ++   ++ +E  +E+
Sbjct: 993  -KYKESNTDSAKKGLDEKIREVEEILNELQPNARAEERYDEAEERFEVINNETEELKAEE 1051

Query: 1253 ETAKEETEVLKKKRLEEFTTGFDIISLTLKEMYQMIT---------MGGNAELELVDSLD 1303
            +    +   +K+KR E F   FD +S  L  +Y+ +T          GGNA L + D  +
Sbjct: 1052 KKILSQFLKIKRKRKELFEKTFDYVSDHLDAIYRELTKNPNSNVELAGGNASLTIEDEDE 1111

Query: 1304 PFSEGVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFR 1363
            PF+ G+ +   PP K ++++  LSGGEKT+++LAL+FA++ Y+P+P +V+DE+DAALD  
Sbjct: 1112 PFNAGIKYHATPPLKRFKDMEYLSGGEKTVAALALLFAINSYQPSPFFVLDEVDAALDIT 1171

Query: 1364 NVSIVANYI-KERTKDAQLIVISLRNNMFELSKQLVGIYK--SENMTQSATL 1412
            NV  +A YI + R  D Q IVISL+N MFE S  LVG+Y+   EN +++ TL
Sbjct: 1172 NVQRIAAYIRRHRNPDLQFIVISLKNTMFEKSDALVGVYRQQQENSSKTITL 1223

 Score =  105 bits (261), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 69/204 (33%), Positives = 104/204 (50%), Gaps = 12/204 (5%)

Query: 170 LVLTNFKSYAGRQVVGPFHTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLKDLI 229
           L L+NFKSY G   VG   +NF++++GPNGSGKSN++D++ FV G R+N +R   LKDLI
Sbjct: 7   LELSNFKSYRGVTKVGFGESNFTSIIGPNGSGKSNMMDAISFVLGVRSNHLRSNVLKDLI 66

Query: 230 HKS---EKYPELSSCSVEIHFQYVIDDPNGGPSKIDESK-EKLV-VMRKAFKNNSSKYYI 284
           ++    +     +             +P     K    K  KLV +MR   +N  + Y I
Sbjct: 67  YRGILNDGNDNDNDDDSASDDDATTSNPKSAYVKAFYQKGNKLVELMRIISRNGDTSYKI 126

Query: 285 NDKESSFTQVTTLLKNEGIDLDHKRFLILQGEVENIAQMKPKSEKEGDDGLLEYLEDIIG 344
           + K  S+   +  L+NE I +  K FL+ QG+VE IA   P         L +  E++ G
Sbjct: 127 DGKSVSYRDYSVFLENENILIKAKNFLVFQGDVEQIAAQSPIE-------LSKMFEEVSG 179

Query: 345 TSHYKVQIEHNLSKVEALNEICIE 368
           +  YK + +    K+E L +   E
Sbjct: 180 SIQYKKEYDELKEKIEKLGKSATE 203

 Score = 74.3 bits (181), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 81/298 (27%), Positives = 148/298 (49%), Gaps = 42/298 (14%)

Query: 712 EKYDVAISTACPR-LEDLVVDSVDCGQQCIDYLRKNRLGYARFILLDKLRKFNLNRIETP 770
           EKY +A+ST   R  + ++V+++   Q+CI +L+K R G A FI LD +   +L  +  P
Sbjct: 547 EKYGLAVSTILGRNFDSVIVENLTVAQECIAFLKKQRAGTASFIPLDTIET-DLPTLSLP 605

Query: 771 DNAPRLFDLIQVRED-KFLPAFYSVLRDTLVATNLLHANKVAYGKR-RFRVVTLDGKLID 828
           D+   +  +  +  D ++  A   V  D+++   L  A  + + K  R ++VT++G LI 
Sbjct: 606 DSQDYILSINAIDYDSEYEKAMQYVCGDSIICNTLNIAKDLKWKKSVRAKLVTIEGALIH 665

Query: 829 ISGTMSGG--GNYVLR-------GLMKLGQDLPENDFEQTSPEEVQKLE-RELEILEKNF 878
            +G M+GG  G+   R       GLM L   L     E ++ +    +  RE+E      
Sbjct: 666 KAGLMTGGISGDANNRWDKEEYQGLMSLKDKLLIQIDELSNSQRSNSIRAREVE------ 719

Query: 879 KVAYNSLKEMNQEILHMKEQIPATELNISKTTIEIEY----CENEIKQLISQLKEKQEI- 933
               NS+  +N +I  ++ Q+   + ++ +  +EI+Y     E EI+  I++L+EK +  
Sbjct: 720 ----NSVSLLNSDIASLRTQVTQQKRSLDENNLEIKYHNDLIEKEIQPKITELEEKLKNL 775

Query: 934 --------HDQESNNNDEIKVADDKLQALKKEYYSLNDQTKVTKQ---EIEKLRQQIM 980
                    ++E+  ND  K   DK+    KEY   N   ++ +Q   E+++L++QI+
Sbjct: 776 ENTRNDLEKEKEALQNDIFKKFTDKIGFSIKEYE--NHSGELMRQQSRELQQLQKQIL 831

>Kpol_1011.5 s1011 complement(13399..17064) [3666 bp, 1221 aa] {ON}
            complement(13399..17064) [3666 nt, 1222 aa]
          Length = 1221

 Score =  142 bits (358), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 107/321 (33%), Positives = 170/321 (52%), Gaps = 49/321 (15%)

Query: 1131 TIREISQNLE-------SFDERLEKYDISKNGATEDTQHTSSALNSVSNINTDTMDIDST 1183
            ++ E+S +LE        F++ +EK D+ K G  ++ + +   L   S I  + +  D  
Sbjct: 904  SLNEVSNSLEISKREKLGFNDDIEKVDLEKIGIYKNCKISGIELPITSAITLENLPNDKI 963

Query: 1184 DNEINPGIKRLSELEI-------------NELDIESLDAEIENLEEQLEHSTANIEILEE 1230
            DN+    I   +E+E+             NE   + ++ EI++ EE+L     N + +E 
Sbjct: 964  DNDT---ILISNEIEVDYDELPAEYKESGNEAVGQKIEKEIKDAEEKLMELQPNSKAVER 1020

Query: 1231 YVRRLSEYKKRKSDLDESISEKETAKEETEVL-------KKKRLEEFTTGFDIISLTLKE 1283
            Y        + K   DE   E E  K++   L       KKKR E F   F+ ++  +  
Sbjct: 1021 Y-------DEAKDKFDEIDKETEGLKKKERKLLTQFVNIKKKRKELFEKAFEYVNEHIDP 1073

Query: 1284 MYQMIT---------MGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNISNLSGGEKTLS 1334
            +Y+ +T          GGNA L L D  +P++ GV +   PP K ++++  LSGGEKT++
Sbjct: 1074 IYRELTKNPNSSVELAGGNASLTLEDEDEPYNGGVKYHATPPLKRFKDMEYLSGGEKTVA 1133

Query: 1335 SLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKER-TKDAQLIVISLRNNMFEL 1393
            +LAL+FA++ Y+P+P +V+DEIDAALD  NV  +A YI+     + Q IVISL+N+MFE 
Sbjct: 1134 ALALLFAINSYQPSPFFVLDEIDAALDITNVERIATYIQRHGNPELQFIVISLKNSMFEK 1193

Query: 1394 SKQLVGIYK--SENMTQSATL 1412
            S+ LVGIY+   EN ++  TL
Sbjct: 1194 SEALVGIYRHQKENSSRIITL 1214

 Score =  100 bits (249), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 61/154 (39%), Positives = 91/154 (59%), Gaps = 8/154 (5%)

Query: 170 LVLTNFKSYAGRQVVGPFHTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLKDLI 229
           L L NFKSY G   VG   +NF++++GPNGSGKSN++D++ FV G +++ +R   LKDLI
Sbjct: 7   LELNNFKSYKGVVNVGFGESNFTSIIGPNGSGKSNMMDAISFVLGVQSSHLRSNVLKDLI 66

Query: 230 HKSEKYPELSSCSVEIHFQYVIDDPNGGPSKIDESKEKLV--VMRKAFKNNSSKYYINDK 287
           ++      LS    + + + V  +PN    K    KE +   +MR    +  S Y IN+K
Sbjct: 67  YRG----FLSGDDEDNNNEDV--NPNSAYVKAFYQKEDVTHELMRSISNSGDSTYKINNK 120

Query: 288 ESSFTQVTTLLKNEGIDLDHKRFLILQGEVENIA 321
             S+ Q T+ L++E I +  K FL+ QG+VE IA
Sbjct: 121 TVSYKQYTSFLEDENILIKAKNFLVFQGDVEQIA 154

>Smik_6.71 Chr6 (132627..136313) [3687 bp, 1228 aa] {ON} YFL008W
            (REAL)
          Length = 1228

 Score =  142 bits (358), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 72/163 (44%), Positives = 105/163 (64%), Gaps = 12/163 (7%)

Query: 1262 LKKKRLEEFTTGFDIISLTLKEMYQMIT---------MGGNAELELVDSLDPFSEGVTFS 1312
            +K+KR E F   FD +S  L  +Y+ +T          GGNA L + D  +PF+ G+ + 
Sbjct: 1059 IKRKRKELFEKTFDYVSDHLDAIYRELTKNPNSNVELAGGNASLTIEDEDEPFNAGIKYH 1118

Query: 1313 VMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1372
              PP K ++++  LSGGEKT+++LAL+FA++ Y+P+P +V+DE+DAALD  NV  +A YI
Sbjct: 1119 ATPPLKRFKDMEYLSGGEKTVAALALLFAINSYQPSPFFVLDEVDAALDITNVQRIAAYI 1178

Query: 1373 -KERTKDAQLIVISLRNNMFELSKQLVGIYK--SENMTQSATL 1412
             + R  D Q IVISL+N MFE S  LVG+Y+   EN ++  TL
Sbjct: 1179 RRHRNPDLQFIVISLKNTMFEKSDALVGVYRQQQENSSKIITL 1221

 Score =  104 bits (260), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 69/202 (34%), Positives = 106/202 (52%), Gaps = 10/202 (4%)

Query: 170 LVLTNFKSYAGRQVVGPFHTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLKDLI 229
           L L+NFKSY G   VG   +NF++++GPNGSGKSN++D++ FV G R+N +R   LKDLI
Sbjct: 7   LELSNFKSYRGITKVGFGESNFTSIIGPNGSGKSNMMDAISFVLGVRSNHLRSNILKDLI 66

Query: 230 HKSEKYPELSSCSVEIHFQYVI-DDPNGGPSKIDESK-EKLV-VMRKAFKNNSSKYYIND 286
           ++     +      +     V   +P     K    K  K+V +MR   +N  + Y I++
Sbjct: 67  YRGVLNDDNDDNYNDTSDDDVASSNPKSAYVKAFYQKGNKMVELMRIISRNGDTSYKIDE 126

Query: 287 KESSFTQVTTLLKNEGIDLDHKRFLILQGEVENIAQMKPKSEKEGDDGLLEYLEDIIGTS 346
           K  S+   +  L+NE I +  K FL+ QG+VE IA   P         L    E++ G+ 
Sbjct: 127 KTVSYKDYSIFLENENILIKAKNFLVFQGDVEQIAAQSPIE-------LSRMFEEVSGSI 179

Query: 347 HYKVQIEHNLSKVEALNEICIE 368
            YK + +    K+E L++   E
Sbjct: 180 QYKKEYDELKEKIEKLSKSATE 201

 Score = 67.4 bits (163), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 63/236 (26%), Positives = 118/236 (50%), Gaps = 28/236 (11%)

Query: 712 EKYDVAISTACPR-LEDLVVDSVDCGQQCIDYLRKNRLGYARFILLDKLRKFNLNRIETP 770
           EKY +A+ST   +  + ++V+++   Q+CI +L+K R G A FI LD +    L  +  P
Sbjct: 545 EKYGLAVSTILGKNFDSVIVENLTVAQECIAFLKKQRAGTASFIPLDTIET-ELPTLSLP 603

Query: 771 DNAPRLFDLIQV-REDKFLPAFYSVLRDTLVATNLLHANKVAYGKR-RFRVVTLDGKLID 828
           D+   +  +  +  E ++  A   V  D+++  +L  A  + + K  R ++VT++G LI 
Sbjct: 604 DSQEYILSINAIDYEPEYEKAMQYVCGDSIICNSLKIAKGLKWNKGVRAKLVTIEGALIH 663

Query: 829 ISGTMSGG--GNYVLR-------GLMKLGQDLPENDFEQTSPEEVQKLE-RELEILEKNF 878
            +G M+GG  G+   R        LM L   L     E ++ +    +  RE+E      
Sbjct: 664 KAGLMTGGISGDANNRWDKEEYQSLMSLKDKLLVQIDELSNSQRSNSIRAREVE------ 717

Query: 879 KVAYNSLKEMNQEILHMKEQIPATELNISKTTIEIEY----CENEIKQLISQLKEK 930
               NS+  +N +I  ++ Q+   + ++ +  +EI+Y     E EI+  I++L++K
Sbjct: 718 ----NSVSLLNSDIASLRTQVTQQKRSLDENNLEIKYHNDLLEKEIQPKITELEKK 769

>Kwal_23.5043 s23 (978758..982435) [3678 bp, 1225 aa] {ON} YFL008W
            (SMC1) - SMC chromosomal ATPase family member [contig 7]
            FULL
          Length = 1225

 Score =  142 bits (357), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 68/164 (41%), Positives = 105/164 (64%), Gaps = 10/164 (6%)

Query: 1262 LKKKRLEEFTTGFDIISLTLKEMYQMIT---------MGGNAELELVDSLDPFSEGVTFS 1312
            +K+ R E F   FD +S ++ E+Y+ +T          GGNA L L D  +P+  G+ + 
Sbjct: 1056 IKRLRKEAFEKAFDHVSSSIDEIYRELTRDPHSRAELAGGNASLTLEDEDEPYLAGIRYH 1115

Query: 1313 VMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1372
              PP K ++++  LSGGEKT+++LAL+FA++ ++P+P +V+DE+DAALD  NV  VA+YI
Sbjct: 1116 ATPPAKRFKDMEYLSGGEKTIAALALLFAINSFQPSPFFVLDEVDAALDISNVERVASYI 1175

Query: 1373 KERT-KDAQLIVISLRNNMFELSKQLVGIYKSENMTQSATLVNN 1415
            + +   D Q IVISL+N MFE S+ LVG+++ +    S  L  N
Sbjct: 1176 RRKAGADLQFIVISLKNTMFEKSQALVGVFRQQQNNTSKALTLN 1219

 Score =  101 bits (252), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 72/237 (30%), Positives = 117/237 (49%), Gaps = 15/237 (6%)

Query: 170 LVLTNFKSYAGRQVVGPFHTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLKDLI 229
           L L NFKSY G+  +G   +NF++++GPNGSGKSN++D++ FV G ++  +R   L DLI
Sbjct: 7   LELNNFKSYKGKVSIGFRDSNFTSIIGPNGSGKSNLMDAISFVLGVKSVHLRSHLLADLI 66

Query: 230 HK---SEKYPELSSCSVEIHFQYVIDDPNGGPSKIDESKEKLVVMRKAFKNNSSKYYIND 286
           ++   SE+    +    E H           PS  ++   +L   R   ++  S Y I+ 
Sbjct: 67  YRGTLSEEEASSADFESENHPNSAYVKAFYSPSNNEDDVVEL--SRTVTRSQESTYRIDG 124

Query: 287 KESSFTQVTTLLKNEGIDLDHKRFLILQGEVENIAQMKPKSEKEGDDGLLEYLEDIIGTS 346
           K   + + +  L++E I +  + FL+ QG+VE +A  KP+        L +  E + G+ 
Sbjct: 125 KTVGYKKYSQFLESENILIKARNFLVFQGDVEQVAAQKPQE-------LTDLFEQVSGSL 177

Query: 347 HYKV---QIEHNLSKVEALNEICIEKENRFNIVEKEKDSLVDGKNEALKYLANEKNL 400
            YK    +I   L +  +    CI+   R +I  K     VD   E  K+L +  NL
Sbjct: 178 QYKQDYDRIREELERARSETSDCIQSRKRAHIGLKSFKEGVDKDEEYRKHLEDRNNL 234

>KAFR0C03200 Chr3 (643231..646902) [3672 bp, 1223 aa] {ON} Anc_8.68
            YFL008W
          Length = 1223

 Score =  137 bits (345), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 69/163 (42%), Positives = 105/163 (64%), Gaps = 12/163 (7%)

Query: 1262 LKKKRLEEFTTGFDIISLTLKEMYQMITM---------GGNAELELVDSLDPFSEGVTFS 1312
            +KK+R E F   F+ ++  L  +Y+ +T          GGNA L L D  +PF+ G+ + 
Sbjct: 1054 IKKRRRELFEKAFEHVTNHLDSIYRELTRDPHSSAELSGGNASLTLEDEDEPFNAGIRYH 1113

Query: 1313 VMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1372
              PP K ++++  LSGGEKT+++LAL+FA++ ++P+P +V+DE+DAALD RNV  +A YI
Sbjct: 1114 ATPPLKRFKDMEYLSGGEKTMAALALLFAINSFQPSPFFVLDEVDAALDVRNVERIAAYI 1173

Query: 1373 KER-TKDAQLIVISLRNNMFELSKQLVGIYK--SENMTQSATL 1412
            +     + Q IVISL+N MFE S  LVG+Y+   EN ++  TL
Sbjct: 1174 RRHGNPNLQFIVISLKNTMFEKSDALVGVYRQQQENSSKIVTL 1216

 Score =  109 bits (273), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 103/379 (27%), Positives = 188/379 (49%), Gaps = 38/379 (10%)

Query: 170 LVLTNFKSYAGRQVVGPFHTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLKDLI 229
           L L NFKSY G   +G   +NF++++GPNGSGKSN++D++ FV G R++ +R   L+DLI
Sbjct: 7   LELYNFKSYKGSVKLGFGESNFTSIIGPNGSGKSNMMDAISFVLGVRSSHLRSSILRDLI 66

Query: 230 HKSEKYPELSSCSVEIHFQYVIDDPNGGPSKIDESKEKLVV--MRKAFKNNSSKYYINDK 287
           ++     E S    +      +++P+    K    KE   +  MR   +N  + Y I  K
Sbjct: 67  YRGVITGEDSESDEDGS----VNNPSTAYVKAFYEKENKTIELMRTISRNGDTNYKIGGK 122

Query: 288 ESSFTQVTTLLKNEGIDLDHKRFLILQGEVENIAQMKPKSEKEGDDGLLEYLEDIIGTSH 347
             S+   ++ L++E I +  K FL+ QG+VE IA   P         L    E++ G+  
Sbjct: 123 VVSYKDYSSFLESENILIKAKNFLVFQGDVEQIASQSPMD-------LSRLFEEVSGSIQ 175

Query: 348 YKVQIEHNLSKVEALNEICIEKENRFNIVEKEKDSLVDGKNEALKYLANEKNLVLAKSKK 407
           YK + +    K+E L++   E       +  E  +  +G N+  +Y +      +AK K+
Sbjct: 176 YKKEYDQLKEKMEQLSKAATESIKNRRRIHGELKTYKEGINKDEEYKSK-----VAKKKE 230

Query: 408 YQ-----HQLY-IDNKKLT---------STLAKITDAQENYDKELEKYST-ISKELKNLQ 451
            Q      QLY ++ KK+          S ++ + D   N ++ L++  T I+KE+  + 
Sbjct: 231 LQTILVLWQLYHLEQKKINIMKNMADTKSKMSVLKDKIHNEERNLQRAKTSIAKEMSIIT 290

Query: 452 DEEITLNKRLNETKKYEEKLLSNQRKNNSELISTQEMIKNIEKKKDNAEKLVNTTEKSIT 511
            ++  ++ +L E    +EK+ S+ +      +ST + I NIEK+ ++ EK +      + 
Sbjct: 291 KKKDKIDYKLKE----KEKIASDLKLIKLPQLSTIKRIGNIEKRIESFEKDIERQSSFVE 346

Query: 512 QTNNKLETLNNQQEDYTKQ 530
           +  N+L+ +   +E + ++
Sbjct: 347 RFTNQLKVVTKTKEAFERE 365

>KLTH0A02706g Chr1 complement(234723..238409) [3687 bp, 1228 aa] {ON}
            similar to uniprot|P32908 Saccharomyces cerevisiae
            YFL008W SMC1 Subunit of the multiprotein cohesin complex
            essential protein involved in chromosome segregation and
            in double-strand DNA break repair SMC chromosomal ATPase
            family member binds DNA with a preference for DNA with
            secondary structure
          Length = 1228

 Score =  136 bits (343), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 64/163 (39%), Positives = 108/163 (66%), Gaps = 12/163 (7%)

Query: 1262 LKKKRLEEFTTGFDIISLTLKEMYQMIT---------MGGNAELELVDSLDPFSEGVTFS 1312
            +++ R + F + FD +S  + ++Y+ +T          GGNA L L D  +P+  G+ + 
Sbjct: 1059 IRRLRKDAFESAFDHVSNAIDDVYRELTRDPHSTAELAGGNASLTLEDEDEPYLAGIRYH 1118

Query: 1313 VMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1372
              PP K ++++  LSGGEKT+++LAL+FA++ ++P+P +V+DE+DAALD  NV  +A YI
Sbjct: 1119 ATPPTKRFKDMEFLSGGEKTIAALALLFAINSFQPSPFFVLDEVDAALDILNVERIATYI 1178

Query: 1373 KERT-KDAQLIVISLRNNMFELSKQLVGIYKSE--NMTQSATL 1412
            ++R   + Q IVISL+N MFE S+ LVG+++ +  N +++ TL
Sbjct: 1179 RQRALSNLQFIVISLKNTMFEKSQALVGVFRQQRDNTSRALTL 1221

 Score = 94.7 bits (234), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 92/330 (27%), Positives = 146/330 (44%), Gaps = 64/330 (19%)

Query: 172 LTNFKSYAGRQVVGPFHTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLKDLI-- 229
           L NFKSY G+  +G   +NF++V+GPNGSGKSN++D++ FV G ++  +R   L DLI  
Sbjct: 9   LYNFKSYKGKVSIGFGESNFTSVIGPNGSGKSNLMDAISFVLGMKSIHLRSHTLADLIYR 68

Query: 230 ---------------HKSEKYPELSSCSVEIHFQYVIDDPNGGPSKIDESKEKLVVMRKA 274
                          H +E  P  SS  V+  +      P+G  + + E      + R  
Sbjct: 69  GTLQDGDADSGYSETHDNENNP--SSAYVKAFY-----SPSGQENDVAE------LTRTI 115

Query: 275 FKNNSSKYYINDKESSFTQVTTLLKNEGIDLDHKRFLILQGEVENIAQMKPKSEKEGDDG 334
             +  S Y +N +  S  +    L++E I +  + FL+ QG+VE +A  KP+        
Sbjct: 116 TLSQESTYKLNGETVSHKKYCDFLESENILIKARNFLVFQGDVEQVASQKPRE------- 168

Query: 335 LLEYLEDIIGTSHYKVQ---IEHNLSKVEALNEICIEKENRFNIVEKEKDSLVDGKNEAL 391
           L    E + G+  YK +   +   L K  +     I+   R NI  K     V+   E  
Sbjct: 169 LTTLFEQVSGSIQYKQEYDRLREELEKARSATSELIQSRKRANIGLKSFKEGVNKDEEYR 228

Query: 392 KYLANEKNLVLAKSKKYQHQLYIDNKKLTSTLAKITDAQENYDKELEKYSTISKELKNL- 450
           K+L  E+N       K Q QL +          ++   Q   D   E   +  +EL++L 
Sbjct: 229 KHL-EERN-------KLQQQLIV---------WQLFHLQAKRDSLTESLKSSQRELQSLD 271

Query: 451 ----QDEEITLNKRLNETKKYEEKLLSNQR 476
                +E+I   K+L+  KK  + L + QR
Sbjct: 272 SELNSEEQIVAKKKLSYAKK--QTLAAKQR 299

 Score = 69.3 bits (168), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 75/305 (24%), Positives = 141/305 (46%), Gaps = 39/305 (12%)

Query: 712 EKYDVAISTACPR-LEDLVVDSVDCGQQCIDYLRKNRLGYARFILLDKL--RKFNLNRIE 768
           EKY VA+ST   +  + ++VD     QQC+ +L+K R G   FI LD +   K ++  ++
Sbjct: 546 EKYTVAVSTILGKSFDAVIVDHFSVAQQCVSFLKKQRSGILSFIPLDTIDVNKVSMMALD 605

Query: 769 TPDNAPRLFDLIQVREDKFLPAFYSVLRDTLVATNLLHANKVAYGKR-RFRVVTLDGKLI 827
           T        D I    D    A   V  D+++  +L  A  + + +  R ++V+LDG ++
Sbjct: 606 TK-GCTLAIDAIDYERD-LERAMQYVCSDSIICDSLAIAKDLKWRRNVRAKLVSLDGSIV 663

Query: 828 DISGTMSGG-----GNYV----LRGLMKLGQDLPENDFEQTSPEEVQKLERELEILEKNF 878
             +G M+GG     GN       +GLM L         + T   E+ +L     I  +  
Sbjct: 664 HKAGLMTGGTTKSSGNRWDKEEYQGLMSL---------KDTLLGEISELSSANTIDSERI 714

Query: 879 KVAYNSLKEMNQEILHMKEQIPATELNISKTTIEIEY----CENEIKQLISQLKEKQEIH 934
           +   N L  +N +++ ++ Q+   + ++++   EI+Y     + E +  I  LKE    H
Sbjct: 715 RSTENELSFLNSDVMSLRTQLNQVKRSLNEKETEIQYQQELIKGEFEPKIQSLKEAMTAH 774

Query: 935 DQESNNNDEIKVADDKLQALKKEY-----YSLNDQTK----VTKQEIEKLRQQIMDAGGI 985
            + +   +E K  D  L ++  ++     + ++   K    + ++++E LR+  M   GI
Sbjct: 775 AKTTARFEEEK--DRLLDSVYADFEGDIGFKVSQYEKHSGEMMRRQLEDLRKLQMQIAGI 832

Query: 986 ELKMQ 990
           E K++
Sbjct: 833 EKKLE 837

>KLLA0D07502g Chr4 complement(642751..646482) [3732 bp, 1243 aa] {ON}
            similar to uniprot|P32908 Saccharomyces cerevisiae
            YFL008W SMC1 Subunit of the multiprotein cohesin complex
            essential protein involved in chromosome segregation and
            in double-strand DNA break repair SMC chromosomal ATPase
            family member binds DNA with a preference for DNA with
            secondary structure
          Length = 1243

 Score =  135 bits (339), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 79/214 (36%), Positives = 127/214 (59%), Gaps = 18/214 (8%)

Query: 1225 IEILEEYVRRLSEYKKRKSDLDESISEKE-------TAKEETEVLKKKRLEEFTTGFDII 1277
            +EIL+   + +  Y + K  LD+  +E E        AKE+   +K KR E F   F  +
Sbjct: 1029 LEILQPNSKAVQRYDETKHKLDQVSNENERLRNKERKAKEKFLEVKAKRKELFEACFKHV 1088

Query: 1278 SLTLKEMYQMIT---------MGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNISNLSG 1328
               + ++Y+ +T          GGNA L + +  +P+  G+ +   PP K ++++  LSG
Sbjct: 1089 DKHIDQIYRALTKNPHDKSELAGGNASLTVENEDEPYLGGIKYFATPPLKRFKDMEYLSG 1148

Query: 1329 GEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT-KDAQLIVISLR 1387
            GEKT+++LAL+F ++ Y+P+P +V+DE+DAALD  NV  +A+YIK     +AQ IVISL+
Sbjct: 1149 GEKTMAALALLFTINSYQPSPFFVLDEVDAALDITNVERIAHYIKRNANPNAQFIVISLK 1208

Query: 1388 NNMFELSKQLVGIYKSENMTQSATLVNNDMLNRD 1421
            N MFE S+ LVGI++ E    S+ +V+ ++ N D
Sbjct: 1209 NAMFEKSQSLVGIFR-EQEDNSSRMVSLNLENYD 1241

 Score = 90.9 bits (224), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 72/224 (32%), Positives = 107/224 (47%), Gaps = 50/224 (22%)

Query: 170 LVLTNFKSYAGRQVVGPFHTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLKDLI 229
           L L NFKSY     VG   + F++++GPNGSGKSN++D++ FV G R+N++R   L DLI
Sbjct: 7   LELHNFKSYKDTVQVGFGESYFTSIIGPNGSGKSNLMDAISFVLGVRSNQLRSSALVDLI 66

Query: 230 HK----------------------SEKYPELSSCSVE------IHFQYVIDDPNGGPSKI 261
           ++                      SE  PE ++ S E      +   Y  DD +  P+K 
Sbjct: 67  YRGRIENGDPDNGNAKRMHRSDADSEAGPENATYSEEEPRSAYVSCVYQKDDLD-EPTKF 125

Query: 262 DESKEKLVVMRKAFKNNSSKYYINDKESSFTQVTTLLKNEGIDLDHKRFLILQGEVENIA 321
                     R    +  S Y IND+  S+ +    L++E I +  K FL+ QG+VE IA
Sbjct: 126 ---------TRTINTSGDSVYKINDRAVSYKKYNEELESENILVKAKNFLVFQGDVERIA 176

Query: 322 QMKPKSEKEGDDGLLEYLEDIIGTSHY-----KVQIEHNLSKVE 360
              P+S       L   LE + G+ +Y     K++ EH L+  E
Sbjct: 177 SQGPES-------LTLLLEQVSGSINYKNDYEKLKEEHKLALAE 213

>SAKL0B02288g Chr2 (215750..219436) [3687 bp, 1228 aa] {ON} similar to
            uniprot|P32908 Saccharomyces cerevisiae YFL008W SMC1
            Subunit of the multiprotein cohesin complex essential
            protein involved in chromosome segregation and in
            double-strand DNA break repair SMC chromosomal ATPase
            family member binds DNA with a preference for DNA with
            secondary structure
          Length = 1228

 Score =  132 bits (332), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 76/212 (35%), Positives = 130/212 (61%), Gaps = 16/212 (7%)

Query: 1217 QLEHSTANIEILEEYVRRLSEYKKRKSDLD---ESISEKET-AKEETEVLKKKRLEEFTT 1272
            ++EH+   ++   + V R  E + R   ++   ES+  KE   +E+   +K+ R E F  
Sbjct: 1010 KIEHALLELQPNSKAVERYEETQMRYDVINGETESLKAKEKKIREQYLKVKQSRREMFEK 1069

Query: 1273 GFDIISLTLKEMYQMIT---------MGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNI 1323
             ++ +S  + ++Y+ +T          GG+A L L D  +P+  G+ +   PP K ++++
Sbjct: 1070 AYNHVSDHIDQIYRELTKDPHSTAALAGGSASLTLEDEDEPYLAGIKYHATPPMKRFKDM 1129

Query: 1324 SNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKER-TKDAQLI 1382
             +LSGGEKT+++LAL+FA++ Y+P+P +V+DE+DAALD  NV  +A YIK   + + Q I
Sbjct: 1130 EHLSGGEKTVAALALLFAINSYQPSPFFVLDEVDAALDNTNVEKIATYIKRHASPNFQFI 1189

Query: 1383 VISLRNNMFELSKQLVGIYK--SENMTQSATL 1412
            VISL+N+MFE S+ LVG+++   EN ++  TL
Sbjct: 1190 VISLKNSMFEKSQALVGVFRQQQENTSKVITL 1221

 Score = 94.0 bits (232), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 62/188 (32%), Positives = 97/188 (51%), Gaps = 11/188 (5%)

Query: 170 LVLTNFKSYAGRQVVGPFHTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLKDLI 229
           L L+NFKSY G   VG    NF++++GPNGSGKSN++D++ FV G R++ +R   L DL+
Sbjct: 7   LELSNFKSYKGTVKVGFGDANFTSIIGPNGSGKSNMMDAISFVLGVRSSHLRSHLLMDLV 66

Query: 230 HKSEKYPELSSCSVEIHFQYVIDDPNGGPSK---IDESKEKLV-VMRKAFKNNSSKYYIN 285
           ++  +  +      E      I        K   + E +E  +  MR   ++  S Y +N
Sbjct: 67  YRGRRTGDEEESMEEEPSSSKISSTRSAYVKAFYLKEGEESPIEFMRTISRSGESAYKVN 126

Query: 286 DKESSFTQVTTLLKNEGIDLDHKRFLILQGEVENIAQMKPKSEKEGDDGLLEYLEDIIGT 345
            K   +   T +L+ E I +  + FL+ QG+VE IA     S+  G+  L +  E I G+
Sbjct: 127 GKTVGYKDYTDILEKENILIKARNFLVFQGDVEQIA-----SQSAGE--LTKLFEQISGS 179

Query: 346 SHYKVQIE 353
             YK + E
Sbjct: 180 VQYKREYE 187

 Score = 73.9 bits (180), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 78/295 (26%), Positives = 135/295 (45%), Gaps = 37/295 (12%)

Query: 642 SGDIEFNKFTKKIQEMRDKLDSHRQKANDSRTSLSNVQNKNSVLTALFKLQKSGRISGFY 701
           S + E N   +++    D L +++++ N  R    NV    + L  LF         G  
Sbjct: 487 SKEYELNYKLREVLVKLDDLSANQRETNKERKLRENV----ATLKRLF--------PGVR 534

Query: 702 GRLGDLG-VIDEKYDVAISTACPR-LEDLVVDSVDCGQQCIDYLRKNRLGYARFILLDKL 759
           G + DL     +KY VA+ST   +  + ++VD+    Q+CI YL++ R G A FI LD +
Sbjct: 535 GLVHDLCHPKKDKYAVAVSTVLGKNFDSVIVDNFSVAQECISYLKRQRSGVASFIPLDTI 594

Query: 760 RKFNLNRIETPDNAPRLFDLIQVREDKFL-PAFYSVLRDTLVATNLLHANKVAYGKR-RF 817
                N +   +    +  +  +  D  L  A   V  D+++  +L  A  + + +  R 
Sbjct: 595 DAITAN-LPVSNTKGCILAIDSISYDSELEKAMQYVCSDSIICDSLDLAKDLKWNRGIRS 653

Query: 818 RVVTLDGKLIDISGTMSGG----GNYVL-----RGLMKLGQDLPENDFEQTSPEEVQKLE 868
           ++VTL+G LI  +G M+GG    GN        +GL+ L   L     E  S E +   +
Sbjct: 654 KLVTLEGALIHKAGLMTGGASREGNNRWDKEEYQGLLALKNRLTSESTELISHERLDSAK 713

Query: 869 -RELEILEKNFKVAYNSLKEMNQEILHMKEQIPATELNISKTTIEIEYCENEIKQ 922
            RELE          N +  +N EI  ++ Q+   + ++ +  +EI+Y E+ +K+
Sbjct: 714 ARELE----------NEISVLNTEISGLRTQLNQIQRSLKENKVEIQYHEDMVKK 758

>Ecym_7303 Chr7 (638719..642387) [3669 bp, 1222 aa] {ON} similar to
            Ashbya gossypii AGL023W
          Length = 1222

 Score =  129 bits (323), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 81/257 (31%), Positives = 143/257 (55%), Gaps = 25/257 (9%)

Query: 1174 NTDTMDIDSTDNEINPGIKRLSELEINELDIESLDAEIENLEEQLEHSTANIEILEEYVR 1233
            N+ T+D  S DN+       L+  E      E    +IEN   +L+ ++  +E  +E   
Sbjct: 971  NSITVDYSSLDNKYKESGSNLTREEF-----EDSIKDIENTLRELQPNSKAVERFDEAKE 1025

Query: 1234 RLSEYKKRKSDLDESISEKETAKEETEV---LKKKRLEEFTTGFDIISLTLKEMYQMIT- 1289
            + S        +DES   KE  +E  E    +K+KR++ F + F  ++  +  +Y+ +T 
Sbjct: 1026 QFS------VAIDESEKLKEIERESKEKYLKIKEKRVKTFLSCFQHVTDHIDRIYRELTR 1079

Query: 1290 --------MGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFA 1341
                     GG+A L L D  +P+  G+ +   PP K ++++  LSGGEKT+++LAL+FA
Sbjct: 1080 NPGSTAELAGGSASLTLEDEDEPYLAGIRYHATPPMKRFKDMDYLSGGEKTMAALALLFA 1139

Query: 1342 LHKYKPTPLYVMDEIDAALDFRNVSIVANYIKER-TKDAQLIVISLRNNMFELSKQLVGI 1400
            ++ Y+P+P +++DE+DAALD  NV  +A YIK   +   Q IVISL++N+F  S+ + G+
Sbjct: 1140 INSYQPSPFFILDEVDAALDVTNVERIAAYIKRHASPKFQFIVISLKSNLFGKSQSMAGV 1199

Query: 1401 YKSENMTQSATLVNNDM 1417
            ++++    S+ ++  D+
Sbjct: 1200 FRNQQ-ANSSMVITTDL 1215

 Score = 94.7 bits (234), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 59/159 (37%), Positives = 82/159 (51%), Gaps = 16/159 (10%)

Query: 170 LVLTNFKSYAGRQVVGPFHTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLKDLI 229
           L L NFKSY G   VG  + +F ++VGPNGSGKSN++D++ FV G R+N +R   L DLI
Sbjct: 7   LELNNFKSYKGTHNVGFGNKHFISIVGPNGSGKSNMMDAISFVLGIRSNHLRSNALVDLI 66

Query: 230 HKS-------EKYPELSSCSVEIHFQYVIDDPNGGPSKIDESKEKLVVMRKAFKNNSSKY 282
           ++        E      S  V+  +   + D NG      E   K+  MR       S Y
Sbjct: 67  YRGRMDDRSDEHVASPKSAYVKAFY---LKDDNG------EQGTKIEFMRIIQNTGDSVY 117

Query: 283 YINDKESSFTQVTTLLKNEGIDLDHKRFLILQGEVENIA 321
            I+ K  SF +    L+ E I +  + FL+ QG+VE IA
Sbjct: 118 RIDGKTVSFKRYVEYLEGESILVKARNFLVFQGDVEQIA 156

 Score = 65.5 bits (158), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 66/226 (29%), Positives = 107/226 (47%), Gaps = 34/226 (15%)

Query: 623 SEKITGWKQQLLEQRKEVESGDIEFNKFTKKIQEMRDKLD---SHRQKANDSRTSLSNVQ 679
           S K+  WK    E +  +ES + +  +   K++E+  KLD   + ++++N  R    NV 
Sbjct: 461 SAKVKEWK----EVQSAIESANNKEYELNYKLKEVLVKLDDLTADQRESNKERKLRENV- 515

Query: 680 NKNSVLTALFKLQKSGRISGFYGRLGDLGVID-EKYDVAISTACPR-LEDLVVDSVDCGQ 737
              + L  LF         G  G + DL     +KY +A+S+   +  + +VVDSV   Q
Sbjct: 516 ---ATLKRLF--------PGVKGLVHDLCRPKKDKYALAVSSMLGKNFDSIVVDSVSVAQ 564

Query: 738 QCIDYLRKNRLGYARFILLDKLRKFNLNRIETPDNAPR-----LFDLIQVREDKFL-PAF 791
           QCI YL+K+R G A FI LD +       I TP    R     +  +  +  D  L  A 
Sbjct: 565 QCISYLKKHRSGAASFIPLDTI------DINTPTLPVRNLKGCILTVNAIEYDSELEKAM 618

Query: 792 YSVLRDTLVATNLLHANKVAYGKR-RFRVVTLDGKLIDISGTMSGG 836
             V  D+++   L  A  + + +  + ++VT+ G LI  +G M+GG
Sbjct: 619 QYVCSDSIICDTLDIAKNLKWDRGIKSKLVTIQGALIHRAGLMTGG 664

>AGL023W Chr7 (670877..674545) [3669 bp, 1222 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YFL008W (SMC1)
          Length = 1222

 Score =  124 bits (310), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 60/173 (34%), Positives = 108/173 (62%), Gaps = 11/173 (6%)

Query: 1255 AKEETEVLKKKRLEEFTTGFDIISLTLKEMYQMIT---------MGGNAELELVDSLDPF 1305
            AKE    +K+KR+  F   F+ +   +  +Y+ +T          GG+A L L D  +P+
Sbjct: 1044 AKELYLKIKEKRINTFLACFNHVRDNIDRIYRELTRNPGSTAELAGGSASLTLEDEDEPY 1103

Query: 1306 SEGVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNV 1365
              G+ +   PP K ++++  LSGGEKT+++LAL+FA++ Y+P+P +++DE+DAALD  NV
Sbjct: 1104 LGGIRYHATPPMKRFKDMDYLSGGEKTMAALALLFAINSYQPSPFFILDEVDAALDVTNV 1163

Query: 1366 SIVANYIKER-TKDAQLIVISLRNNMFELSKQLVGIYKSENMTQSATLVNNDM 1417
              +A YI+   +   Q IVISL++N+F  S+ + G++++++   S+ ++  D+
Sbjct: 1164 ERIAAYIRRHASPKMQFIVISLKSNLFSKSESMAGVFRNQH-ENSSMVITTDL 1215

 Score = 92.4 bits (228), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 103/391 (26%), Positives = 178/391 (45%), Gaps = 68/391 (17%)

Query: 170 LVLTNFKSYAGRQVVGPFHTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLKDLI 229
           L + NFKSY G   VG    NF ++VGPNGSGKSN++D++ FV G R++ +R   L DLI
Sbjct: 7   LEVKNFKSYKGVHNVGFGGKNFISIVGPNGSGKSNMMDAISFVLGIRSSHLRSSALVDLI 66

Query: 230 HKSEKYPELSSC------SVEIHFQYVIDDPNGGPSKIDESKEKLVVMRKAFKNNSSKYY 283
           ++  +  E  S       S  +   YV  D +G   +++         R       S Y 
Sbjct: 67  YRG-RMEEGGSAHENNPKSAYVTAFYVKQDASGAERRME-------FTRVIHNTGDSTYK 118

Query: 284 INDKESSFTQVTTLLKNEGIDLDHKRFLILQGEVENIAQMKPKSEKEGDDGLLEYLEDII 343
           ++ K   + +   +L+ E I +  + FL+ QG+VE IA       + G D L +  E + 
Sbjct: 119 LDGKTVGYKEYVDVLEGERILVKARNFLVFQGDVEQIAS------QSGVD-LTKLFEQVS 171

Query: 344 GTSHYKVQIEH---NLSKVEALNEICIEKENRFNIVEKEKDSLVDGKNEALKYLANEKNL 400
           G+  Y+ + E    +  K  A     ++   +  I  K   S  +G  +  +Y++     
Sbjct: 172 GSVQYQREYERLKDDYEKASAEYNESLKARRKMQIDLK---SFKEGVQKEEQYIS----- 223

Query: 401 VLAKSKKYQH-----QLYIDNKKLTSTLAKITDAQENYDKELEKYSTISKELKNLQDEEI 455
           +LA+  K Q      QL+    K +  +A + D++        K S + ++L N   EE 
Sbjct: 224 LLAERVKLQQQFMLWQLFHLQSKRSGLVASLKDSK-------AKLSQLKRQLSN---EEA 273

Query: 456 TLNKRLNETKKYEEKLLSNQRKN-----------NSELI--------STQEMIKNIEKKK 496
            L K  +   K EE LL+ +R+            N++L+        +T+ M+ NIEK+ 
Sbjct: 274 ILGKSKSLVAK-EELLLARRRETLLQKQQDKARLNAQLLPVGSARQGTTRRMV-NIEKRI 331

Query: 497 DNAEKLVNTTEKSITQTNNKLETLNNQQEDY 527
           D+ ++ +   E  + Q  N+L+ +   +  +
Sbjct: 332 DSLQRDIERQESYVKQLKNQLKVVGKTKASF 362

>TDEL0H02610 Chr8 (434116..437628) [3513 bp, 1170 aa] {ON} Anc_7.186
           YFR031C
          Length = 1170

 Score =  104 bits (259), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 72/215 (33%), Positives = 112/215 (52%), Gaps = 20/215 (9%)

Query: 167 IERLVLTNFKSYAGRQVVGPFHTNFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQGKL 225
           IE L++  FKSYA R V+  +   F+A+ G NGSGKSN++D++ FV G  A   +R   L
Sbjct: 3   IEELIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNILDAICFVLGISAMTTVRASSL 62

Query: 226 KDLIHKSEKYPELSSCSVEIHFQYVIDDPNGGPSKIDESKEKLVVMRKAFKNNSSKYYIN 285
           +DLI+K  +   ++  SV + F     D +  P     S  K+ V R+     SSKY IN
Sbjct: 63  QDLIYKRGQ-AGVTKASVTVVFDN--SDKSNSPIGFTNSA-KISVTRQVMLGGSSKYLIN 118

Query: 286 DKESSFTQVTTLLKNEGIDLDHKRFLILQGEVENIAQMKPKSEKEGDDGLLEYLEDIIGT 345
              +    V  L ++  +++++  FLI+QG++  +  MKPK        +L  +E+  GT
Sbjct: 119 GHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPKE-------ILSLIEEAAGT 171

Query: 346 SHY---KVQIEHNLSKVEALNEICIEKENRFNIVE 377
             +   K + E  ++K EA  E     ENR  +VE
Sbjct: 172 KMFEDRKDKAERTMAKKEAKLE-----ENRALLVE 201

 Score = 80.9 bits (198), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 34/86 (39%), Positives = 57/86 (66%)

Query: 1306 SEGVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNV 1365
            +EG+ F V        ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  + 
Sbjct: 1064 TEGLEFKVRLGSIWKESLVELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHT 1123

Query: 1366 SIVANYIKERTKDAQLIVISLRNNMF 1391
              + + IK R K +Q IV+SL+  MF
Sbjct: 1124 QNIGHLIKTRFKGSQFIVVSLKEGMF 1149

 Score = 34.7 bits (78), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 50/199 (25%), Positives = 86/199 (43%), Gaps = 29/199 (14%)

Query: 661 LDSHRQKANDSRTSLSNVQNKNS-----VLTALFKLQKSGR------ISGFYGRLGDLGV 709
           ++S +Q+ N+ R  +S + N++S     V    F   K         + G   +L  L  
Sbjct: 476 VESLKQEENNLRHEISRLNNESSYLRRKVANVDFTYSKPTHDFNPRSVKGVAAQLFTLA- 534

Query: 710 IDEKYDVAIS---TACPRLEDLVVDSVDCGQQCIDYLRKNRL-GYARFILLDKL--RKFN 763
            ++ YD A +    A  RL ++VVD+     Q    L K RL      I L+++  R  N
Sbjct: 535 -EDNYDSATALQVCAGGRLYNVVVDNERTASQL---LEKGRLRKRVTIIPLNRIAARALN 590

Query: 764 -----LNRIETPDNAPRLFDLIQVREDKFLPAFYSVLRDTLVATNLLHANKVAYGKR-RF 817
                L +   P       +L+   E++   A   +  ++L+  +   A K+ +  + R 
Sbjct: 591 SQTLQLAQKTAPGKVELALNLVGY-EEEVSRAMEFIFGNSLICKDAETAKKITFHPQIRT 649

Query: 818 RVVTLDGKLIDISGTMSGG 836
           R +TL G + D  GT+SGG
Sbjct: 650 RSITLQGDVYDPEGTLSGG 668

>ZYRO0D15642g Chr4 complement(1307703..1311215) [3513 bp, 1170 aa]
           {ON} similar to uniprot|P38989 Saccharomyces cerevisiae
           YFR031C SMC2 Component of the condensin complex
           essential SMC chromosomal ATPase family member that
           forms a complex with Smc4p to form the active ATPase
           Smc2p/Smc4p complex binds DNA possibly in the cleft
           formed by the coiled-coil of the folded dimer
          Length = 1170

 Score =  103 bits (257), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 62/183 (33%), Positives = 99/183 (54%), Gaps = 12/183 (6%)

Query: 167 IERLVLTNFKSYAGRQVVGPFHTNFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQGKL 225
           IE L++  FKSYA R V+  +   F+A+ G NGSGKSNV+D++ FV G  + + +R   L
Sbjct: 3   IEELIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNVLDAICFVLGIASMSTVRASSL 62

Query: 226 KDLIHKSEKYPELSSCSVEIHFQYVIDDPNGGPSKIDESKEKLVVMRKAFKNNSSKYYIN 285
           +DLI+K  +   ++  SV I F  +  DP   P   + S  KL V R+     +SKY IN
Sbjct: 63  QDLIYKRGQ-AGVTKASVTIVFSNL--DPKCSPIGFENSP-KLSVTRQIILGGTSKYLIN 118

Query: 286 DKESSFTQVTTLLKNEGIDLDHKRFLILQGEVENIAQMKPKSEKEGDDGLLEYLEDIIGT 345
              +    V  L ++  +++++  FLI+QG++  +  MKP         +L  +E+  GT
Sbjct: 119 GHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPSE-------ILSLIEEAAGT 171

Query: 346 SHY 348
             +
Sbjct: 172 KMF 174

 Score = 78.6 bits (192), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 53/73 (72%), Gaps = 1/73 (1%)

Query: 1320 WR-NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKD 1378
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1379 AQLIVISLRNNMF 1391
            +Q IV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

 Score = 34.3 bits (77), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 89/359 (24%), Positives = 151/359 (42%), Gaps = 82/359 (22%)

Query: 654 IQEMRDKLDSHRQKANDS-------RTSLSNVQNKNSVLTALFKLQKSGRISGFYGRLGD 706
           ++E+R K  S RQ+ ++        R S++N++   ++ +  F       + G   +L  
Sbjct: 476 VKELRQKEYSMRQELHNVGRETEYLRRSVANIEFNYTMPSEKFD---PNSVKGVAAQLFT 532

Query: 707 LGVIDEKYDVAIS---TACPRLEDLVVDSVDCGQQCIDY--LRKNRLGYARFILLDKL-- 759
           L   +  YD A++    A  RL +++VD  +   Q ++   LRK        I L+K+  
Sbjct: 533 LS--ENNYDSALALQVCAGGRLFNVIVDDQNTASQLLERGKLRKR----VTIIPLNKIAT 586

Query: 760 RKFN-----LNRIETPDNAPRLFDLIQVREDKFLPAFYSVLRDTLVATNLLHANKVAYGK 814
           R  N     L +   P       +L+   E++   A   +  ++LV  +   A ++ +  
Sbjct: 587 RVINSESLKLAKQLAPGKVQLALNLVGY-EEEVSKAMEYIFGNSLVCNDAETAKRLTFHP 645

Query: 815 R-RFRVVTLDGKLIDISGTMSGGGNYVLRGLMKLGQDLPENDFEQTSPEEVQKL---ERE 870
           + R R +T  G + D  GT+SGG                  + + T   ++QK     + 
Sbjct: 646 QIRTRSITQQGDVYDPEGTLSGGS----------------RNNKSTLLVDIQKYNSAAKR 689

Query: 871 LEILEKNFKVAYNSLKEMNQEILHMKE--------------------QIPATELNISKT- 909
           +++LE    V  N LKE        KE                    + PAT++ I +  
Sbjct: 690 MKVLEDELLVISNKLKEQESASAKTKEIQNKLNLVSHKLSIFQRTLNENPATQI-IKRND 748

Query: 910 --TIEIEYCENEIKQ---LISQLK-EKQEIH-DQESNNNDEIKVADDKLQALKKEYYSL 961
             T +I  CE EI+Q    +SQL+ E ++I  D E  NND+      KL+ LKKE  SL
Sbjct: 749 DLTRQIRECEEEIEQKQSYMSQLQDEIRKIQDDMEEFNNDK----GTKLEKLKKEIDSL 803

>AGR236W Chr7 (1189845..1193357) [3513 bp, 1170 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YFR031C (SMC2)
          Length = 1170

 Score =  102 bits (254), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 61/183 (33%), Positives = 99/183 (54%), Gaps = 12/183 (6%)

Query: 167 IERLVLTNFKSYAGRQVVGPFHTNFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQGKL 225
           +E L++  FKSYA R V+  +   F+A+ G NGSGKSN++DS+ FV G  +   +R   L
Sbjct: 3   VEELIIDGFKSYATRTVISGWDPQFNAITGLNGSGKSNILDSICFVLGISSMATVRAQNL 62

Query: 226 KDLIHKSEKYPELSSCSVEIHFQYVIDDPNGGPSKIDESKEKLVVMRKAFKNNSSKYYIN 285
           +DLI+K  +   + + SV I F     DP+  P    E+  K+ V R+     +SKY IN
Sbjct: 63  QDLIYKRGQAGVIKA-SVTIVFDN--SDPSSSPFGF-ETYPKISVTRQIILGGTSKYLIN 118

Query: 286 DKESSFTQVTTLLKNEGIDLDHKRFLILQGEVENIAQMKPKSEKEGDDGLLEYLEDIIGT 345
              +    V  L ++  +++++  FLI+QG++  +  MKP       D +L  +E+  GT
Sbjct: 119 GHRAQQLTVLHLFQSVQLNINNPNFLIMQGKITKVLNMKP-------DEILALIEEAAGT 171

Query: 346 SHY 348
             +
Sbjct: 172 RMF 174

 Score = 64.7 bits (156), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 53/73 (72%), Gaps = 1/73 (1%)

Query: 1320 WR-NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKD 1378
            W+ ++  LSGG+++L +L+L+ AL ++KP P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLILALLQFKPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1379 AQLIVISLRNNMF 1391
            +Q IV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

>NDAI0G02070 Chr7 (461697..465212) [3516 bp, 1171 aa] {ON} Anc_7.186
           YFR031C
          Length = 1171

 Score =  100 bits (248), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 59/183 (32%), Positives = 97/183 (53%), Gaps = 12/183 (6%)

Query: 167 IERLVLTNFKSYAGRQVVGPFHTNFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQGKL 225
           +E L++  FKSYA R V+  +   F+A+ G NGSGKSN++D++ FV G  +   +R   L
Sbjct: 3   VEELIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNILDAICFVLGITSMTTVRASNL 62

Query: 226 KDLIHKSEKYPELSSCSVEIHFQYVIDDPNGGPSKIDESKEKLVVMRKAFKNNSSKYYIN 285
           +DLI+K  +   ++  SV I F     D    P   + S  K+ V R+     +SKY IN
Sbjct: 63  QDLIYKRGQ-AGITKASVTIVFDNT--DKTNSPIGFNNSA-KISVTRQVVLGGTSKYLIN 118

Query: 286 DKESSFTQVTTLLKNEGIDLDHKRFLILQGEVENIAQMKPKSEKEGDDGLLEYLEDIIGT 345
              +    V  L ++  +++++  FLI+QG++  +  MKPK        +L  +E+  GT
Sbjct: 119 GHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPKE-------ILSLIEEAAGT 171

Query: 346 SHY 348
             +
Sbjct: 172 KMF 174

 Score = 78.6 bits (192), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 53/73 (72%), Gaps = 1/73 (1%)

Query: 1320 WR-NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKD 1378
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1078 WKESLVELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1137

Query: 1379 AQLIVISLRNNMF 1391
            +Q IV+SL+  MF
Sbjct: 1138 SQFIVVSLKEGMF 1150

>Kwal_55.20421 s55 (391382..394894) [3513 bp, 1170 aa] {ON} YFR031C
           (SMC2) - SMC chromosomal ATPase family member [contig
           149] FULL
          Length = 1170

 Score =  100 bits (248), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 60/183 (32%), Positives = 98/183 (53%), Gaps = 12/183 (6%)

Query: 167 IERLVLTNFKSYAGRQVVGPFHTNFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQGKL 225
           +E L++  FKSYA R V+  +   F+A+ G NGSGKSN++D++ FV G  + + +R   L
Sbjct: 3   VEELIIDGFKSYATRTVISNWDPQFNAITGLNGSGKSNILDAICFVLGISSMSTVRASNL 62

Query: 226 KDLIHKSEKYPELSSCSVEIHFQYVIDDPNGGPSKIDESKEKLVVMRKAFKNNSSKYYIN 285
           +DLI+K  +   ++  SV I F     D N  P    ES  K+ V R+     +SKY IN
Sbjct: 63  QDLIYKRGQAG-VTKASVTIVFAN--SDKNNSPIGF-ESYPKISVTRQIVLGGTSKYLIN 118

Query: 286 DKESSFTQVTTLLKNEGIDLDHKRFLILQGEVENIAQMKPKSEKEGDDGLLEYLEDIIGT 345
              +    V  L ++  +++++  FLI+QG++  +  MKP         +L  +E+  GT
Sbjct: 119 GHRAQQQTVLHLFQSVQLNINNPNFLIMQGKITKVLNMKPTE-------ILSLIEEAAGT 171

Query: 346 SHY 348
             +
Sbjct: 172 KMF 174

 Score = 64.7 bits (156), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 53/73 (72%), Gaps = 1/73 (1%)

Query: 1320 WR-NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKD 1378
            W+ ++  LSGG+++L +L+L+ AL ++KP P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLILALLQFKPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1379 AQLIVISLRNNMF 1391
            +Q IV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

 Score = 37.4 bits (85), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 34/125 (27%), Positives = 55/125 (44%), Gaps = 11/125 (8%)

Query: 720 TACPRLEDLVVDSVDCGQQCIDYLRKNRLGYARFILLDKLRK-------FNLNRIETPDN 772
            A  RL ++VV++     Q ++  R  +      I L+K+          N  +   PD+
Sbjct: 547 CAGGRLFNVVVNNESTASQLLERGRLRK--RVTIIPLNKISARRLHQDTVNFAKQLAPDS 604

Query: 773 APRLFDLIQVREDKFLPAFYSVLRDTLVATNLLHANKVAY-GKRRFRVVTLDGKLIDISG 831
                +LI   ED+   A   +   +L+  +   A KV +  K R R +TL G + D  G
Sbjct: 605 VELALNLIGY-EDEVAKAMEFIFGTSLICRDAETAKKVTFHPKVRARSITLQGDIYDPEG 663

Query: 832 TMSGG 836
           T+SGG
Sbjct: 664 TLSGG 668

>SAKL0F07282g Chr6 complement(554459..557971) [3513 bp, 1170 aa]
           {ON} similar to uniprot|P38989 Saccharomyces cerevisiae
           YFR031C SMC2 Component of the condensin complex
           essential SMC chromosomal ATPase family member that
           forms a complex with Smc4p to form the active ATPase
           Smc2p/Smc4p complex binds DNA possibly in the cleft
           formed by the coiled-coil of the folded dimer
          Length = 1170

 Score = 99.4 bits (246), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 61/184 (33%), Positives = 99/184 (53%), Gaps = 14/184 (7%)

Query: 167 IERLVLTNFKSYAGRQVVGPFHTNFSAVVGPNGSGKSNVIDSMLFVFGFRAN-KMRQGKL 225
           +E L++  FKSYA R V+  +   F+A+ G NGSGKSN++DS+ FV G  +   +R   L
Sbjct: 3   VEELIIDGFKSYATRTVISNWDPQFNAITGLNGSGKSNILDSICFVLGISSMVTVRASNL 62

Query: 226 KDLIHKSEKYPELSSCSVEIHFQYVIDDPNGGPSKID-ESKEKLVVMRKAFKNNSSKYYI 284
           +DLI+K  +   ++  SV I F    D+ +   S I  ES  K+ V R+     +SKY I
Sbjct: 63  QDLIYKRGQAG-VTKASVTIVF----DNTDKSSSPIGFESYPKISVTRQIILGGTSKYLI 117

Query: 285 NDKESSFTQVTTLLKNEGIDLDHKRFLILQGEVENIAQMKPKSEKEGDDGLLEYLEDIIG 344
           N   +    V  L ++  +++++  FLI+QG++  +  MKP         +L  +E+  G
Sbjct: 118 NGHRAQQQTVLHLFQSVQLNINNPNFLIMQGKITKVLNMKPTE-------ILSLIEEAAG 170

Query: 345 TSHY 348
           T  +
Sbjct: 171 TRMF 174

 Score = 64.7 bits (156), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 53/73 (72%), Gaps = 1/73 (1%)

Query: 1320 WR-NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKD 1378
            W+ ++  LSGG+++L +L+L+ AL ++KP P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLILALLQFKPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1379 AQLIVISLRNNMF 1391
            +Q IV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

 Score = 41.2 bits (95), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 39/136 (28%), Positives = 63/136 (46%), Gaps = 14/136 (10%)

Query: 712 EKYDVAIS---TACPRLEDLVVDSVDCGQQCIDYLRKNRLGYARFILLDKL--RKFNLNR 766
           E +D A +    A  RL ++VVD+     Q ++  R  +      I L+K+  R  N N 
Sbjct: 536 ENFDSATALQVCAGGRLFNVVVDNEVTASQLLERGRLRK--RVTIIPLNKIASRTLNENA 593

Query: 767 IE-----TPDNAPRLFDLIQVREDKFLPAFYSVLRDTLVATNLLHANKVAYGKR-RFRVV 820
           ++      P N     +LI   ED+   A   +   +L+  +   A +V +  + R R +
Sbjct: 594 LKLAKSVAPGNVELALNLIGY-EDEVSRAMEFIFGTSLICKDAETAKRVTFHPQIRARSI 652

Query: 821 TLDGKLIDISGTMSGG 836
           TLDG + D  GT+SGG
Sbjct: 653 TLDGDIYDPEGTLSGG 668

>KLTH0E04774g Chr5 (426535..430047) [3513 bp, 1170 aa] {ON} similar
           to uniprot|P38989 Saccharomyces cerevisiae YFR031C SMC2
           Component of the condensin complex essential SMC
           chromosomal ATPase family member that forms a complex
           with Smc4p to form the active ATPase Smc2p/Smc4p complex
           binds DNA possibly in the cleft formed by the
           coiled-coil of the folded dimer
          Length = 1170

 Score = 99.0 bits (245), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 60/183 (32%), Positives = 97/183 (53%), Gaps = 12/183 (6%)

Query: 167 IERLVLTNFKSYAGRQVVGPFHTNFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQGKL 225
           +E L++  FKSYA R V+  +   F+A+ G NGSGKSN++D++ FV G  +   +R   L
Sbjct: 3   VEELIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNILDAICFVLGISSMATVRASNL 62

Query: 226 KDLIHKSEKYPELSSCSVEIHFQYVIDDPNGGPSKIDESKEKLVVMRKAFKNNSSKYYIN 285
           +DLI+K  +   ++  SV I F    DD    P    ES  K+ V R+     +SKY IN
Sbjct: 63  QDLIYKRGQAG-VTKASVTIVFTN--DDKANSPIGF-ESYPKISVTRQIVLGGTSKYLIN 118

Query: 286 DKESSFTQVTTLLKNEGIDLDHKRFLILQGEVENIAQMKPKSEKEGDDGLLEYLEDIIGT 345
              +    V  L ++  +++++  FLI+QG++  +  MKP         +L  +E+  GT
Sbjct: 119 GHRAQQQTVLHLFQSVQLNINNPNFLIMQGKITKVLNMKPSE-------ILSLIEEAAGT 171

Query: 346 SHY 348
             +
Sbjct: 172 KMF 174

 Score = 64.7 bits (156), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 53/73 (72%), Gaps = 1/73 (1%)

Query: 1320 WR-NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKD 1378
            W+ ++  LSGG+++L +L+L+ AL ++KP P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLILALLQFKPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1379 AQLIVISLRNNMF 1391
            +Q IV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

 Score = 33.5 bits (75), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 40/148 (27%), Positives = 64/148 (43%), Gaps = 15/148 (10%)

Query: 698 SGFYGRLGDLGVIDEK-YDVAIS---TACPRLEDLVVDSVDCGQQCIDYLRKNRLGYARF 753
           S   G    L  +DEK Y  A +    A  RL ++VVD+     Q ++  R  +      
Sbjct: 521 SSVKGVAAQLFSLDEKNYSSATALQVCAGGRLFNVVVDNEGTASQLLERGRLRK--RVTI 578

Query: 754 ILLDKL--RKFNLNRIET-----PDNAPRLFDLIQVREDKFLPAFYSVLRDTLVATNLLH 806
           I L+K+  R  + N ++      P N     +LI   E++   A   +   +L+  +   
Sbjct: 579 IPLNKISARSLHQNAVKAAKELAPGNVELALNLIGY-EEEVSKAMEFIFGTSLICQDAET 637

Query: 807 ANKVAYGKR-RFRVVTLDGKLIDISGTM 833
           A KV +  R R R +TL G + D  GT+
Sbjct: 638 AKKVTFHPRVRARSITLQGDIYDPEGTL 665

>KAFR0G02930 Chr7 complement(609210..612722) [3513 bp, 1170 aa] {ON}
           Anc_7.186 YFR031C
          Length = 1170

 Score = 98.2 bits (243), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 58/183 (31%), Positives = 97/183 (53%), Gaps = 12/183 (6%)

Query: 167 IERLVLTNFKSYAGRQVVGPFHTNFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQGKL 225
           IE L++  FKSYA R V+  +   F+A+ G NGSGKSN++D++ FV G  + + +R   L
Sbjct: 3   IEELIIDGFKSYAARTVISDWDPQFNAITGLNGSGKSNILDAICFVLGISSMSTVRASNL 62

Query: 226 KDLIHKSEKYPELSSCSVEIHFQYVIDDPNGGPSKIDESKEKLVVMRKAFKNNSSKYYIN 285
           +DLI+K  +   ++  SV + F     D +  P     S  K+ V R+     +SKY IN
Sbjct: 63  QDLIYKRGQAG-VTKASVTVVFDN--SDRDNSPIGFTNSP-KISVTRQVVLGGTSKYLIN 118

Query: 286 DKESSFTQVTTLLKNEGIDLDHKRFLILQGEVENIAQMKPKSEKEGDDGLLEYLEDIIGT 345
              +    V  L ++  +++++  FLI+QG++  +  MKP         +L  +E+  GT
Sbjct: 119 GHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPTE-------ILSLIEEAAGT 171

Query: 346 SHY 348
             +
Sbjct: 172 KMF 174

 Score = 78.6 bits (192), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 53/73 (72%), Gaps = 1/73 (1%)

Query: 1320 WR-NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKD 1378
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1379 AQLIVISLRNNMF 1391
            +Q IV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

 Score = 39.3 bits (90), Expect = 0.096,   Method: Compositional matrix adjust.
 Identities = 81/308 (26%), Positives = 131/308 (42%), Gaps = 49/308 (15%)

Query: 702 GRLGDLGVIDEK-YDVAIS---TACPRLEDLVVDSVDCGQQCIDYLR-KNRLGYARFILL 756
           G    L  +D++ +D AI+    A  RL +++VD+     Q ++  R K R+     I L
Sbjct: 525 GVAAQLFTVDQQQFDNAIALQVCAGGRLYNIIVDNEITASQLLERGRLKKRVT---IIPL 581

Query: 757 DKL--RKFNLNRIE-----TPDNAPRLFDLIQVREDKFLPAFYSVLRDTLVATNLLHANK 809
            K+  R  N N +       P       +LI   +D+   A   +  + LV  +   A K
Sbjct: 582 SKIATRTLNKNTLALAKELAPGKVELALNLIGY-DDEVSKAMEFIFGNGLVCKDADTAKK 640

Query: 810 VAYGKR-RFRVVTLDGKLIDISGTMSGGGNYVLRGLMKLGQDLPENDFEQTSPEEVQKLE 868
           V +    R R +T  G + D  GT+SGG     R L+         D ++ +    +  E
Sbjct: 641 VTFHPNIRTRSITQQGDVYDPEGTLSGGSRNTTRSLLV--------DIQKYNHAVAKVNE 692

Query: 869 RELEILEKNFKVAYNSLKEMNQEILHMKEQIPATELNISKTTIEI---EYCENEIKQLIS 925
            EL+++E   K     LKE  QE    K +    ELN++   + I      EN   Q+I 
Sbjct: 693 LELKLIEMQKK-----LKE--QEETSQKTKSLQNELNLADHKLNIAQRRLVENSAAQII- 744

Query: 926 QLKEKQEIHDQESNNNDEIKVADDKLQALK---------KEYYSLNDQTKVT--KQEIEK 974
             K  +E+H++     ++I V      AL+          E +S +  +K++  K EIEK
Sbjct: 745 --KRNKELHEELQGCEEQILVEKKNASALEIEIETTKKDAEEFSKDKNSKLSKLKNEIEK 802

Query: 975 LRQQIMDA 982
           L + I D 
Sbjct: 803 LNKAIEDV 810

>NCAS0E01920 Chr5 (368382..371894) [3513 bp, 1170 aa] {ON} Anc_7.186
          Length = 1170

 Score = 97.8 bits (242), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 58/183 (31%), Positives = 97/183 (53%), Gaps = 12/183 (6%)

Query: 167 IERLVLTNFKSYAGRQVVGPFHTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQGKL 225
           +E L++  FKSYA R V+  +   F+A+ G NGSGKSN++D++ FV G  +  + R   L
Sbjct: 3   VEELIIDGFKSYATRTVIADWDPQFNAITGLNGSGKSNILDAICFVLGISSMTIVRASNL 62

Query: 226 KDLIHKSEKYPELSSCSVEIHFQYVIDDPNGGPSKIDESKEKLVVMRKAFKNNSSKYYIN 285
           +DLI+K  +   ++  SV I F     D    P   + S  K+ V R+     +SKY IN
Sbjct: 63  QDLIYKRGQAG-VTKASVTIVFDN--SDKTNSPIGFNNSS-KISVTRQIILGGTSKYLIN 118

Query: 286 DKESSFTQVTTLLKNEGIDLDHKRFLILQGEVENIAQMKPKSEKEGDDGLLEYLEDIIGT 345
              +    V  L ++  +++++  FLI+QG++  +  MKP       + +L  +E+  GT
Sbjct: 119 GHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKP-------NEILSLIEEAAGT 171

Query: 346 SHY 348
             +
Sbjct: 172 KMF 174

 Score = 79.0 bits (193), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 53/73 (72%), Gaps = 1/73 (1%)

Query: 1320 WRN-ISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKD 1378
            W++ +  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKDSLVELSGGQRSLVALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1379 AQLIVISLRNNMF 1391
            +Q IV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

 Score = 34.3 bits (77), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 40/134 (29%), Positives = 61/134 (45%), Gaps = 14/134 (10%)

Query: 714 YDVAIS---TACPRLEDLVVDSVDCGQQCIDYLRKNRL-GYARFILLDKL--RKFNLNRI 767
           +D A +    A  RL ++VVD+          L K RL      I L+K+  R  N   +
Sbjct: 538 FDAASALQVCAGGRLYNVVVDNEKTASLL---LEKGRLRKRVTIIPLNKIAARTLNARTL 594

Query: 768 ETP-DNAPRLFDL---IQVREDKFLPAFYSVLRDTLVATNLLHANKVAYGKR-RFRVVTL 822
           +   D AP   +L   +   +D+   A   +   +LV  +   A KV +  + R R +TL
Sbjct: 595 QMAKDIAPGKVELALNLIGYDDEVSRAMEFIFGGSLVCQDANTAKKVTFHPQIRTRSITL 654

Query: 823 DGKLIDISGTMSGG 836
           DG + D  GT+SGG
Sbjct: 655 DGDVYDPEGTLSGG 668

>KNAG0L01160 Chr12 complement(206434..209946) [3513 bp, 1170 aa]
           {ON} Anc_7.186 YFR031C
          Length = 1170

 Score = 96.7 bits (239), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 56/183 (30%), Positives = 99/183 (54%), Gaps = 12/183 (6%)

Query: 167 IERLVLTNFKSYAGRQVVGPFHTNFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQGKL 225
           +E L++  FKSYA R V+  +   F+A+ G NGSGKSN++D++ FV G  + + +R   +
Sbjct: 3   VEELIIDGFKSYATRTVISGWDAQFNAITGLNGSGKSNILDAICFVLGISSMSTVRASNM 62

Query: 226 KDLIHKSEKYPELSSCSVEIHFQYVIDDPNGGPSKIDESKEKLVVMRKAFKNNSSKYYIN 285
           +DLI+K  +   ++  SV I F     D +  P   ++S  K+ V R+     +SKY IN
Sbjct: 63  QDLIYKRGQ-AGVTKASVTIVFDN--SDKSNSPIGFNDSL-KISVTRQIVLGGTSKYLIN 118

Query: 286 DKESSFTQVTTLLKNEGIDLDHKRFLILQGEVENIAQMKPKSEKEGDDGLLEYLEDIIGT 345
              +    V  L ++  +++++  FLI+QG++  +  M+P         +L  +E+  GT
Sbjct: 119 GHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMRPSE-------ILSLIEEAAGT 171

Query: 346 SHY 348
             +
Sbjct: 172 KMF 174

 Score = 78.2 bits (191), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 53/73 (72%), Gaps = 1/73 (1%)

Query: 1320 WR-NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKD 1378
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLIELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1379 AQLIVISLRNNMF 1391
            +Q IV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 75/300 (25%), Positives = 125/300 (41%), Gaps = 37/300 (12%)

Query: 702 GRLGDLGVIDEK--YDVAISTACP--RLEDLVVDSVDCGQQCIDYLRKNRLGYARFILLD 757
           G    L  +DE+  Y       C   RL ++VVD+ +   Q ++  R  +   A  I L+
Sbjct: 525 GIAAQLFSLDEQNFYSATALQVCAGGRLFNVVVDNENTAAQLLERGRLRK--RATIIPLN 582

Query: 758 KLRKFNLN-------RIETPDNAPRLFDLIQVREDKFLPAFYSVLRDTLVATNLLHANKV 810
           K+    LN       +   P       +LI   E++   A   +   +LV  +   A  V
Sbjct: 583 KIAARTLNDNIVNMAKSVAPGRVELALNLIGY-EEEVRRAMEFIFGSSLVCKDAEAAKMV 641

Query: 811 AYG-KRRFRVVTLDGKLIDISGTMSGGGNYVLRGLMKLGQDLPENDFEQTSPEEVQKLER 869
            +  K R R +TLDG + D  GT+SGG       L+   Q    N         V++LE 
Sbjct: 642 TFNPKIRTRSITLDGDVYDPEGTLSGGSRNNTSSLLIDIQRYNNN------CNLVKELET 695

Query: 870 ELEILEKNFKVAY---NSLKEMNQEILHMKEQIPATELNISKTTI------------EIE 914
           +L  + K   + +   N  K + +E+   + ++  +E N+   T             EI 
Sbjct: 696 KLNDIAKKIAIQFEISNKTKNLQKELELAQHKLKLSERNLQSNTAAQLIRKNEELESEIA 755

Query: 915 YCENEIKQLISQLKE-KQEIHDQESNNNDEIKVADDKLQALKKEYYSLNDQTKVTKQEIE 973
            C+ EIK   SQ+K+ K++I   E + ++       KL  L++E  S++ Q    +Q  E
Sbjct: 756 QCKEEIKDKTSQIKQLKKQIAKIEKDADEFSHDKGSKLDELRREVESMSVQISEEEQRCE 815

>CAGL0D05258g Chr4 (500858..504370) [3513 bp, 1170 aa] {ON} similar
           to uniprot|P38989 Saccharomyces cerevisiae YFR031c SMC2
           chromosome segregation protein
          Length = 1170

 Score = 96.7 bits (239), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 59/183 (32%), Positives = 96/183 (52%), Gaps = 12/183 (6%)

Query: 167 IERLVLTNFKSYAGRQVVGPFHTNFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQGKL 225
           +E L++  FKSYA R V+  +   F+A+ G NGSGKSN++D++ FV G  +   +R   L
Sbjct: 3   VEELIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNILDAICFVLGISSMATVRASNL 62

Query: 226 KDLIHKSEKYPELSSCSVEIHFQYVIDDPNGGPSKIDESKEKLVVMRKAFKNNSSKYYIN 285
           +DLI+K  +   ++  SV I F     D +  P    E   K+ V R+     +SKY IN
Sbjct: 63  QDLIYKRGQAG-VTKASVTIVFDNT--DKSNTPIGFSEYP-KISVTRQIVLGGTSKYLIN 118

Query: 286 DKESSFTQVTTLLKNEGIDLDHKRFLILQGEVENIAQMKPKSEKEGDDGLLEYLEDIIGT 345
              +    V  L ++  +++++  FLI+QG++  I  MKP         +L  +E+  GT
Sbjct: 119 GHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKILNMKPSE-------ILSLIEEAAGT 171

Query: 346 SHY 348
             +
Sbjct: 172 KMF 174

 Score = 79.0 bits (193), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 53/73 (72%), Gaps = 1/73 (1%)

Query: 1320 WR-NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKD 1378
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1379 AQLIVISLRNNMF 1391
            +Q IV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

 Score = 45.1 bits (105), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 83/310 (26%), Positives = 132/310 (42%), Gaps = 46/310 (14%)

Query: 697 ISGFYGRLGDLGVIDEKYDVAIS-TACPRLEDLVVDSVDCGQQCIDYLRKNRL-GYARFI 754
           + G    L  +   + KY + +   A  RL +++VD+   G      L+K RL      I
Sbjct: 523 VKGVTAELFSIPEQNMKYVIGLQICAGGRLYNVIVDNEKTGSA---LLQKGRLRKRVTII 579

Query: 755 LLDKL--RKFNLNRIE-----TPDNAPRLFDLIQVREDKFLPAFYSVLRDTLVATNLLHA 807
            LDK+  R  N N+++      P       +LI    D+ + A   +  ++L+  +   A
Sbjct: 580 PLDKVISRPLNQNKLKLAKQLAPGKVELALNLIGY-SDEVVKAMEFIFGNSLICDDAETA 638

Query: 808 NKVAYGKR-RFRVVTLDGKLIDISGTMSGGGNYVLRGLMKLGQDLPENDFEQTSP----- 861
            K+ +    R R +TL+G + D  GT+SGG       L+         D +Q +      
Sbjct: 639 KKITFNPGIRTRSITLEGDIYDPEGTLSGGTRNNTNTLLV--------DIQQYNTLKKEL 690

Query: 862 ----EEVQKLERELEILEKNFKVAYNSLKEMN--QEILHMKEQIPATE--LNISKTTIEI 913
               EE Q + ++L+ILE       N  KE++  +  L + E+   +E  L +     EI
Sbjct: 691 LAMNEEKQNIHKQLKILEAKSNETSNLQKELSLKKHRLDILERTMNSEPSLMMQNRNGEI 750

Query: 914 EYCENEIKQLISQLKEKQ--------EIHDQESNNNDEIKVADDKLQALKKEYYSLNDQT 965
              ENE+K L    K+K         EI     +  D  K    KL+ LK E + LN+Q 
Sbjct: 751 ---ENEVKTLEDSTKQKMLENSSLEAEIEKLRKDMVDFSKNKGAKLKELKAEVHELNEQI 807

Query: 966 KVTKQEIEKL 975
           K  + E EKL
Sbjct: 808 KDLESESEKL 817

>Kpol_1063.20 s1063 (46233..49748) [3516 bp, 1171 aa] {ON}
           (46233..49748) [3516 nt, 1172 aa]
          Length = 1171

 Score = 96.7 bits (239), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 62/199 (31%), Positives = 103/199 (51%), Gaps = 15/199 (7%)

Query: 167 IERLVLTNFKSYAGRQVVGPFHTNFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQGKL 225
           +E L++  FKSYA R V+  +   F+A+ G NGSGKSN++D++ FV G  +   +R   L
Sbjct: 3   VEELIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNILDAICFVLGISSMATVRASNL 62

Query: 226 KDLIHKSEKYPELSSCSVEIHFQYVIDDPNGGPSKIDESKEKLVVMRKAFKNNSSKYYIN 285
           +DLI+K  +   ++  SV I F     D +  P    ES   + V R+     +SKY IN
Sbjct: 63  QDLIYKRGQ-AGVTKASVTIVFDN--SDKSNAPIGF-ESSPTISVTRQVALGGTSKYLIN 118

Query: 286 DKESSFTQVTTLLKNEGIDLDHKRFLILQGEVENIAQMKPKSEKEGDDGLLEYLEDIIGT 345
              +    V  L ++  +++++  FLI+QG++  +  MKP         +L  +E+  GT
Sbjct: 119 GHRAPQQSVLHLFQSVQLNINNPNFLIMQGKITKVLNMKPTE-------ILSLIEEAAGT 171

Query: 346 SHY---KVQIEHNLSKVEA 361
             +   + + E  + K EA
Sbjct: 172 KMFEDRREKAERTMGKKEA 190

 Score = 78.6 bits (192), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 53/73 (72%), Gaps = 1/73 (1%)

Query: 1320 WR-NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKD 1378
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1379 AQLIVISLRNNMF 1391
            +Q IV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

 Score = 41.2 bits (95), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 42/152 (27%), Positives = 66/152 (43%), Gaps = 18/152 (11%)

Query: 697 ISGFYGRLGDLGVIDEKYDVAIS---TACPRLEDLVVDSVDCGQQCIDYLRKNRL-GYAR 752
           + G   RL  L   +  Y  A +    A  RL ++VVD+     Q    L++ RL     
Sbjct: 523 VKGVAARLFHLN--ENNYSSATALQVCAGGRLYNVVVDNEKTASQL---LQRGRLRKRVT 577

Query: 753 FILLDKL-------RKFNLNRIETPDNAPRLFDLIQVREDKFLPAFYSVLRDTLVATNLL 805
            I L+K+       +  N+ +  +P N     +LI   ED    A   +   +L+  +  
Sbjct: 578 IIPLNKIMARKLNDKTLNIAKEISPGNVELALNLIGYEED-VAKAMEFIFGSSLICKDAE 636

Query: 806 HANKVAYGKR-RFRVVTLDGKLIDISGTMSGG 836
            A KV +  + R R +TL G + D  GT+SGG
Sbjct: 637 TAKKVTFHPQVRTRSITLQGDVYDPEGTLSGG 668

>Smik_7.346 Chr7 complement(577634..581146) [3513 bp, 1170 aa] {ON}
           YFR031C (REAL)
          Length = 1170

 Score = 96.3 bits (238), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 62/199 (31%), Positives = 104/199 (52%), Gaps = 15/199 (7%)

Query: 167 IERLVLTNFKSYAGRQVVGPFHTNFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQGKL 225
           +E L++  FKSYA R V+  +   F+A+ G NGSGKSN++D++ FV G  + + +R   L
Sbjct: 3   VEELIIDGFKSYATRTVITDWDPQFNAITGLNGSGKSNILDAICFVLGIASMSTVRASSL 62

Query: 226 KDLIHKSEKYPELSSCSVEIHFQYVIDDPNGGPSKIDESKEKLVVMRKAFKNNSSKYYIN 285
           +DLI+K  +   ++  SV I F     D +  P     S + + V R+     +SKY IN
Sbjct: 63  QDLIYKRGQ-AGVTKASVTIVFDNT--DKSNSPIGFANSPQ-ISVTRQVVLGGTSKYLIN 118

Query: 286 DKESSFTQVTTLLKNEGIDLDHKRFLILQGEVENIAQMKPKSEKEGDDGLLEYLEDIIGT 345
              +    V  L ++  +++++  FLI+QG++  +  MKP         +L  +E+  GT
Sbjct: 119 GHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPSE-------ILSLIEEAAGT 171

Query: 346 SHY---KVQIEHNLSKVEA 361
             +   K + E  +SK E 
Sbjct: 172 KMFEDRKEKAERTMSKKET 190

 Score = 78.6 bits (192), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 53/73 (72%), Gaps = 1/73 (1%)

Query: 1320 WR-NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKD 1378
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLIELSGGQRSLVALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1379 AQLIVISLRNNMF 1391
            +Q IV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

 Score = 37.7 bits (86), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 47/161 (29%), Positives = 73/161 (45%), Gaps = 17/161 (10%)

Query: 698 SGFYGRLGDLGVIDE---KYDVAIST-ACPRLEDLVVDSVDCGQQCID--YLRKNRLGYA 751
           S  YG +G L  +D    +Y  A+ T A  RL ++VV       Q ++   LRK      
Sbjct: 521 SSVYGVVGRLFQLDNDNIRYSSALQTCAGGRLFNVVVRDSQTATQLLEGGRLRKR----V 576

Query: 752 RFILLDKL--RKFNLNRIETPDN-APRLFDLI--QVREDKFLP-AFYSVLRDTLVATNLL 805
             I LDK+  R      +E   + AP   +L    +R DK +  A   +  ++L+  +  
Sbjct: 577 TIIPLDKIYTRPITPQVLELAKSIAPGKVELAINLIRFDKPVTKAMEFIFGNSLICDDPE 636

Query: 806 HANKVAY-GKRRFRVVTLDGKLIDISGTMSGGGNYVLRGLM 845
            A K+ +  K R R +TL G + D  GT+SGG     + L+
Sbjct: 637 TAKKITFHPKIRARSITLQGDVYDPEGTLSGGSRNTSQSLL 677

>KLLA0D16005g Chr4 complement(1346492..1350004) [3513 bp, 1170 aa]
           {ON} similar to uniprot|P38989 Saccharomyces cerevisiae
           YFR031C SMC2 Component of the condensin complex
           essential SMC chromosomal ATPase family member that
           forms a complex with Smc4p to form the active ATPase
           Smc2p/Smc4p complex binds DNA possibly in the cleft
           formed by the coiled-coil of the folded dimer
          Length = 1170

 Score = 95.9 bits (237), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 58/183 (31%), Positives = 97/183 (53%), Gaps = 12/183 (6%)

Query: 167 IERLVLTNFKSYAGRQVVGPFHTNFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQGKL 225
           +E L++  FKSYA R V+  +   F+A+ G NGSGKSN++D++ FV G  +   +R   L
Sbjct: 3   VEELIIDGFKSYATRTVITDWDPQFNAITGLNGSGKSNILDAICFVLGISSMATVRAQNL 62

Query: 226 KDLIHKSEKYPELSSCSVEIHFQYVIDDPNGGPSKIDESKEKLVVMRKAFKNNSSKYYIN 285
           +DLI+K  +   ++  SV I F     D +  P    ES  K+ + R+      SKY IN
Sbjct: 63  QDLIYKRGQ-AGVTKASVTIVFNN--SDTSNSPIGF-ESHAKISITRQIILGGVSKYLIN 118

Query: 286 DKESSFTQVTTLLKNEGIDLDHKRFLILQGEVENIAQMKPKSEKEGDDGLLEYLEDIIGT 345
              +    V  L ++  +++++  FLI+QG++  +  MKP+        +L  +E+  GT
Sbjct: 119 GHRAQQQTVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPQE-------ILSLIEEAAGT 171

Query: 346 SHY 348
             +
Sbjct: 172 RMF 174

 Score = 70.9 bits (172), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 58/190 (30%), Positives = 95/190 (50%), Gaps = 34/190 (17%)

Query: 1235 LSEYKKRKSDLDES------------------ISEKETA---------------KEETEV 1261
            L +YKKR SDL ES                  + +KETA               +E  E 
Sbjct: 961  LDQYKKRGSDLAESFQSLRRKVNPEVMSMIESVEKKETALKTMIKTIEKDKQKIQETIEK 1020

Query: 1262 LKKKRLEEFTTGFDIISLTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWR 1321
            L + + E     ++ +S+    ++  +     A+LE  +  D  +EG+   V   K    
Sbjct: 1021 LNEYKRETLIKTWEKVSVDFGNIFGDLLPNSFAKLEPSEGKD-VTEGLEVKVKLGKIWKE 1079

Query: 1322 NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKDAQL 1381
            ++  LSGG+++L +L+L+ AL ++KP P+Y++DE+DAALD  +   + + IK R K +Q 
Sbjct: 1080 SLVELSGGQRSLIALSLILALLQFKPAPMYILDEVDAALDLSHTQNIGHLIKTRFKGSQF 1139

Query: 1382 IVISLRNNMF 1391
            IV+SL+  MF
Sbjct: 1140 IVVSLKEGMF 1149

>Suva_6.104 Chr6 complement(183396..186908) [3513 bp, 1170 aa] {ON}
           YFR031C (REAL)
          Length = 1170

 Score = 95.9 bits (237), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 57/183 (31%), Positives = 96/183 (52%), Gaps = 12/183 (6%)

Query: 167 IERLVLTNFKSYAGRQVVGPFHTNFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQGKL 225
           +E L++  FKSYA R V+  +   F+A+ G NGSGKSN++D++ FV G  +   +R   L
Sbjct: 3   VEELIIDGFKSYATRTVITDWDPQFNAITGLNGSGKSNILDAICFVLGIASMTTVRASSL 62

Query: 226 KDLIHKSEKYPELSSCSVEIHFQYVIDDPNGGPSKIDESKEKLVVMRKAFKNNSSKYYIN 285
           +DLI+K  +   ++  SV I F     D +  P     S + + V R+     +SKY IN
Sbjct: 63  QDLIYKRGQ-AGVTKASVTIVFDNT--DKSNSPIGFTNSPQ-ISVTRQVVLGGTSKYLIN 118

Query: 286 DKESSFTQVTTLLKNEGIDLDHKRFLILQGEVENIAQMKPKSEKEGDDGLLEYLEDIIGT 345
              +    V  L ++  +++++  FLI+QG++  +  MKP         +L  +E+  GT
Sbjct: 119 GHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPTE-------ILSLIEEAAGT 171

Query: 346 SHY 348
             +
Sbjct: 172 KMF 174

 Score = 80.1 bits (196), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 53/73 (72%), Gaps = 1/73 (1%)

Query: 1320 WRN-ISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKD 1378
            W++ +  LSGG+++L +LAL+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKDSLIELSGGQRSLIALALIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1379 AQLIVISLRNNMF 1391
            +Q IV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

>YFR031C Chr6 complement(216594..220106) [3513 bp, 1170 aa] {ON}
           SMC2Subunit of the condensin complex; essential SMC
           chromosomal ATPase family member that forms a complex
           with Smc4p to form the active ATPase; Smc2p/Smc4p
           complex binds DNA; required for clustering of tRNA genes
           at the nucleolus
          Length = 1170

 Score = 95.5 bits (236), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 57/183 (31%), Positives = 97/183 (53%), Gaps = 12/183 (6%)

Query: 167 IERLVLTNFKSYAGRQVVGPFHTNFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQGKL 225
           +E L++  FKSYA R V+  +   F+A+ G NGSGKSN++D++ FV G  + + +R   L
Sbjct: 3   VEELIIDGFKSYATRTVITDWDPQFNAITGLNGSGKSNILDAICFVLGIASMSTVRASSL 62

Query: 226 KDLIHKSEKYPELSSCSVEIHFQYVIDDPNGGPSKIDESKEKLVVMRKAFKNNSSKYYIN 285
           +DLI+K  +   ++  SV I F     D +  P     S + + V R+     +SKY IN
Sbjct: 63  QDLIYKRGQ-AGVTKASVTIVFDNT--DKSNSPIGFTNSPQ-ISVTRQVVLGGTSKYLIN 118

Query: 286 DKESSFTQVTTLLKNEGIDLDHKRFLILQGEVENIAQMKPKSEKEGDDGLLEYLEDIIGT 345
              +    V  L ++  +++++  FLI+QG++  +  MKP         +L  +E+  GT
Sbjct: 119 GHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPSE-------ILSLIEEAAGT 171

Query: 346 SHY 348
             +
Sbjct: 172 KMF 174

 Score = 78.2 bits (191), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 53/73 (72%), Gaps = 1/73 (1%)

Query: 1320 WR-NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKD 1378
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLIELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1379 AQLIVISLRNNMF 1391
            +Q IV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

>Ecym_4390 Chr4 (816076..819588) [3513 bp, 1170 aa] {ON} similar to
           Ashbya gossypii AGR236W
          Length = 1170

 Score = 94.7 bits (234), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 60/184 (32%), Positives = 98/184 (53%), Gaps = 14/184 (7%)

Query: 167 IERLVLTNFKSYAGRQVVGPFHTNFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQGKL 225
           +E L++  FKSYA R V+  +   F+A+ G NGSGKSN++DS+ FV G  +   +R   L
Sbjct: 3   VEELIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNILDSICFVLGISSMATVRAQNL 62

Query: 226 KDLIHKSEKYPELSSCSVEIHFQYVIDDPNGGPSKID-ESKEKLVVMRKAFKNNSSKYYI 284
           +DLI+K  +   + + SV I F    D+ +   S I  E   K+ V R+     +SKY I
Sbjct: 63  QDLIYKRGQAGVIKA-SVTIVF----DNSDIKSSPIGFERYPKISVTRQIALGGTSKYLI 117

Query: 285 NDKESSFTQVTTLLKNEGIDLDHKRFLILQGEVENIAQMKPKSEKEGDDGLLEYLEDIIG 344
           N   +    V  L ++  +++++  FLI+QG++  +  MKP         +L  +E+  G
Sbjct: 118 NGHRAQQQTVLHLFQSVQLNINNPNFLIMQGQITKVLNMKPTE-------ILSLIEEAAG 170

Query: 345 TSHY 348
           T  +
Sbjct: 171 TRMF 174

 Score = 65.1 bits (157), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 53/73 (72%), Gaps = 1/73 (1%)

Query: 1320 WR-NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKD 1378
            W+ ++  LSGG+++L +L+L+ AL ++KP P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLILALLQFKPAPMYILDEVDAALDLNHTQNIGHLIKTRFKG 1136

Query: 1379 AQLIVISLRNNMF 1391
            +Q IV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

 Score = 37.7 bits (86), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 57/238 (23%), Positives = 104/238 (43%), Gaps = 33/238 (13%)

Query: 632 QLLEQRKEVESGDIEFNK------FTKKIQEMRDKLDSHRQK-ANDS---RTSLSNVQNK 681
           Q+ ++ +E+E   +  NK        K ++   ++L ++ QK +ND+   R  ++N++  
Sbjct: 451 QVKQRGQEIEKLKVSLNKSGFNPELMKTLRRRENELKNNLQKLSNDTEYLRRKVANLEFN 510

Query: 682 NSVLTALFKLQKSGRISGFYGRLGDLGVIDEKYDVAIS---TACPRLEDLVVDSVDCGQQ 738
            +  T  F  Q    + G   ++  LG   + +D A +    A  RL +++VD+     Q
Sbjct: 511 YTSPTKDFNPQS---VKGVAAQVFTLG--KDNFDSANALQVCAGGRLFNIIVDNEKTASQ 565

Query: 739 CID--YLRKNRLGYARFILLDKL-------RKFNLNRIETPDNAPRLFDLIQVREDKFLP 789
            ++   LRK        I L+K+           L +   P       +LI   ED    
Sbjct: 566 LLEKGMLRKR----VTIIPLNKISTRVLSDESLALAKKIAPGKVELALNLIGYEED-VSK 620

Query: 790 AFYSVLRDTLVATNLLHANKVAYGKR-RFRVVTLDGKLIDISGTMSGGGNYVLRGLMK 846
           A   +   +L+  +   A K+ +  + R R +TLDG + D  GT+SGG +     L+K
Sbjct: 621 AMQYIFGGSLICADAETAKKITFHPQIRARSITLDGDIYDPEGTLSGGSSNNTNSLLK 678

>Skud_6.119 Chr6 complement(211918..215430) [3513 bp, 1170 aa] {ON}
           YFR031C (REAL)
          Length = 1170

 Score = 94.4 bits (233), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 57/183 (31%), Positives = 96/183 (52%), Gaps = 12/183 (6%)

Query: 167 IERLVLTNFKSYAGRQVVGPFHTNFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQGKL 225
           +E L++  FKSYA R V+  +   F+A+ G NGSGKSN++D++ FV G  + + +R   L
Sbjct: 3   VEELIIDGFKSYATRTVITDWDPQFNAITGLNGSGKSNILDAICFVLGIASMSTVRASSL 62

Query: 226 KDLIHKSEKYPELSSCSVEIHFQYVIDDPNGGPSKIDESKEKLVVMRKAFKNNSSKYYIN 285
           +DLI+K  +   ++  SV I F     D    P     S + + V R+     +SKY IN
Sbjct: 63  QDLIYKRGQ-AGVTKASVTIVFNNT--DKLNSPIGFTNSPQ-ISVTRQVVLGGTSKYLIN 118

Query: 286 DKESSFTQVTTLLKNEGIDLDHKRFLILQGEVENIAQMKPKSEKEGDDGLLEYLEDIIGT 345
              +    V  L ++  +++++  FLI+QG++  +  MKP         +L  +E+  GT
Sbjct: 119 GHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPSE-------ILSLIEEAAGT 171

Query: 346 SHY 348
             +
Sbjct: 172 KMF 174

 Score = 78.2 bits (191), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 53/73 (72%), Gaps = 1/73 (1%)

Query: 1320 WRN-ISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKD 1378
            W++ +  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKDSLIELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1379 AQLIVISLRNNMF 1391
            +Q IV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

>TBLA0D04610 Chr4 complement(1139885..1143409) [3525 bp, 1174 aa]
           {ON} Anc_7.186 YFR031C
          Length = 1174

 Score = 92.8 bits (229), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 56/183 (30%), Positives = 96/183 (52%), Gaps = 12/183 (6%)

Query: 167 IERLVLTNFKSYAGRQVVGPFHTNFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQGKL 225
           +E L++  FKSYA R V+  +   F+A+ G NGSGKSN++D++ FV G  +   +R   L
Sbjct: 3   VEELIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNILDAICFVLGISSMTTVRASNL 62

Query: 226 KDLIHKSEKYPELSSCSVEIHFQYVIDDPNGGPSKIDESKEKLVVMRKAFKNNSSKYYIN 285
           +DLI+K  +   ++  SV I F     D +  P   + S  ++ V R+     +SKY IN
Sbjct: 63  QDLIYKRGQ-AGVTKASVTIVFDNT--DKSNSPIGFNTS-PRISVTRQIVIGGTSKYLIN 118

Query: 286 DKESSFTQVTTLLKNEGIDLDHKRFLILQGEVENIAQMKPKSEKEGDDGLLEYLEDIIGT 345
              +    V  L ++  +++++  FLI+QG++  +  MK          +L  +E+  GT
Sbjct: 119 GHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKSTE-------ILSLIEEAAGT 171

Query: 346 SHY 348
             +
Sbjct: 172 KMF 174

 Score = 79.7 bits (195), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 53/73 (72%), Gaps = 1/73 (1%)

Query: 1320 WR-NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKD 1378
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1081 WKESLVELSGGQRSLVALSLILALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1140

Query: 1379 AQLIVISLRNNMF 1391
            AQ IV+SL+  MF
Sbjct: 1141 AQFIVVSLKEGMF 1153

 Score = 37.7 bits (86), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 72/293 (24%), Positives = 121/293 (41%), Gaps = 59/293 (20%)

Query: 720 TACPRLEDLVVDSVDCGQQCIDYLRKNRL-GYARFILLDKL--RKFNLNRIETPDN-APR 775
            A  RL ++VVD+     Q    L K RL      I L+K+  R+ N N +      AP 
Sbjct: 551 CAGGRLYNVVVDNETTASQL---LEKGRLRKRVTIIPLNKIASRRLNENTVNFAKQLAPG 607

Query: 776 LFDL---IQVREDKFLPAFYSVLRDTLVATNLLHANKVAYGKR-RFRVVTLDGKLIDISG 831
             DL   +    D+   A   +   +L+  +   A KV + +  R R +TL+G + D  G
Sbjct: 608 KVDLALNLIGYSDELSRAMEFIFGTSLICKDSETAKKVTFHQNIRQRSITLEGDVYDPEG 667

Query: 832 TMSGGGNYVLRGLMKLGQDLPENDFEQTSPEEVQKLERELEILEKNFKVAYNSLKEMNQE 891
           T+SGG       L+                +   K   E++ILE+N +     L E  QE
Sbjct: 668 TLSGGSRNNKNSLL-------------LDIQHYNKTCNEIKILEENLRDIKIKLNE--QE 712

Query: 892 ILHMKEQIPATELNISK------------------------TTIEIEYCENEIKQLISQL 927
            ++   ++   +LN+++                         ++EI+ CEN I Q  ++L
Sbjct: 713 KIYSASKVIQNDLNLAEHKLAMAQRSVDSNQSTQLIKRNEAISLEIKSCENSITQEQNKL 772

Query: 928 KEKQEI-----HDQESNNNDEIKVADDKLQALKKEYYSLNDQTKVTKQEIEKL 975
           +  Q        D    NND+      KL+ L++E  +L+ +  V + E+E +
Sbjct: 773 ESIQNSIIQIEKDINEFNNDK----GSKLKELQQEIKALSKKLSVKENEVENI 821

>TPHA0C04440 Chr3 complement(958279..961791) [3513 bp, 1170 aa] {ON}
           Anc_7.186 YFR031C
          Length = 1170

 Score = 92.8 bits (229), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 56/184 (30%), Positives = 98/184 (53%), Gaps = 14/184 (7%)

Query: 167 IERLVLTNFKSYAGRQVVGPFHTNFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQGKL 225
           +  L++  FKSYA R V+  +   F+A+ G NGSGKSN++D++ FV G  + + +R   L
Sbjct: 3   VAELIIDGFKSYATRTVISEWDPQFNAITGLNGSGKSNILDAICFVLGISSMSTVRASNL 62

Query: 226 KDLIHKSEKYPELSSCSVEIHFQYVIDDPNGGPSKID-ESKEKLVVMRKAFKNNSSKYYI 284
           +DLI+K  +   ++  SV I F    D+ +   + I  E+   + V R+     +SKY I
Sbjct: 63  QDLIYKRGQ-AGVTKASVTIVF----DNSDKSKAPIGFETSLTISVTRQIVLGGTSKYLI 117

Query: 285 NDKESSFTQVTTLLKNEGIDLDHKRFLILQGEVENIAQMKPKSEKEGDDGLLEYLEDIIG 344
           N   +    V  L ++  +++++  FLI+QG++  +  MKP         +L  +E+  G
Sbjct: 118 NGHRAPQQSVLHLFQSVQLNINNPNFLIMQGKITKVLNMKPTE-------ILALIEEAAG 170

Query: 345 TSHY 348
           T  +
Sbjct: 171 TKMF 174

 Score = 78.6 bits (192), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 32/75 (42%), Positives = 54/75 (72%), Gaps = 1/75 (1%)

Query: 1318 KSWR-NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT 1376
            K W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R 
Sbjct: 1075 KLWKESLVELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRF 1134

Query: 1377 KDAQLIVISLRNNMF 1391
            K +Q IV+SL+  MF
Sbjct: 1135 KGSQFIVVSLKEGMF 1149

 Score = 40.4 bits (93), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 42/152 (27%), Positives = 64/152 (42%), Gaps = 18/152 (11%)

Query: 697 ISGFYGRLGDLGVIDEKYDVAIS---TACPRLEDLVVDSVDCGQQCIDYLRKNRL-GYAR 752
           + G   RL    +  + YD A +    A  RL ++VVD+     +    L K RL     
Sbjct: 523 VKGVAARL--FTIDKQNYDSATALQVCAGGRLYNVVVDNETTASKL---LEKGRLRKRVT 577

Query: 753 FILLDKLRK-------FNLNRIETPDNAPRLFDLIQVREDKFLPAFYSVLRDTLVATNLL 805
            I L+K+          N  +   P       +LI   ED+   A   +   +L+  +  
Sbjct: 578 IIPLNKISARTIDNNTLNYAKQLAPGKVELALNLIGY-EDEVAKALQFIFGSSLICNDAE 636

Query: 806 HANKVAYG-KRRFRVVTLDGKLIDISGTMSGG 836
            A K+ +  K R R +TLDG + D  GT+SGG
Sbjct: 637 TAKKITFNPKIRTRSITLDGDVYDPEGTLSGG 668

>KLLA0A00286g Chr1 complement(22024..25698) [3675 bp, 1224 aa] {ON}
           similar to uniprot|P47037 Saccharomyces cerevisiae
           YJL074C SMC3 Subunit of the multiprotein cohesin complex
           required for sister chromatid cohesion in mitotic cells
          Length = 1224

 Score = 85.9 bits (211), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 83/299 (27%), Positives = 139/299 (46%), Gaps = 26/299 (8%)

Query: 167 IERLVLTNFKSYAGRQVVGPFHTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLK 226
           I+ ++++ FK+Y  R VV  F  + + VVG NGSGKSN   ++ FV     + +++   K
Sbjct: 4   IKTVIISGFKTYKNRTVVENFSPHHNVVVGSNGSGKSNFFAAIRFVLSEENSNLKREDRK 63

Query: 227 DLIHKSEKYPELSSCSVEIHFQYVIDDPNG---GPSKIDESKEKLVVMRKAFKNNSSKYY 283
             I++     ++ S  VEI F    DDP      P + D  +   V +R+       +Y 
Sbjct: 64  GFIYQG--AGQVMSAFVEIIF----DDPENLMLAPLRNDTGE---VRIRRTVGLKKDEYM 114

Query: 284 INDKESSFTQVTTLLKNEGIDLDHKRFLILQGEVENIAQMKPKSEKEGDDGLLEYLEDII 343
           INDK S+   V  +L+N G    +   ++ QG + ++   K       D   L  LED++
Sbjct: 115 INDKNSTRQDVRRVLENVGFSTSNPYNIVPQGRIISLTNAK-------DLERLHLLEDVV 167

Query: 344 GTSHYKVQIEHNLSKVEALNEICIEKENRFNIVEKEKDSLVDGKNEALKYLANEKNLVLA 403
           G   ++ +++ +L K+EA      +  N  N ++K    L D K E  KY     N +  
Sbjct: 168 GAKSFENKLKESLKKMEAAERDRTKITNELNELDKRLSELSDEKEELEKY-----NNLNR 222

Query: 404 KSKKYQHQLYIDNKKLTSTLAKITDAQENYDKELEKYSTISKELKNLQDEEITLNKRLN 462
             K  Q  LY  +++L     +I   +  Y+  +E  S    EL+  +   + LNKR+N
Sbjct: 223 DRKVLQFCLY--DRELNDITNQIEQLEGEYNSIIENSSEYVNELEKREVLAVELNKRMN 279

 Score = 65.9 bits (159), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 34/92 (36%), Positives = 51/92 (55%), Gaps = 1/92 (1%)

Query: 1323 ISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKDAQLI 1382
            +  LSGG+KT+ ++AL+ A+    P P Y+ DEIDAALD +    VA  IK  +  AQ I
Sbjct: 1117 VEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRIAVARTIKNLSDTAQFI 1176

Query: 1383 VISLRNNMFELSKQLVGIYKSENMTQSATLVN 1414
              + R +M  ++     + K EN   + T V+
Sbjct: 1177 CTTFRTDMINVADTFFRV-KFENKVSTVTEVS 1207

>NDAI0G05630 Chr7 complement(1393671..1397360) [3690 bp, 1229 aa]
           {ON} Anc_1.295 YJL074C
          Length = 1229

 Score = 83.6 bits (205), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 78/297 (26%), Positives = 144/297 (48%), Gaps = 34/297 (11%)

Query: 165 LVIERLVLTNFKSYAGRQVVGPFHTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGK 224
           + I+R+V+  FK+Y    ++  F  + + V+G NGSGKSN   ++ FV     + +++ +
Sbjct: 1   MYIKRVVIKGFKTYRNETIIDNFSPHHNIVIGSNGSGKSNFFSAIRFVLSDDYSNLKREE 60

Query: 225 LKDLIHKSEKYPELSSCSVEIHFQYVIDDPNGG---PSKIDESKEKLVVMRKAFKNNSSK 281
            + LIH+      + S SVEI F     DPN     PS +   +   V +R+        
Sbjct: 61  RQGLIHQGSGGA-VMSASVEIVFH----DPNHKIILPSGVVPRENDEVYIRRTVGLKKDD 115

Query: 282 YYINDKESSFTQVTTLLKNEGIDLDHKRFLILQGEVENIAQMKPKSEKEGDDGLLEYLED 341
           Y +ND+  +   V  +L++ G  +++   ++ QG++  +   K K         L  LED
Sbjct: 116 YQLNDRNVTKGDVVRMLESTGFSMNNPYNIVPQGKIIALTNAKDKER-------LNLLED 168

Query: 342 IIGTSHYKVQIEHNLSKVEALNEICIEKENRFNIVEKEKDSLVDGKNEALKYLANEKNLV 401
           ++G   ++++++ +L K++       +K N+ ++   E +S +   N+  K L  EK   
Sbjct: 169 VVGAKSFELKLKASLKKMDETE----QKRNQIDMEMNELNSKLKEMNQERKEL--EKFNS 222

Query: 402 LAKSKK-YQHQLYIDNKKLTSTLAKI----------TDAQENYDKELEKYSTISKEL 447
           L K++K +Q  LY  +++L   + +I           D+ E Y KEL+K   I  EL
Sbjct: 223 LDKNRKVFQFTLY--DRELNDIITQIENLDGDYNSTVDSSEKYIKELDKRENIISEL 277

 Score = 77.4 bits (189), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 54/190 (28%), Positives = 93/190 (48%), Gaps = 34/190 (17%)

Query: 1236 SEYKKRKSDLDESISEKETAKEETEVLKKKRLEEFTTGFDIISLTLKEMYQMITMGGNAE 1295
            +E +KR S+LDES   K + KE    LK++++    + F+ +S     +++ +   G A+
Sbjct: 1007 TELEKRASELDES---KTSIKELITRLKQQKVTAVDSTFEKVSKNFVTVFESLVPRGTAK 1063

Query: 1296 LELVDS-----------------------------LDPFSEGVTFSVMPPKKS--WRNIS 1324
            L +  S                             ++P   GV+ SV    K     ++ 
Sbjct: 1064 LIIHKSDGSASNDNAPESGDEEMDVDMDETEDQKKIEPIYTGVSISVSFNSKENEQLHVE 1123

Query: 1325 NLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKDAQLIVI 1384
             LSGG+KT+ ++AL+ A+    P P Y+ DEIDAALD +  + VA  I++ + +AQ I  
Sbjct: 1124 QLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRTSVAKLIEKLSANAQFICT 1183

Query: 1385 SLRNNMFELS 1394
            + R +M E++
Sbjct: 1184 TFRTDMLEVA 1193

 Score = 43.5 bits (101), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 38/139 (27%), Positives = 66/139 (47%), Gaps = 5/139 (3%)

Query: 701 YGRLGDLGVIDEKYDVAIST-ACPRLEDLVVDSVDCGQQCIDYLRKNRLGYARFILLDKL 759
           +G LG+L  ++ KY           L  ++VD+ +   + +  L + + G   FI L+K+
Sbjct: 537 FGTLGELVSVNSKYKTCAEVIGGNSLFHVIVDTEETASKIMKELYRMKGGRVTFIPLNKV 596

Query: 760 RKFNLNRIETPDNAPRLFDLIQ-VRED-KFLPAFYSVLRDTLVATNLLHANKVAYGKRRF 817
             F+ +    P++      LI+ ++ D KF  A   V   T+V  +L    K+A  K + 
Sbjct: 597 Y-FDNSITFPPEDQSSYTPLIKKIKYDEKFDKAVKHVFGKTIVVKDLSTGLKLA-KKYKL 654

Query: 818 RVVTLDGKLIDISGTMSGG 836
             +TLDG   D  G ++GG
Sbjct: 655 SAITLDGDRADKRGVLTGG 673

>Kpol_1018.2 s1018 complement(5901..9536) [3636 bp, 1211 aa] {ON}
           complement(5901..9536) [3636 nt, 1212 aa]
          Length = 1211

 Score = 82.0 bits (201), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 68/279 (24%), Positives = 130/279 (46%), Gaps = 44/279 (15%)

Query: 165 LVIERLVLTNFKSYAGRQVVGPFHTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGK 224
           + I R+V+  FK+Y    V+  F  N++ V+G NGSGKSN   ++ FV     + +++ +
Sbjct: 1   MYIHRIVIKGFKTYRNETVIDFFSPNYNIVIGSNGSGKSNFFAAIRFVLSDDYSNLKREE 60

Query: 225 LKDLIHKSEKYPELSSCSVEIHFQYVIDDPNGG---PSKIDESKEKLVVMRKAFKNNSSK 281
            + LIH+      + S SVEI F+    DP      PS +   +   + +R+        
Sbjct: 61  RQGLIHQGS--GSVMSASVEIVFR----DPGHRMILPSGVVPRENDEIFIRRTVGLKKDD 114

Query: 282 YYINDKESSFTQVTTLLKNEGIDLDHKRFLILQGEVENIAQMKPKSEKEGDDGLLEYLED 341
           Y +ND+  + + V  +L++ G  + +   ++ QG +  +   K K         L+ LED
Sbjct: 115 YQVNDRNVTKSDVVRMLESAGFSMSNPYNIVPQGRIIAVTNAKDKER-------LQLLED 167

Query: 342 IIGTSHYKVQIEHNLSKVE-------ALNEICIEKENRFNIVEKEKDSL-----VDGKNE 389
           ++G   ++ ++  +L K++        ++E   E   +   +E+E+  L     ++GK +
Sbjct: 168 VVGAKSFESKLRASLKKMDETEQKRKKISEEMSELNKKLGDMEEERKELEKFNALEGKRK 227

Query: 390 ALKY----------------LANEKNLVLAKSKKYQHQL 412
            L++                L +E N +LA S++Y  QL
Sbjct: 228 VLQFTLYDREINDIINQIEGLDSEYNNILASSEEYLQQL 266

 Score = 74.7 bits (182), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 48/178 (26%), Positives = 91/178 (51%), Gaps = 17/178 (9%)

Query: 1237 EYKKRKSDLDESISEKETAKEETEVLKKKRLEEFTTGFDIISLTLKEMYQMITMGGNAEL 1296
            E  +R ++LD+S   K + +   E LK++++    + F  +S     +++ +   G A+L
Sbjct: 1007 ELNERAAELDDS---KVSIQNLIEKLKQQKVTAVDSTFKKVSENFSTVFEKLVPRGTAKL 1063

Query: 1297 EL------------VDSLDPFSEGVTFSVM--PPKKSWRNISNLSGGEKTLSSLALVFAL 1342
             +             +S +    G++ SV     K    ++  LSGG+KT+ ++AL+ A+
Sbjct: 1064 IIHRQEENKTRSKDKNSTESIYSGISISVSFNSKKNEQLHVEQLSGGQKTVCAIALILAI 1123

Query: 1343 HKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKDAQLIVISLRNNMFELSKQLVGI 1400
                P P Y+ DEIDAALD +  + VA+ IK  + +AQ I  + R +M +++ +   +
Sbjct: 1124 QMVDPAPFYLFDEIDAALDKQYRAAVADVIKSLSGNAQFICTTFRTDMLQVADKFFRV 1181

 Score = 45.4 bits (106), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 39/141 (27%), Positives = 67/141 (47%), Gaps = 5/141 (3%)

Query: 699 GFYGRLGDLGVIDEKYD-VAISTACPRLEDLVVDSVDCGQQCIDYLRKNRLGYARFILLD 757
             +G LG+L  + EKY   A       L ++VVD+ +     ++ L   + G   F+ L+
Sbjct: 534 AVFGTLGELIKVSEKYKRCAEVIGGNSLFNVVVDTEETATIIMNELYHMKGGRVTFMPLN 593

Query: 758 KLRKFNLNRIETPDNAPRLFDLIQ-VRED-KFLPAFYSVLRDTLVATNLLHANKVAYGKR 815
           ++   N N    P+       LI+ ++ D ++  A   +   T+V  +LL  +K+A  K 
Sbjct: 594 RIHVDN-NITYPPNEQASCTPLIKKIKYDVRYEKAVKHIFGRTIVVKDLLEGSKIA-KKL 651

Query: 816 RFRVVTLDGKLIDISGTMSGG 836
           +   VTLDG   D  G ++GG
Sbjct: 652 KLNAVTLDGDRADKMGVLTGG 672

>Kwal_14.2435 s14 complement(756213..759956) [3744 bp, 1247 aa] {ON}
            YJL074C (SMC3) - SMC chromosomal ATPase family member
            [contig 224] FULL
          Length = 1247

 Score = 81.6 bits (200), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 58/213 (27%), Positives = 98/213 (46%), Gaps = 33/213 (15%)

Query: 1233 RRLSEYKK---RKSDLDESISEKETAKEE----TEVLKKKRLEEFTTGFDIISLTLKEMY 1285
            R +  +KK   ++ DL+    E E +KE      E LKK+++E     F  ++     ++
Sbjct: 1017 RAIENFKKFNDKREDLESRAEELEQSKESIEKLVESLKKQKVEAVEATFSKVATNFTTIF 1076

Query: 1286 QMITMGGNAELEL------------------------VDSLDPFSEGVTFSVMPPKKSWR 1321
            + +   G   L +                         D+LD    GV+ SV    K+  
Sbjct: 1077 EKLVPAGIGRLIIHRTTEKSNRGTGQRSPEYSPLNSNADTLDSMYSGVSISVSFNSKNNE 1136

Query: 1322 N--ISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKDA 1379
               +  LSGG+KT+ ++AL+ A+    P P Y+ DEIDAALD +  + VAN IKE +  A
Sbjct: 1137 QLYVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRTSVANTIKELSAHA 1196

Query: 1380 QLIVISLRNNMFELSKQLVGIYKSENMTQSATL 1412
            Q I  + R +M +++     +     +++ AT+
Sbjct: 1197 QFICTTFRTDMLQVADSFYRVKFENKISEIATV 1229

 Score = 73.2 bits (178), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 50/204 (24%), Positives = 98/204 (48%), Gaps = 16/204 (7%)

Query: 163 IRLVIERLVLTNFKSYAGRQVVGPFHTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQ 222
           + + I+ +++  FK+Y     V  F  +F+ V+G NGSGKSN   ++ FV     + +++
Sbjct: 23  VEMYIQSVLIQGFKTYRNITAVEDFSPHFNVVIGGNGSGKSNFFAAVRFVLSDDYSSLKR 82

Query: 223 GKLKDLIHKSEKYPELSSCSVEIHFQYVIDDPNGG---PSKIDESKEKLVVMRKAFKNNS 279
            + + LIH+      + S  VEI F     DP+      S I  ++E +V +R+      
Sbjct: 83  EERQGLIHQG--TGSIMSAYVEIVFH----DPSDQMMMTSGIPVTEEHIVRVRRTIGLKK 136

Query: 280 SKYYINDKESSFTQVTTLLKNEGIDLDHKRFLILQGEVENIAQMKPKSEKEGDDGLLEYL 339
            +Y +N K    + ++ + ++ G    +   ++ QG +  +   K K         L  L
Sbjct: 137 DEYSVNGKTCHKSDISRMFESVGFSASNPYNIVPQGRIVAVTNAKDKER-------LLLL 189

Query: 340 EDIIGTSHYKVQIEHNLSKVEALN 363
           ED++G   +++++  +  K+EA N
Sbjct: 190 EDVVGARSFEIKLRESSKKMEATN 213

 Score = 46.6 bits (109), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 42/145 (28%), Positives = 69/145 (47%), Gaps = 13/145 (8%)

Query: 699 GFYGRLGDLGVIDEKY-DVAISTACPRLEDLVVDSVDCGQQCIDYLRKNRLGYARFILLD 757
             +G LG+L  ++EKY   A +     L  +VVD+ +     +  L   + G   FI L+
Sbjct: 558 AVHGPLGELIKVNEKYKTCAEAVGGNSLLHVVVDTEETASILMSELYNTKAGRVTFIPLN 617

Query: 758 KLRKFNLNRIETPDNA-----PRLFDLIQVREDK-FLPAFYSVLRDTLVATNLLHANKVA 811
           ++   + N +  P+NA     P L+   +++ DK F  A   V   T+V  +L + +K+A
Sbjct: 618 RIS--DRNAVTFPENAQAECTPLLW---KIKYDKVFEKAVRHVFGRTIVVRDLGNGSKLA 672

Query: 812 YGKRRFRVVTLDGKLIDISGTMSGG 836
                   VTLDG   D  G ++GG
Sbjct: 673 RSYN-LDAVTLDGDRADNRGVITGG 696

>TPHA0I01090 Chr9 complement(252902..256552) [3651 bp, 1216 aa] {ON}
           Anc_1.295 YJL074C
          Length = 1216

 Score = 80.9 bits (198), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 74/305 (24%), Positives = 143/305 (46%), Gaps = 30/305 (9%)

Query: 165 LVIERLVLTNFKSYAGRQVVGPFHTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGK 224
           + I+++++  FK+Y    ++  F  +++ ++G NGSGKSN   ++ FV     + +++ +
Sbjct: 1   MYIQKVIIKGFKTYRNETIIDDFSPHYNIIIGSNGSGKSNFFAAIRFVLSDDYSNLKREE 60

Query: 225 LKDLIHKSEKYPELSSCSVEIHFQYVIDDPNGG---PSKIDESKEKLVVMRKAFKNNSSK 281
            + LIH+      + S SVEI F     DP      PS +  + +  V +R+        
Sbjct: 61  RQGLIHQGS--GSVMSASVEIQFY----DPGNSMILPSGVAVNPDSTVSIRRTVGLKKDD 114

Query: 282 YYINDKESSFTQVTTLLKNEGIDLDHKRFLILQGEVENIAQMKPKSEKEGDDGLLEYLED 341
           Y IND+  + + +  ++++ G  + +   ++ QG +  +   K K         L+ LED
Sbjct: 115 YQINDRNVTKSDIVRMMESTGFSMSNPYNIVPQGRIVALTNAKDKER-------LQILED 167

Query: 342 IIGTSHYKVQIEHNLSKVEALNEICIEKENRFNIVEKEKDSLVDGKNEALKYLANEKNLV 401
           ++G   ++ ++  +L K+E   +  ++       + K+ D + + + E  KY     N +
Sbjct: 168 VVGAKSFEAKLTASLKKMEETEKKRMQIAKEMKELTKKLDEMEEERKELEKY-----NDL 222

Query: 402 LAKSKKYQHQLY------IDNK--KLTSTLAKITDAQENYDKELEKYSTISKEL-KNLQD 452
               K +Q  LY      I N+  KL S    I    E Y +EL+K   I  ++ K LQ+
Sbjct: 223 EGDRKVFQFTLYDRELNDIINQIEKLESEYTNILYTSEQYLQELDKREGIVVDITKTLQN 282

Query: 453 EEITL 457
            E +L
Sbjct: 283 TEASL 287

 Score = 75.5 bits (184), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 55/211 (26%), Positives = 106/211 (50%), Gaps = 23/211 (10%)

Query: 1225 IEILEEYVRRLSEYKKRKSDLDESISEKETAKEETEVLKKKRLEEFTTGFDIISLTLKEM 1284
             E  +++  + +E  +R  +LD+S   K + +E    LK++++    T F  +S    ++
Sbjct: 995  FENFKKFSEKQNELVERAKELDDS---KNSIQELITQLKEQKITAVDTTFKKVSENFTKV 1051

Query: 1285 YQMITMGGNAELEL-------VDSLDPFSE----------GVTFSVM--PPKKSWRNISN 1325
            ++ +   G A L +       + S+D  ++          GV+ SV     +    ++  
Sbjct: 1052 FEKLVPRGTANLIIHRRSDDSLASMDINTDSQNISELVYTGVSISVSFNSKRDEQLHVEQ 1111

Query: 1326 LSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKDAQLIVIS 1385
            LSGG+KT+ ++A++ A+    P P Y+ DEIDAALD +  + VA+ IK  + +AQ I  +
Sbjct: 1112 LSGGQKTVCAIAMILAIQMVDPAPFYLFDEIDAALDKQYRTAVADVIKSLSSNAQFICTT 1171

Query: 1386 LRNNMFELSKQLVGIYKSENMTQSATLVNND 1416
             R +M +++ +   + K EN   +   +N D
Sbjct: 1172 FRTDMLQVADKFFRV-KYENKISTVVEINRD 1201

 Score = 46.6 bits (109), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 40/140 (28%), Positives = 71/140 (50%), Gaps = 9/140 (6%)

Query: 702 GRLGDLGVIDEKYD-VAISTACPRLEDLVVDSVDCGQQCIDYLRKNRLGYARFILLDKLR 760
           G LG+L  + EKY   A       L ++VVD+ +     +D L + + G   F+ L+++R
Sbjct: 537 GTLGELIKVSEKYKRCAEVIGGNSLFNIVVDTDETASLIMDELYRMKGGRVTFMPLNRIR 596

Query: 761 KFNLNRIETPDNAPRLFDLIQ-VRED-KFLPAFYSVLRDTLVATNLLHANKVAYGKRRFR 818
             + N    P++      LI+ ++ D ++  A   V   T+V  +L   +K+A   +RF+
Sbjct: 597 -MDSNFTYPPNDQASCTPLIKKIKFDVRYEKAVMHVFGKTIVVKDLGEGSKLA---KRFK 652

Query: 819 V--VTLDGKLIDISGTMSGG 836
           +  +TLDG   D  G ++GG
Sbjct: 653 MNAITLDGDRADKRGELTGG 672

>TDEL0D01620 Chr4 complement(321963..325634) [3672 bp, 1223 aa] {ON}
           Anc_1.295 YJL074C
          Length = 1223

 Score = 80.5 bits (197), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 54/200 (27%), Positives = 100/200 (50%), Gaps = 18/200 (9%)

Query: 165 LVIERLVLTNFKSYAGRQVVGPFHTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGK 224
           + I R+++  FK+Y    V+  F  + + V+G NGSGKSN   ++ FV     + +++ +
Sbjct: 1   MYIRRVIIKGFKTYRNETVIDDFSPHHNIVIGSNGSGKSNFFAAIRFVLSGDYSNLKREE 60

Query: 225 LKDLIHKSEKYPELSSCSVEIHFQ---YVIDDPNG-GPSKIDESKEKLVVMRKAFKNNSS 280
            + LIH+      + S SVEI F    + I  P+G  P   DE     V++R+       
Sbjct: 61  RQGLIHQGS--GSVMSASVEIVFHDPDHRIILPSGVAPRSNDE-----VLVRRTVGLKKD 113

Query: 281 KYYINDKESSFTQVTTLLKNEGIDLDHKRFLILQGEVENIAQMKPKSEKEGDDGLLEYLE 340
            Y +ND+  +   V  +L++ G  +++   ++ QG +  +   K K         L+ LE
Sbjct: 114 DYQLNDRNVTKGDVVRMLESAGFSMNNPYNIVPQGRIIALTNAKDKER-------LQLLE 166

Query: 341 DIIGTSHYKVQIEHNLSKVE 360
           D++G   ++V++  +L K+E
Sbjct: 167 DVVGAKSFEVKLRASLKKME 186

 Score = 74.3 bits (181), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 55/195 (28%), Positives = 94/195 (48%), Gaps = 30/195 (15%)

Query: 1237 EYKKRKSDLDESISEKETAKEETEVLKKKRLEEFTTGFDIISLTLKEMYQMITMGGNAEL 1296
            E + R  +LDES   K + +     LK++++    + F+ +S    E+++ +   G A+L
Sbjct: 1007 ELEDRSKELDES---KTSIQNLIVKLKQQKVAAVDSTFENVSRNFTEVFEQLVPRGKAKL 1063

Query: 1297 ELVDSLDPFSE------------------------GVTFSVMPPKKSWR--NISNLSGGE 1330
             +  S D   +                        GV+ SV    K  R  ++  LSGG+
Sbjct: 1064 VIHRSSDARDDDVDAENDTAMTGDDDGTQTESMYTGVSISVSFNSKKTRQLHVEQLSGGQ 1123

Query: 1331 KTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKDAQLIVISLRNNM 1390
            KT+ ++AL+ A+    P P Y+ DEIDAALD +  + VA  IK  + +AQ I  + R +M
Sbjct: 1124 KTVCAVALILAIQMVDPAPFYLFDEIDAALDKQYRTAVAGIIKALSANAQFICTTFRTDM 1183

Query: 1391 FELSKQLVGIYKSEN 1405
             +++ +   + K EN
Sbjct: 1184 LQVADKFFRV-KYEN 1197

>Smik_10.167 Chr10 complement(290936..294625) [3690 bp, 1229 aa]
           {ON} YJL074C (REAL)
          Length = 1229

 Score = 80.1 bits (196), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 65/258 (25%), Positives = 122/258 (47%), Gaps = 32/258 (12%)

Query: 165 LVIERLVLTNFKSYAGRQVVGPFHTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGK 224
           + I+R+++  FK+Y    ++  F  + + ++G NGSGKSN   ++ FV     + +++ +
Sbjct: 1   MYIKRVIIKGFKTYRNETIIDNFSPHQNVIIGSNGSGKSNFFAAIRFVLSDDYSNLKREE 60

Query: 225 LKDLIHKSEKYPELSSCSVEIHFQYVIDDPNGG---PSKIDESKEKLVVMRKAFKNNSSK 281
            + LIH+      + S SVEI F     DP+     PS +    +  V +R+        
Sbjct: 61  RQGLIHQGSG-GSVMSASVEIVFH----DPDHSMILPSGVLSRGDDEVTIRRTVGLKKDD 115

Query: 282 YYINDKESSFTQVTTLLKNEGIDLDHKRFLILQGEVENIAQMKPKSEKEGDDGLLEYLED 341
           Y +ND+  +   +  +L+  G  +++   ++ QG++  +   K K         L+ LED
Sbjct: 116 YQLNDRNVTKGDIVRMLETAGFSMNNPYNIVPQGKIVALTNAKDKER-------LQLLED 168

Query: 342 IIGTSHYKVQIEHNLSKVEALNEICIEKENRFNIVEKEKDSLVDGKNEALKYLANEK--- 398
           ++G   ++V+++ +L K+E       E E +   + KE D L    N  L  +  E+   
Sbjct: 169 VVGAKSFEVKLKASLKKME-------ETEQKKFQINKEMDEL----NSKLTEMEQERKEL 217

Query: 399 ---NLVLAKSKKYQHQLY 413
              N +  K K YQ+ LY
Sbjct: 218 EKYNELERKRKIYQYTLY 235

 Score = 75.5 bits (184), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 65/236 (27%), Positives = 115/236 (48%), Gaps = 35/236 (14%)

Query: 1207 LDAEIENLEEQLEHSTANIEILEEYVRRLSEYKKRKSDLDESISEKETAKEETEVLKKKR 1266
            ++ EI  L+   + +  N +  +E  + LSE   R S+LDES   K++ ++    LK+++
Sbjct: 984  MNTEISGLKNVNKRAFENFKKFDEKRKDLSE---RASELDES---KDSIQDLIVKLKQQK 1037

Query: 1267 LEEFTTGFDIISLTLKEMYQMITMGGNAELEL---------VDSLDP------------- 1304
            +    + F  +S   + +++ +   G A+L +         +DS+D              
Sbjct: 1038 VNAVDSTFQKVSENFEAVFERLVPRGIAKLVIHRRDDTKDQMDSIDDDMDVASSERTSSK 1097

Query: 1305 ----FSEGVTFSVMPPKKS--WRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDA 1358
                   GV+ SV    K     ++  LSGG+KT+ ++AL+ A+    P   Y+ DEIDA
Sbjct: 1098 DGDIMYTGVSISVSFNSKQNEQLHVEQLSGGQKTVCAIALILAIQMVDPASFYLFDEIDA 1157

Query: 1359 ALDFRNVSIVANYIKERTKDAQLIVISLRNNMFELSKQLVGIYKSENMTQSATLVN 1414
            ALD +  + VA  IKE +K+AQ I  + R +M +++ +   + K EN   +   VN
Sbjct: 1158 ALDKQYRTAVATLIKELSKNAQFICTTFRTDMLQVADKFFRV-KYENKISTVIEVN 1212

 Score = 40.8 bits (94), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 39/142 (27%), Positives = 63/142 (44%), Gaps = 9/142 (6%)

Query: 701 YGRLGDLGVIDEKYDVAIST-ACPRLEDLVVDSVDCGQQCIDYLRKNRLGYARFILLDKL 759
           +G LG+L  +++KY           L  +VVD+ +     ++ L + + G   FI L++L
Sbjct: 537 FGTLGELIKVNDKYKACAEVIGGNSLFHVVVDTEETATLIMNELYRMKGGRVTFIPLNRL 596

Query: 760 R-----KFNLNRIETPDNAPRLFDLIQVREDKFLPAFYSVLRDTLVATNLLHANKVAYGK 814
                 KF  N        P L   I+  + +F  A   V   T+V  +L    K+A  K
Sbjct: 597 SLDSDVKFPSNTTTQIQFTP-LIKKIKY-QPRFEKAVKHVFGRTIVVKDLGQGLKLA-KK 653

Query: 815 RRFRVVTLDGKLIDISGTMSGG 836
            +   +TLDG   D  G ++GG
Sbjct: 654 HKLNAITLDGDRADKRGVLTGG 675

>NCAS0A09330 Chr1 (1844122..1847805) [3684 bp, 1227 aa] {ON}
           Anc_1.295 YJL074C
          Length = 1227

 Score = 79.7 bits (195), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 81/312 (25%), Positives = 144/312 (46%), Gaps = 59/312 (18%)

Query: 165 LVIERLVLTNFKSYAGRQVVGPFHTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGK 224
           + I+R+V+  FK+Y  + V+  F  + + V+G NGSGKSN   ++ FV     + +++ +
Sbjct: 1   MYIKRVVIKGFKTYRNQTVIDDFSPHHNIVIGSNGSGKSNFFSAIRFVLSDDYSNLKREE 60

Query: 225 LKDLIHKSEKYPELSSCSVEIHFQYVIDDPNGG---PSKI------DESKEKLVVMRKAF 275
            + LIH+      + S SVEI F     DP      PS +      DE     + +R+  
Sbjct: 61  RQGLIHQGSG-GSVMSASVEIVFH----DPEHKMILPSGVVPRENNDE-----ICIRRTV 110

Query: 276 KNNSSKYYINDKESSFTQVTTLLKNEGIDLDHKRFLILQGEVENIAQMKPKSEKEGDDGL 335
                 Y +ND+  +   V  +L++ G  + +   ++ QG++ ++   K K         
Sbjct: 111 GLKKDDYQLNDRNVTKGDVVRMLESTGFSMSNPYNIVPQGKIISLTNAKDKER------- 163

Query: 336 LEYLEDIIGTSHYKVQIEHNLSKVEALNEICIEKENRFNIVEKEKDSLVDGKNEALKYLA 395
           L+ LED++G   ++V+++ +L K+E       E E +   + KE D L    N  LK + 
Sbjct: 164 LQLLEDVVGAKSFEVKLKASLKKME-------ETEQKRARIAKEMDEL----NSKLKEME 212

Query: 396 NEK------NLVLAKSKKYQHQLYIDNKKLTSTLAKI----------TDAQENYDKELEK 439
            E+      N +    K +Q  LY  +++L   + ++           ++ E Y KEL+K
Sbjct: 213 QERKELEKYNALEKNRKVFQFTLY--DRELNDIINQVERLDDDYNVTANSSEQYIKELDK 270

Query: 440 ----YSTISKEL 447
                S ISK L
Sbjct: 271 REEIISNISKNL 282

 Score = 73.6 bits (179), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 36/106 (33%), Positives = 63/106 (59%), Gaps = 2/106 (1%)

Query: 1297 ELVDSLDPFSEGVTFSVMPPKKS--WRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMD 1354
            E++++ +    GV+ SV    K     ++  LSGG+KT+ ++AL+ A+    P P Y+ D
Sbjct: 1092 EVINNNESIYTGVSISVSFNSKENEQLHVEQLSGGQKTVCAIALILAIQMVDPAPFYLFD 1151

Query: 1355 EIDAALDFRNVSIVANYIKERTKDAQLIVISLRNNMFELSKQLVGI 1400
            EIDAALD +  + VAN IK+ + +AQ I  + R +M +++ +   +
Sbjct: 1152 EIDAALDKQYRTAVANIIKQLSVNAQFICTTFRTDMLQVADRFFRV 1197

 Score = 42.0 bits (97), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 36/141 (25%), Positives = 66/141 (46%), Gaps = 5/141 (3%)

Query: 699 GFYGRLGDLGVIDEKYDVAISTACPR-LEDLVVDSVDCGQQCIDYLRKNRLGYARFILLD 757
             +G LG+L  ++EKY +         L  +VVD+ +     +  L K + G   FI L+
Sbjct: 536 SVFGTLGELINVNEKYKICAEVVGGNSLFHIVVDTEETATIIMKELYKMKGGRVTFIPLN 595

Query: 758 KLRKFNLNRIETPDNAPRLFDLI-QVRED-KFLPAFYSVLRDTLVATNLLHANKVAYGKR 815
           ++   + N    P++      LI +++ D +F  A   +   T+V  +L    +++  K 
Sbjct: 596 RIY-LDANIQYPPNDQTSFTPLINKIKYDQRFDKAVRHIFGKTIVVKDLTTGLRIS-KKF 653

Query: 816 RFRVVTLDGKLIDISGTMSGG 836
           +   +TLDG   D  G ++GG
Sbjct: 654 KLNSITLDGDRADKRGVLTGG 674

>Suva_6.149 Chr6 (248275..251967) [3693 bp, 1230 aa] {ON} YJL074C
           (REAL)
          Length = 1230

 Score = 79.3 bits (194), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 50/199 (25%), Positives = 100/199 (50%), Gaps = 15/199 (7%)

Query: 165 LVIERLVLTNFKSYAGRQVVGPFHTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGK 224
           + I+R+V+  FK+Y    ++  F  + + ++G NGSGKSN   ++ FV     + +++ +
Sbjct: 1   MYIKRVVIKGFKTYRNETIIDNFSPHQNVIIGSNGSGKSNFFAAIRFVLSDDYSNLKREE 60

Query: 225 LKDLIHKSEKYPELSSCSVEIHFQYVIDDPNGG---PSKIDESKEKLVVMRKAFKNNSSK 281
            + LIH+      + S SVEI F     DP+     PS +    +  V +R+        
Sbjct: 61  RQGLIHQGSG-GSVMSASVEIVFH----DPDHSMILPSGVLSRGDDEVTIRRTVGLKKDD 115

Query: 282 YYINDKESSFTQVTTLLKNEGIDLDHKRFLILQGEVENIAQMKPKSEKEGDDGLLEYLED 341
           Y +ND+  +   +  +L+  G  +++   ++ QG++  +   K K         L+ LED
Sbjct: 116 YQLNDRNVTKGDIVRMLETAGFSMNNPYNIVPQGKIVALTNAKDKER-------LQLLED 168

Query: 342 IIGTSHYKVQIEHNLSKVE 360
           ++G   ++V+++ +L K+E
Sbjct: 169 VVGAKSFEVKLKASLKKME 187

 Score = 73.2 bits (178), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 57/203 (28%), Positives = 99/203 (48%), Gaps = 33/203 (16%)

Query: 1241 RKSDLDESISEKETAKEETEVLKKKRLEEFTTGFDIISLTLKEMYQMITMGGNAELELV- 1299
            R S+LDES   K++ ++    LK++++    + F  +S   K +++ +   G A+L +  
Sbjct: 1015 RASELDES---KDSIQDLIVKLKQQKVSAVDSTFQKVSENFKTVFERLVPRGTAKLVIHR 1071

Query: 1300 ---DSLDPFSE-----------------------GVTFSVMPPKKS--WRNISNLSGGEK 1331
               DS+D  ++                       GV+ SV    K     ++  LSGG+K
Sbjct: 1072 RNEDSIDQANDVDVDMDTGNNEDTINKEGETVYTGVSISVSFNSKQNEQLHVEQLSGGQK 1131

Query: 1332 TLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKDAQLIVISLRNNMF 1391
            T+ ++AL+ A+    P   Y+ DEIDAALD +  + VA  IKE + +AQ I  + R +M 
Sbjct: 1132 TVCAIALILAIQMVDPASFYLFDEIDAALDKQYRTAVATMIKELSTNAQFICTTFRTDML 1191

Query: 1392 ELSKQLVGIYKSENMTQSATLVN 1414
            +++ +   + K EN   +   VN
Sbjct: 1192 QVADKFFRV-KYENKISTVIEVN 1213

 Score = 42.4 bits (98), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 38/143 (26%), Positives = 67/143 (46%), Gaps = 11/143 (7%)

Query: 701 YGRLGDLGVIDEKYDVAIST-ACPRLEDLVVDSVDCGQQCIDYLRKNRLGYARFILLDKL 759
           +G LG+L  +++KY           L  +VVD+ +     ++ L + + G   FI L+KL
Sbjct: 537 FGTLGELIKVNDKYKACAEVIGGNSLFHIVVDTEETATLIMNELYRMKGGRVTFIPLNKL 596

Query: 760 RKFNLNR-IETPDNAPRLFDLIQ-VREDKFLPAF----YSVLRDTLVATNLLHANKVAYG 813
              +L+  ++ P N+         +++ K+ P F      V   T+V  +L    K+A  
Sbjct: 597 ---SLDADVKFPSNSTTQIQFTPLIKKIKYQPRFEKAVKHVFGKTIVVKDLGQGLKLA-K 652

Query: 814 KRRFRVVTLDGKLIDISGTMSGG 836
           K +   +TLDG   D  G ++GG
Sbjct: 653 KHKLNAITLDGDRADKRGVLTGG 675

>YJL074C Chr10 complement(299157..302849) [3693 bp, 1230 aa] {ON}
           SMC3Subunit of the multiprotein cohesin complex required
           for sister chromatid cohesion in mitotic cells; also
           required, with Rec8p, for cohesion and recombination
           during meiosis; phylogenetically conserved SMC
           chromosomal ATPase family member
          Length = 1230

 Score = 78.6 bits (192), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 49/199 (24%), Positives = 100/199 (50%), Gaps = 15/199 (7%)

Query: 165 LVIERLVLTNFKSYAGRQVVGPFHTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGK 224
           + I+R+++  FK+Y    ++  F  + + ++G NGSGKSN   ++ FV     + +++ +
Sbjct: 1   MYIKRVIIKGFKTYRNETIIDNFSPHQNVIIGSNGSGKSNFFAAIRFVLSDDYSNLKREE 60

Query: 225 LKDLIHKSEKYPELSSCSVEIHFQYVIDDPNGG---PSKIDESKEKLVVMRKAFKNNSSK 281
            + LIH+      + S SVEI F     DP+     PS +    +  V +R+        
Sbjct: 61  RQGLIHQGSG-GSVMSASVEIVFH----DPDHSMILPSGVLSRGDDEVTIRRTVGLKKDD 115

Query: 282 YYINDKESSFTQVTTLLKNEGIDLDHKRFLILQGEVENIAQMKPKSEKEGDDGLLEYLED 341
           Y +ND+  +   +  +L+  G  +++   ++ QG++  +   K K         L+ LED
Sbjct: 116 YQLNDRNVTKGDIVRMLETAGFSMNNPYNIVPQGKIVALTNAKDKER-------LQLLED 168

Query: 342 IIGTSHYKVQIEHNLSKVE 360
           ++G   ++V+++ +L K+E
Sbjct: 169 VVGAKSFEVKLKASLKKME 187

 Score = 71.2 bits (173), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 39/109 (35%), Positives = 62/109 (56%), Gaps = 3/109 (2%)

Query: 1308 GVTFSVMPPKKS--WRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNV 1365
            GV+ SV    K     ++  LSGG+KT+ ++AL+ A+    P   Y+ DEIDAALD +  
Sbjct: 1106 GVSISVSFNSKQNEQLHVEQLSGGQKTVCAIALILAIQMVDPASFYLFDEIDAALDKQYR 1165

Query: 1366 SIVANYIKERTKDAQLIVISLRNNMFELSKQLVGIYKSENMTQSATLVN 1414
            + VA  +KE +K+AQ I  + R +M +++ +   + K EN   +   VN
Sbjct: 1166 TAVATLLKELSKNAQFICTTFRTDMLQVADKFFRV-KYENKISTVIEVN 1213

 Score = 43.1 bits (100), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 40/142 (28%), Positives = 63/142 (44%), Gaps = 9/142 (6%)

Query: 701 YGRLGDLGVIDEKYDVAIST-ACPRLEDLVVDSVDCGQQCIDYLRKNRLGYARFILLDKL 759
           +G LG+L  +++KY           L  +VVD+ +     ++ L + + G   FI L++L
Sbjct: 537 FGTLGELIKVNDKYKTCAEVIGGNSLFHIVVDTEETATLIMNELYRMKGGRVTFIPLNRL 596

Query: 760 R-----KFNLNRIETPDNAPRLFDLIQVREDKFLPAFYSVLRDTLVATNLLHANKVAYGK 814
                 KF  N        P L   I+  E +F  A   V   T+V  +L    K+A  K
Sbjct: 597 SLDSDVKFPSNTTTQIQFTP-LIKKIKY-EPRFEKAVKHVFGKTIVVKDLGQGLKLA-KK 653

Query: 815 RRFRVVTLDGKLIDISGTMSGG 836
            +   +TLDG   D  G ++GG
Sbjct: 654 HKLNAITLDGDRADKRGVLTGG 675

>KAFR0A01610 Chr1 complement(326620..330303) [3684 bp, 1227 aa] {ON}
           Anc_1.295 YJL074C
          Length = 1227

 Score = 78.6 bits (192), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 56/229 (24%), Positives = 112/229 (48%), Gaps = 24/229 (10%)

Query: 165 LVIERLVLTNFKSYAGRQVVGPFHTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGK 224
           + I+R+++  FK+Y    ++  F  + + ++G NGSGKSN+  ++ FV     + +++ +
Sbjct: 1   MYIKRVIIKGFKTYRNETIIDNFSPHHNIIIGSNGSGKSNLFAAIRFVLSDDYSNLKREE 60

Query: 225 LKDLIHK-SEKYPELSSCSVEIHFQYVIDDPN-----GGPSKIDESKEKLVVMRKAFKNN 278
            + LIH+ +     + SCSVEI F     DP+        + I       V +R+     
Sbjct: 61  RQGLIHQGTSGGSSVMSCSVEIVFH----DPDNRMILASNASIVPRPNNEVFIRRTVGLK 116

Query: 279 SSKYYINDKESSFTQVTTLLKNEGIDLDHKRFLILQGEVENIAQMKPKSEKEGDDGLLEY 338
              Y IND+  + + +  +L+  G  + +   ++ QG++  +   K K         L+ 
Sbjct: 117 KDDYQINDRNVTKSDIVRILETAGFSMSNPYNIVPQGKIIALTNAKDKER-------LQL 169

Query: 339 LEDIIGTSHYKVQIEHNLSKVE--ALNEICIEKE-----NRFNIVEKEK 380
           LED++G   +++++  +L K++     +  I+KE     N+ N +E EK
Sbjct: 170 LEDVVGAKSFEIKLNDSLKKIKETEFKKSTIDKELSELKNKLNEMEWEK 218

 Score = 78.6 bits (192), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 42/115 (36%), Positives = 66/115 (57%), Gaps = 3/115 (2%)

Query: 1304 PFSEGVTFSVMPPKKS--WRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALD 1361
            P   GV+ SV    K+    ++  LSGG+KT+ ++AL+ A+    P P Y+ DEIDAALD
Sbjct: 1099 PMYTGVSISVSFNSKNDEQLHVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALD 1158

Query: 1362 FRNVSIVANYIKERTKDAQLIVISLRNNMFELSKQLVGIYKSENMTQSATLVNND 1416
             +  + VAN +KE +K+AQ I  + R +M +++ +   + K EN   S   +  D
Sbjct: 1159 KQYRTAVANTLKELSKNAQFICTTFRTDMLQVADKFFRV-KYENKISSVLEIERD 1212

 Score = 43.5 bits (101), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 47/182 (25%), Positives = 86/182 (47%), Gaps = 10/182 (5%)

Query: 701 YGRLGDLGVIDEKYDVAIST-ACPRLEDLVVDSVDCGQQCIDYLRKNRLGYARFILLDKL 759
           +G +G+L    EKY   +      +L  ++VD+ +     +  L + + G   FI L+K+
Sbjct: 542 FGTVGELIKASEKYKNCVEIIGGNQLFHIIVDTEETASLLMQELYRMKGGRVTFIPLNKI 601

Query: 760 RKFNLNRIETP--DNAPRLFDLIQV--REDKFLPAFYSVLRDTLVATNLLHANKVAYGKR 815
             +N   I  P  D       LI+    E KF  A   +   T+V  +L +  K+A  K 
Sbjct: 602 --YNDPNITYPPADQYSSFTPLIKKLKYESKFEGAMKHIFGKTIVVKDLSYGLKLA-KKF 658

Query: 816 RFRVVTLDGKLIDISGTMSGG-GNYVLRGLMKLGQDLPE-NDFEQTSPEEVQKLERELEI 873
           +   +TLDG   D  G ++GG  +Y  R  ++  ++L +  D    +  +++ ++REL I
Sbjct: 659 KLNAITLDGDRADKRGVLTGGYFDYHKRTRLESLKNLSDARDSHAQTTADLETVKRELAI 718

Query: 874 LE 875
           ++
Sbjct: 719 ID 720

>Skud_10.170 Chr10 (316063..319755) [3693 bp, 1230 aa] {ON} YJL074C
           (REAL)
          Length = 1230

 Score = 78.2 bits (191), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 50/199 (25%), Positives = 99/199 (49%), Gaps = 15/199 (7%)

Query: 165 LVIERLVLTNFKSYAGRQVVGPFHTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGK 224
           + I+R+V+  FK+Y    ++  F  + + ++G NGSGKSN   ++ FV     + +++ +
Sbjct: 1   MYIKRVVIKGFKTYRNETIIDNFSPHQNVIIGSNGSGKSNFFAAIRFVLSDDYSNLKREE 60

Query: 225 LKDLIHKSEKYPELSSCSVEIHFQYVIDDPNGG---PSKIDESKEKLVVMRKAFKNNSSK 281
            + LIH+      + S SVEI F     DP+     PS +    +  V +R+        
Sbjct: 61  RQGLIHQGSG-GSVMSASVEIVFH----DPDHSMILPSGVLSRGDDEVTIRRTVGLKKDD 115

Query: 282 YYINDKESSFTQVTTLLKNEGIDLDHKRFLILQGEVENIAQMKPKSEKEGDDGLLEYLED 341
           Y +ND+  +   +  +L+  G  + +   ++ QG++  +   K K         L+ LED
Sbjct: 116 YQLNDRNVTKGDIVRMLETAGFSMTNPYNIVPQGKIVALTNAKDKER-------LQLLED 168

Query: 342 IIGTSHYKVQIEHNLSKVE 360
           ++G   ++V+++ +L K+E
Sbjct: 169 VVGAKSFEVKLKASLKKME 187

 Score = 73.2 bits (178), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 65/237 (27%), Positives = 110/237 (46%), Gaps = 36/237 (15%)

Query: 1207 LDAEIENLEEQLEHSTANIEILEEYVRRLSEYKKRKSDLDESISEKETAKEETEVLKKKR 1266
            ++ EI  L+   + +  N +   E  + LSE   R S+LDES   K + ++    LK+++
Sbjct: 984  MNTEISGLKNVNKRAFENFKKFNEKRKDLSE---RASELDES---KNSIQDLIVRLKQQK 1037

Query: 1267 LEEFTTGFDIISLTLKEMYQMITMGGNAELEL----------VDSLD------------- 1303
            +    + F  +S   + +++ +   G A+L +           DS D             
Sbjct: 1038 VSAVDSTFQKVSENFETVFERLVPRGTAKLVIHRRNENVGDQTDSADVEMDADASKVTSS 1097

Query: 1304 ----PFSEGVTFSVMPPKKS--WRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEID 1357
                    GV+ SV    K     ++  LSGG+KT+ ++AL+ A+    P   Y+ DEID
Sbjct: 1098 RDGETVYTGVSISVSFNSKQNEQLHVEQLSGGQKTVCAIALILAIQMVDPASFYLFDEID 1157

Query: 1358 AALDFRNVSIVANYIKERTKDAQLIVISLRNNMFELSKQLVGIYKSENMTQSATLVN 1414
            AALD +  + VA  IKE + DAQ I  + R +M +++ +   + K EN   +   VN
Sbjct: 1158 AALDKQYRTAVATLIKELSNDAQFICTTFRTDMLQVADKFFRV-KYENKISTVIEVN 1213

 Score = 42.0 bits (97), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 37/142 (26%), Positives = 64/142 (45%), Gaps = 9/142 (6%)

Query: 701 YGRLGDLGVIDEKYDVAISTACPR-LEDLVVDSVDCGQQCIDYLRKNRLGYARFILLDKL 759
           +G LG+L  +++KY           L  +VVD+ +     ++ L + + G   FI L++L
Sbjct: 537 FGTLGELIKVNDKYKACAEVVGGNSLFHIVVDTEETATLIMNELYRMKGGRVTFIPLNRL 596

Query: 760 RKFNLNRIETPDNAPRLFDLIQ-VREDKFLPAF----YSVLRDTLVATNLLHANKVAYGK 814
             F  + ++ P N          +++ K+ P F      V   T+V   L    K+A  K
Sbjct: 597 --FLDSDVKFPSNTTTQIQFTPLIKKIKYQPRFEKAVKHVFGKTIVVKELGQGLKLA-KK 653

Query: 815 RRFRVVTLDGKLIDISGTMSGG 836
            +   +TLDG   D  G ++GG
Sbjct: 654 HKLNAITLDGDRADKRGLLTGG 675

>ZYRO0G21296g Chr7 (1747217..1750900) [3684 bp, 1227 aa] {ON} similar
            to uniprot|P47037 Saccharomyces cerevisiae YJL074C SMC3
            Subunit of the multiprotein cohesin complex required for
            sister chromatid cohesion in mitotic cells also required
            with Rec8p for cohesion and recombination during meiosis
            phylogenetically conserved SMC chromosomal ATPase family
            member
          Length = 1227

 Score = 78.2 bits (191), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 37/96 (38%), Positives = 62/96 (64%), Gaps = 2/96 (2%)

Query: 1301 SLDPFSEGVTFSVM--PPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDA 1358
            S++    GV+ SV     K   +++  LSGG+KT+ ++AL+ A+   +P P Y+ DEIDA
Sbjct: 1096 SVEAMYSGVSISVSFNSKKNEQQHVEQLSGGQKTVCAVALILAIQMVEPAPFYLFDEIDA 1155

Query: 1359 ALDFRNVSIVANYIKERTKDAQLIVISLRNNMFELS 1394
            ALD +  + VA+ IKE +++AQ I  + R++M E++
Sbjct: 1156 ALDKQYRTAVASTIKELSENAQFICTTFRSDMLEVA 1191

 Score = 75.5 bits (184), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 50/199 (25%), Positives = 96/199 (48%), Gaps = 16/199 (8%)

Query: 165 LVIERLVLTNFKSYAGRQVVGPFHTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGK 224
           + I R+V+  FK+Y    ++  F  + + V+G NGSGKSN   ++ FV       +++ +
Sbjct: 1   MYIRRVVIKGFKTYRNETIIDNFSPHHNIVIGSNGSGKSNFFAAIRFVLSNDYANLKREE 60

Query: 225 LKDLIHKSEKYPELSSCSVEIHFQYVIDDPNGG---PSKIDESKEKLVVMRKAFKNNSSK 281
            + LIH+      + S SVEI F     DP+     PS I   +   V +R+        
Sbjct: 61  RQGLIHQGS--GSVMSASVEIVFH----DPSHRIILPSGIPPRENDEVFVRRTVGLKKDD 114

Query: 282 YYINDKESSFTQVTTLLKNEGIDLDHKRFLILQGEVENIAQMKPKSEKEGDDGLLEYLED 341
           Y +ND+  + + V  +L++ G  + +   ++ QG +  +   K +         L  LE+
Sbjct: 115 YQLNDRNVTKSDVVRMLESAGFSMSNPYNIVPQGRIVALTNAKDRER-------LHLLEE 167

Query: 342 IIGTSHYKVQIEHNLSKVE 360
           ++G   ++V++  +L K++
Sbjct: 168 VVGAKSFEVKLRASLKKMD 186

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 40/141 (28%), Positives = 68/141 (48%), Gaps = 9/141 (6%)

Query: 701 YGRLGDLGVIDEKYD-VAISTACPRLEDLVVDSVDCGQQCIDYLRKNRLGYARFILLDKL 759
           +G LG+L  +++KY   A       L  +VVD+ +     I  L + + G   F+ L+++
Sbjct: 536 FGTLGELIKVNDKYKKCAEVVGGNSLFHIVVDTDETASLIIQELYRMKGGRVTFLPLNRV 595

Query: 760 RKFNLNRIETPDNAPRLFDLIQ-VRED-KFLPAFYSVLRDTLVATNLLHANKVAYGKRRF 817
              + N    P+       LI+ +R D +F  A   V   T+V  +L    ++A   +RF
Sbjct: 596 YS-DPNITYPPNEQASCTPLIKKIRYDARFEKAVKQVFGKTIVVRDLSTGARLA---KRF 651

Query: 818 RV--VTLDGKLIDISGTMSGG 836
           R+  +TLDG   D  G ++GG
Sbjct: 652 RLNAITLDGDRADKKGALTGG 672

>SAKL0D06116g Chr4 complement(503196..506885) [3690 bp, 1229 aa]
           {ON} similar to uniprot|P47037 Saccharomyces cerevisiae
           YJL074C SMC3 Subunit of the multiprotein cohesin complex
           required for sister chromatid cohesion in mitotic cells
           also required with Rec8p for cohesion and recombination
           during meiosis phylogenetically conserved SMC
           chromosomal ATPase family member
          Length = 1229

 Score = 76.3 bits (186), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 76/314 (24%), Positives = 149/314 (47%), Gaps = 43/314 (13%)

Query: 165 LVIERLVLTNFKSYAGRQVVGPFHTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGK 224
           + I+R+ +  FK+Y    ++  F  + + V+G NGSGKSN   ++ FV     N +++ +
Sbjct: 1   MYIKRVTIQGFKTYKNTTLIDNFSPHHNVVIGSNGSGKSNFFAAIRFVLSDDYNNLKREE 60

Query: 225 LKDLIHKSEKYPELSSCSVEIHFQYVIDDPNG-------GPSKIDESKEKLVVMRKAFKN 277
            + LIH+       S   +  + + V D+ +G        PS  DE     VV+R+    
Sbjct: 61  RQGLIHQG------SGSVMSAYVEIVFDNSDGRLLNAAASPSSPDE-----VVIRRTIGL 109

Query: 278 NSSKYYINDKESSFTQVTTLLKNEGIDLDHKRFLILQGEVENIAQMKPKSEKEGDDGLLE 337
              +Y +N K  S  ++  LL++ G    +  +++ QG +  +   K       D   L+
Sbjct: 110 KKDEYSLNSKSCSKIEIKNLLESAGFSTANPYYIVPQGRIVALTNAK-------DYERLQ 162

Query: 338 YLEDIIGTSHYKVQIEHNLSKVEALNEICIEKENRFNIVEKEKDSLVDGKNEALKYLANE 397
            L+++ G + ++ ++  +L+K++A N    + ++    ++++   L + + E  KY A E
Sbjct: 163 LLKEVTGANSFEKKLRDSLNKMDATNRNRKKIDSELRELDEKLQELNEEREELEKYNALE 222

Query: 398 KNLVLAKSKKYQHQLY------IDN--KKLTSTLAKITDAQENYDKELEK----YSTISK 445
           ++      K +Q  LY      + N  +KL S      D+ E Y +E++K     S ++K
Sbjct: 223 RD-----RKVFQFTLYDRELNDVTNHIEKLDSEYNNTVDSSEQYVQEMDKREVLISNVTK 277

Query: 446 ELKNLQDEEITLNK 459
            L N+ D E+ + K
Sbjct: 278 NLVNI-DAELKIKK 290

 Score = 76.3 bits (186), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 39/114 (34%), Positives = 64/114 (56%), Gaps = 2/114 (1%)

Query: 1308 GVTFSVM--PPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNV 1365
            GV+ SV     +    ++  LSGG+KT+ ++AL+ A+ K  P P Y+ DEIDAALD +  
Sbjct: 1103 GVSISVSFNSRQDEQLHVEQLSGGQKTVCAIALILAIQKVDPAPFYLFDEIDAALDKQYR 1162

Query: 1366 SIVANYIKERTKDAQLIVISLRNNMFELSKQLVGIYKSENMTQSATLVNNDMLN 1419
            + VAN IKE + +AQ I  + R++M  ++     +     ++  A +   D +N
Sbjct: 1163 TSVANTIKELSANAQFICTTFRSDMLRVADVFYRVKYENKISTVAEVSQRDAIN 1216

>CAGL0H02805g Chr8 complement(256682..260341) [3660 bp, 1219 aa] {ON}
            similar to uniprot|P47037 Saccharomyces cerevisiae
            YJL074c SMC3 required for structural maintenance of
            chromosomes
          Length = 1219

 Score = 75.1 bits (183), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 58/197 (29%), Positives = 99/197 (50%), Gaps = 23/197 (11%)

Query: 1236 SEYKKRKSDLDESISEKETAKEETEVLKKKRLEEFTTGFDIISLTLKEMYQMITMGGNAE 1295
            SE ++R ++LD+S   K++ ++    LK+++L      FD +S     +++ I   G A 
Sbjct: 1009 SELRERATELDDS---KQSIQDLIIKLKEQKLNAVDKTFDKVSKNFVMIFEKIVPRGTAT 1065

Query: 1296 LELV--------DSLDPFS---------EGVTFSVMPPKKS--WRNISNLSGGEKTLSSL 1336
            L +         D+ + F+         EGV+ SV    K      +  LSGG+KT+ ++
Sbjct: 1066 LNIHRINLQGTDDNSELFTQSNEHTTPYEGVSISVSFNSKQDEQLKVEQLSGGQKTVCAI 1125

Query: 1337 ALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKDAQLIVISLRNNMFELSKQ 1396
            AL+ A+   +P P Y+ DEIDAALD +    VA  I + + +AQ I  + R++M + + +
Sbjct: 1126 ALILAIQMVEPAPFYLFDEIDAALDKQYRRAVAQTISQLSNNAQFICTTFRSDMVDAANK 1185

Query: 1397 LVGIYKSENMTQSATLV 1413
               + K EN   S   V
Sbjct: 1186 FYRV-KYENKQSSVIEV 1201

 Score = 73.9 bits (180), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 50/203 (24%), Positives = 103/203 (50%), Gaps = 22/203 (10%)

Query: 165 LVIERLVLTNFKSYAGRQVVGPFHTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGK 224
           + I+R+++  FK+Y    ++G F  + + V+G NGSGKSN   ++ FV     + +++ +
Sbjct: 1   MYIKRVIIKGFKTYRNETIIGDFSPHHNVVIGANGSGKSNFFAAVRFVLSDDYSNLKREE 60

Query: 225 LKDLIHKSEKYPELSSCSVEIHF---QYVIDDPNG----GPSKIDESKEKLVVMRKAFKN 277
            + LIH+      + S SVEI F   ++ I  P G    G S  DE     V +R+    
Sbjct: 61  RQGLIHQGAG-ASVMSASVEIVFHDPEHSIIAPTGINSNGSS--DE-----VRIRRTVGL 112

Query: 278 NSSKYYINDKESSFTQVTTLLKNEGIDLDHKRFLILQGEVENIAQMKPKSEKEGDDGLLE 337
               Y +ND+  +   +  +L++ G  + +   ++ QG + ++   K K         L+
Sbjct: 113 KKDDYQVNDRNVTKGDLVRMLESAGFYMSNPYNIVPQGRIVSLTNAKDKER-------LQ 165

Query: 338 YLEDIIGTSHYKVQIEHNLSKVE 360
            LE+++G   ++V+++ ++ +++
Sbjct: 166 LLEEVVGAKSFEVKLKASMKQMD 188

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 39/141 (27%), Positives = 69/141 (48%), Gaps = 8/141 (5%)

Query: 701 YGRLGDLGVIDEKYDVAIST-ACPRLEDLVVDSVDCGQQCIDYLRKNRLGYARFILLDKL 759
           +G +G+L  ++EKY V         L  +VVD+ +     ++ L + + G   F+ L+KL
Sbjct: 538 FGTVGELIQVNEKYKVCAEVIGGNSLFHVVVDTDETASILMNELFRMKGGRVTFMPLNKL 597

Query: 760 RKFNLNRIETPD--NAPRLFDLIQVRED-KFLPAFYSVLRDTLVATNLLHANKVAYGKR- 815
           +  N N I+ P   N P    + +++ D +F      V    LV  +L   N ++  K+ 
Sbjct: 598 KNGNQN-IDYPSDPNIPCTPLIKKIKYDMQFDCVVKQVFGRALVVKDL--TNGLSISKQY 654

Query: 816 RFRVVTLDGKLIDISGTMSGG 836
           +   +TLDG  +D  G ++GG
Sbjct: 655 KLSCITLDGDRVDGKGVLTGG 675

>Ecym_6322 Chr6 (611978..615676) [3699 bp, 1232 aa] {ON} similar to
            Ashbya gossypii AAL182W
          Length = 1232

 Score = 73.2 bits (178), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 54/211 (25%), Positives = 94/211 (44%), Gaps = 34/211 (16%)

Query: 1240 KRKSDLDESISEKETAKEETEVLKKKRLEEFTTGFDIISLTLKEMYQMITMGGNAELELV 1299
            KR  +LDES   K++ +E  E LK +++E     F  +S    ++++ +   G   L + 
Sbjct: 1007 KRAKELDES---KKSIEELIEKLKGQKVEAVEVTFKKVSENFTKLFEKMVPRGTGRLVIH 1063

Query: 1300 -----------------------------DSLDPFSEGVTFSVM--PPKKSWRNISNLSG 1328
                                         D+ D    GV+  V     K    ++  LSG
Sbjct: 1064 RRADEKQEPRSRNQKKRKQDQLYDFDNGDDNEDSVYSGVSIGVSFNSKKDEQLHVEQLSG 1123

Query: 1329 GEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKDAQLIVISLRN 1388
            G+KT+ ++AL+ A+    P P Y+ DEIDAALD +  + VA  IKE + +AQ I  + R+
Sbjct: 1124 GQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRTAVAATIKELSSEAQFICTTFRS 1183

Query: 1389 NMFELSKQLVGIYKSENMTQSATLVNNDMLN 1419
            +M  ++ +   +     ++    +   D L+
Sbjct: 1184 DMIGIADKFYRVKYENKISTVVEVTRTDALH 1214

 Score = 67.8 bits (164), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 48/204 (23%), Positives = 97/204 (47%), Gaps = 27/204 (13%)

Query: 165 LVIERLVLTNFKSYAGRQVVGPFHTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGK 224
           + I +++++ FK+Y  +  +  F  + + VVG NGSGKSN   ++ FV       +++ +
Sbjct: 1   MYIRKVIISGFKTYKNKTEIDNFSAHHNVVVGLNGSGKSNFFAAIRFVLSDDYTNLKREE 60

Query: 225 LKDLIHKSEKYPELSSCSVEIHFQYV-------IDDPNGGPSKIDESKEKLVVMRKAFKN 277
            + LI++      + S  VEI F          I D NG            + +R+    
Sbjct: 61  RRSLIYQG--TSSVMSGYVEIVFHDAENRTLLGIPDSNGA-----------IRIRRTVGL 107

Query: 278 NSSKYYINDKESSFTQVTTLLKNEGIDLDHKRFLILQGEVENIAQMKPKSEKEGDDGLLE 337
              +Y IN+K SS + V  LL++ G    +   ++ QG + ++   K +         L+
Sbjct: 108 KKDEYMINNKNSSRSDVQRLLESAGFSTSNPYNIVPQGRIVSLTNAKDRER-------LQ 160

Query: 338 YLEDIIGTSHYKVQIEHNLSKVEA 361
            LE+++G   ++ +++ +L +++A
Sbjct: 161 LLEEVVGAKSFERKLKESLQRMDA 184

 Score = 41.2 bits (95), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 41/143 (28%), Positives = 67/143 (46%), Gaps = 13/143 (9%)

Query: 701 YGRLGDLGVIDEKY-DVAISTACPRLEDLVVDSVDCGQQCIDYLRKNRLGYARFILLDKL 759
           +G LG+L  + EKY   A       L  +VVD+ +     +  L  ++ G   F+ L+++
Sbjct: 533 FGPLGELIKVSEKYKTCAEVVGGNSLFHVVVDTENTASLIMQELYNSKGGRVTFMPLNRI 592

Query: 760 RKFNLNRIETPDN----APRLFDLIQVREDKFLPAFYSVLRDTLVATNLLHANKVAYGKR 815
             +    I+ P N       L   I+  + KF  A   V   T+V  +LL  +K+A   +
Sbjct: 593 --YVDPNIQYPSNEEYNCTPLIKKIKF-DGKFEKAVKHVFGKTIVVKDLLQGSKLA---K 646

Query: 816 RFRV--VTLDGKLIDISGTMSGG 836
           +F +  VTLDG   D  G ++GG
Sbjct: 647 QFNLNSVTLDGDKADNKGVLTGG 669

>KLTH0H09966g Chr8 complement(859362..863036) [3675 bp, 1224 aa]
           {ON} similar to uniprot|P47037 Saccharomyces cerevisiae
           YJL074C SMC3 Subunit of the multiprotein cohesin complex
           required for sister chromatid cohesion in mitotic cells
           also required with Rec8p for cohesion and recombination
           during meiosis phylogenetically conserved SMC
           chromosomal ATPase family member
          Length = 1224

 Score = 70.1 bits (170), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 49/202 (24%), Positives = 96/202 (47%), Gaps = 16/202 (7%)

Query: 165 LVIERLVLTNFKSYAGRQVVGPFHTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGK 224
           + I+ +V+  FK+Y     V      F+ ++G NGSGKSN   ++ FV     + +++ +
Sbjct: 1   MYIKSVVIQGFKTYKNTTSVEGLSPRFNVIIGGNGSGKSNFFAAVRFVLSDDYSNLKREE 60

Query: 225 LKDLIHKSEKYPELSSCSVEIHFQYVIDDPNGG---PSKIDESKEKLVVMRKAFKNNSSK 281
            + LIH+      + S  VEI F     DP+G     S I  ++E +V +R+       +
Sbjct: 61  RQGLIHQG--TGSVMSAYVEIIFH----DPSGQMMITSGIPMTEEHIVRVRRTIGLKKDE 114

Query: 282 YYINDKESSFTQVTTLLKNEGIDLDHKRFLILQGEVENIAQMKPKSEKEGDDGLLEYLED 341
           Y +N K    + ++ + ++ G    +   ++ QG +  +   K       D   L  LE+
Sbjct: 115 YSVNGKTCHKSDISRMFESVGFSAVNPYNIVPQGRIVAVTNAK-------DRERLALLEE 167

Query: 342 IIGTSHYKVQIEHNLSKVEALN 363
           ++G   +++++  +  K+EA N
Sbjct: 168 VVGAKSFEIKLRESAKKMEATN 189

 Score = 40.8 bits (94), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 51/208 (24%), Positives = 93/208 (44%), Gaps = 29/208 (13%)

Query: 701 YGRLGDLGVIDEKYD-VAISTACPRLEDLVVDSVDCGQQCIDYLRKNRLGYARFILLDKL 759
           +G LG+L  ++EKY   A +     L  +VVD+ +     ++ L   + G   FI L+++
Sbjct: 536 HGPLGELIKVNEKYKACAEAVGGNALLHVVVDTDETASILMEELYNTKAGRVTFIPLNRI 595

Query: 760 RKFNLNRIETPDNA-----PRLFDLIQVREDKFLPAFYSVLRDTLVATNLLHANKVAYGK 814
              + N +  PDN+     P ++ +    E +F  A   V   T+V  ++   +K+A   
Sbjct: 596 --ADSNPVTFPDNSQAECTPLIWKM--KYEKRFEKAVRHVFGRTIVVRDIGTGSKLA--- 648

Query: 815 RRFRV--VTLDGKLIDISGTMSGG-GNYVLRGLMKLGQDLPENDFEQTSPEEVQKLEREL 871
           + F +  VTLDG   D  G ++GG  +Y  R  +                +E+   +R+L
Sbjct: 649 KSFNLDAVTLDGDRTDKRGLITGGYHDYHKRNRLD-------------CLKEMSAAKRQL 695

Query: 872 EILEKNFKVAYNSLKEMNQEILHMKEQI 899
               KN   A   +  ++ EI  + ++I
Sbjct: 696 LEATKNLDAARGQITAIDTEIDQINDEI 723

>TBLA0C02740 Chr3 (656941..660300) [3360 bp, 1119 aa] {ON} Anc_1.295
            YJL074C
          Length = 1119

 Score = 69.3 bits (168), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 41/136 (30%), Positives = 74/136 (54%), Gaps = 4/136 (2%)

Query: 1262 LKKKRLEEFTTGFDIISLTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKS-- 1319
            LK++++      F+ +S    ++++ +   G  EL +      +S GV+  V    K+  
Sbjct: 955  LKEQKVNAVERTFNQVSENFSDIFEQLVPRGTGELVIGRQGQEYS-GVSIQVSFNSKNDE 1013

Query: 1320 WRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKDA 1379
               I  LSGG+KT+ ++AL+ A+ +  P P Y+ DEIDAALD      V+  IK  +++ 
Sbjct: 1014 QLQIEQLSGGQKTVCAIALILAIQQVDPAPFYLFDEIDAALDKEYRKSVSQVIKRLSQNG 1073

Query: 1380 -QLIVISLRNNMFELS 1394
             Q I+ + R++M E++
Sbjct: 1074 TQFILTTFRSDMIEIA 1089

>AAL182W Chr1 (16155..19850) [3696 bp, 1231 aa] {ON} Syntenic homolog
            of Saccharomyces cerevisiae YJL074C (SMC3)
          Length = 1231

 Score = 69.3 bits (168), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 34/96 (35%), Positives = 53/96 (55%), Gaps = 2/96 (2%)

Query: 1301 SLDPFSEGVTFSVM--PPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDA 1358
            S D    GV+  V     K    ++  LSGG+KT+ ++AL+ A+    P P Y+ DEIDA
Sbjct: 1099 SQDSIYSGVSIEVSFNSKKDEQVHVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDA 1158

Query: 1359 ALDFRNVSIVANYIKERTKDAQLIVISLRNNMFELS 1394
            ALD +  + VA  +K+ +  AQ I  + R +M  ++
Sbjct: 1159 ALDKQYRTAVAATVKQLSSQAQFICTTFRGDMIAVA 1194

 Score = 63.9 bits (154), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 46/201 (22%), Positives = 99/201 (49%), Gaps = 24/201 (11%)

Query: 165 LVIERLVLTNFKSYAGRQVVGPFHTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGK 224
           + I+++++  FK+Y  +  +  F  + + VVG NGSGKSN   ++ FV       +++ +
Sbjct: 1   MYIKKVIIRGFKTYKNKTEIDNFSPHHNVVVGFNGSGKSNFFAAIRFVLSDDYTNLKREE 60

Query: 225 LKDLIHKSEKYPELSSCSVEIHF-----QYVIDDPNGGPSKIDESKEKLVVMRKAFKNNS 279
            + LI++      + S  VEI F     + ++   +GG          ++ +R+      
Sbjct: 61  RRSLIYQG--TSSVMSGYVEIVFHGAENRTLLGAQDGG----------VIHIRRTVGLKK 108

Query: 280 SKYYINDKESSFTQVTTLLKNEGIDLDHKRFLILQGEVENIAQMKPKSEKEGDDGLLEYL 339
            +Y IN+K +S + V  LL++ G    +   ++ QG + ++   + +         L+ L
Sbjct: 109 DEYMINNKNASRSDVQRLLESAGFSTSNPYNIVPQGRIVSLTNAQNRER-------LQLL 161

Query: 340 EDIIGTSHYKVQIEHNLSKVE 360
           E++IG   ++ +++ +L K+E
Sbjct: 162 EEVIGAKSFERKLKESLQKME 182

>KNAG0B05230 Chr2 complement(1005244..1008921) [3678 bp, 1225 aa]
           {ON} Anc_1.295 YJL074C
          Length = 1225

 Score = 69.3 bits (168), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 50/196 (25%), Positives = 91/196 (46%), Gaps = 18/196 (9%)

Query: 165 LVIERLVLTNFKSYAGRQVVGPFHTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGK 224
           + I+R+V+  FK+Y    ++  F  + + V+G NGSGKSN   ++ FV     + +++ +
Sbjct: 1   MYIKRVVIKGFKTYRNETIIDNFSPHHNIVIGSNGSGKSNFFAAIRFVLSDDYSNLKREE 60

Query: 225 LKDLIHKSEKYPELSSCSVEIHF----QYVIDDPNGGPSKIDESKEKLVVMRKAFKNNSS 280
            + LIH+      + S SVEI F      +I      P   DE     V +R+       
Sbjct: 61  RQGLIHQGS--GSVMSASVEIVFHDPDHRIILSSGVIPRPNDE-----VFVRRTVGLKKD 113

Query: 281 KYYINDKESSFTQVTTLLKNEGIDLDHKRFLILQGEVENIAQMKPKSEKEGDDGLLEYLE 340
            Y IND+  + + +  +L++ G  +     ++ QG +  +   K K         L  LE
Sbjct: 114 DYQINDRNVTKSDLVRMLESAGFSMGSPYNIVPQGRIIALTNAKDKER-------LLLLE 166

Query: 341 DIIGTSHYKVQIEHNL 356
           D+IG   ++ ++  +L
Sbjct: 167 DVIGAKSFETKLRASL 182

 Score = 38.9 bits (89), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 38/141 (26%), Positives = 62/141 (43%), Gaps = 4/141 (2%)

Query: 699 GFYGRLGDLGVIDEKY-DVAISTACPRLEDLVVDSVDCGQQCIDYLRKNRLGYARFILLD 757
             +G LG+L  + EKY   A       L  +VVD+       +  L K + G   F+ L+
Sbjct: 534 AVFGTLGELLKVSEKYKTCAEVVGGNSLFHVVVDTDKTASLLMRELYKMKGGRVTFMPLN 593

Query: 758 KLRKFNLNRIETPDNAPRLFDLIQ-VRED-KFLPAFYSVLRDTLVATNLLHANKVAYGKR 815
           +L + +       D +     L++ ++ D KF  A   V   T+V  +L    K+A    
Sbjct: 594 RLHEDSGVTFPPQDQSAACTPLLKKIKYDAKFEKAVKHVFGKTIVVRDLTTGVKMAKS-Y 652

Query: 816 RFRVVTLDGKLIDISGTMSGG 836
           +   +TLDG   D  G ++GG
Sbjct: 653 QLNAITLDGDRADNRGVLTGG 673

>KNAG0L00630 Chr12 complement(93928..97254) [3327 bp, 1108 aa] {ON}
            Anc_7.101 YOL034W
          Length = 1108

 Score = 51.6 bits (122), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 50/192 (26%), Positives = 83/192 (43%), Gaps = 45/192 (23%)

Query: 1200 NELDIESLDAEIENLEEQLE---HSTANIEILEEYVRRLSEYKKRKS----DLDESISEK 1252
             + + E +  ++E LE ++    H  ++I IL+E  R+L++ K R       LD + +  
Sbjct: 875  GDFNTEYIGEQVERLESEIRMINHDESSIAILQEVERKLADVKARLPAMVRKLDAATASM 934

Query: 1253 ETAKEETE----VLKKKRLEEFTTGF------DIISLTLKEMYQ------MITMGGNAEL 1296
             T + E E     + +K  E FT  F        I L+   +YQ      M+    NA L
Sbjct: 935  STMQAELEPRLDTIVEKISERFTNLFTNVGSAGAIQLSKPHLYQEWEMKIMVKFRDNAPL 994

Query: 1297 ELVDSLDPFSEGVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEI 1356
            + +DS                         SGGE+ +S++  + AL ++   P  V+DEI
Sbjct: 995  KRLDS----------------------HTQSGGERAVSTVLYIIALQEFTSAPFRVVDEI 1032

Query: 1357 DAALDFRNVSIV 1368
            +  +D RN  IV
Sbjct: 1033 NQGMDQRNERIV 1044

 Score = 49.3 bits (116), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 43/162 (26%), Positives = 77/162 (47%), Gaps = 21/162 (12%)

Query: 167 IERLVLTNFKSYAGRQVVGPFHTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLK 226
           + RL L NF +Y+  +    F  + + VVGPNGSGKS ++ ++      R   +  G++K
Sbjct: 57  VVRLRLHNFVTYSLAEF--EFSPSLNMVVGPNGSGKSTLVCALCLGLAGRTEYL--GRMK 112

Query: 227 DLIHKSEKYPELSSCSVEIHFQYVIDDPNGGPSKIDESKEKLVVMRKAFKNN--SSKYYI 284
               +S+ + +  + S  I      +DP             L V R   +N+  +S YY+
Sbjct: 113 ----RSDSFIKNGADSARIDVWLAGEDPG----------TTLKVSRVLTRNHKKASLYYV 158

Query: 285 NDKESSFTQVTTLLKNE-GIDLDHKRFLILQGEVENIAQMKP 325
           +  E+S  +V  L+  +  I LD+    + Q  V+  A+++P
Sbjct: 159 DGVETSEQRVRQLVATQHNIQLDNLCQFLSQERVQEFARLRP 200

>SAKL0B09526g Chr2 (805816..809115) [3300 bp, 1099 aa] {ON} similar
           to uniprot|Q08204 Saccharomyces cerevisiae YOL034W SMC5
           Structural maintenance of chromosomes (SMC) protein
           interacts with Rhc18p and Nse1p to form a large complex
           S. pombe homolog forms a heterodimer with S. pombe
           Rad18p that is involved in DNA repair
          Length = 1099

 Score = 49.3 bits (116), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 42/162 (25%), Positives = 77/162 (47%), Gaps = 15/162 (9%)

Query: 167 IERLVLTNFKSYAGRQVVGPFH--TNFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQG 223
           I ++ L NF +YA    +  FH   + + ++GPNGSGKS  + ++      R   + R  
Sbjct: 48  IIKIRLKNFVTYA----LTEFHLSPSLNMIIGPNGSGKSTFVCAICLGLAGRPEYIGRSK 103

Query: 224 KLKDLIHKSEKYPELSSCSVEIHFQYVIDDPNGGPSKIDESKEKLVVMRKAFKNNS-SKY 282
           +++D I   E       C +EI  +   +    G + +  S + + + R   ++   S Y
Sbjct: 104 RVEDFIKNGE-----DECEIEITLKN--NSKIQGIANVLSSDDVIKITRVLIRHRKKSDY 156

Query: 283 YINDKESSFTQVTTLLKNEGIDLDHKRFLILQGEVENIAQMK 324
           +IND+ +S   V +++    I LD+    + Q  VE  A++K
Sbjct: 157 FINDRPASEGVVKSMILQLNIQLDNLCQFLSQERVEEFARLK 198

 Score = 43.1 bits (100), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 41/83 (49%), Gaps = 11/83 (13%)

Query: 1327 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KDAQLIV 1383
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q  +
Sbjct: 994  SGGERAVSTVLYMIALQEFTTAPFRVVDEINQGMDTRNERIVHKAMVENACAENTSQYFL 1053

Query: 1384 ISLRNNMFELSKQLVGIYKSENM 1406
            I+         K L G+Y  E M
Sbjct: 1054 IT--------PKLLTGLYYHEKM 1068

>Ecym_2625 Chr2 (1208550..1211843) [3294 bp, 1097 aa] {ON} similar
           to Ashbya gossypii AEL337
          Length = 1097

 Score = 47.8 bits (112), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 102/387 (26%), Positives = 167/387 (43%), Gaps = 69/387 (17%)

Query: 166 VIERLVLTNFKSYAGRQVVGPFH--TNFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQ 222
            I +L L NF +Y+    +  FH   + + ++GPNGSGKS+ + ++      +   + R 
Sbjct: 45  AIIKLRLVNFVTYS----LTEFHLSPSLNMIIGPNGSGKSSFVCAICLGLAGKPEYIGRA 100

Query: 223 GKLKDLIHKSEKYPELSSCSVEIHFQYVIDDPNGGPSKIDESKE----KLVVMRKAFKNN 278
            K++D I       E S   + +     +     G S I  S E    K V+M+   K  
Sbjct: 101 KKVEDFIKNG---TEESVIELTVKNSKAV----SGYSMIGGSDEVINIKTVIMKAKKK-- 151

Query: 279 SSKYYINDKESSFTQVTTLLKNEGIDLDHKRFLILQGEVENIAQMKP-----KSEKEGDD 333
              YYIN +     QV  L+    I LD+    + Q  VE  A++K      ++ +  D 
Sbjct: 152 -CIYYINGQSVGENQVKALVCLLNIQLDNLCQFLSQERVEEFARLKSDKLLEETIRSIDS 210

Query: 334 GLLEYLEDIIGTSHYKVQI----EHNLSKVEALNEICIEKENRFNIVEKEKDSLVDGKNE 389
            L+E L+ +      +V I    E N SK+E L            I+ KE    ++ +  
Sbjct: 211 TLVEKLDMLKDKQQEEVTIGRDVELNKSKLEKL------------IIRKES---LESQVR 255

Query: 390 ALKYLANEKNLV------LAKSKKYQHQLYIDNKKLTSTLAKITDAQENYDKELEKYSTI 443
           AL+    +KN +      L   +   H+L ++N K     +K     +++ K+ + +   
Sbjct: 256 ALEEYERKKNEIDIHKKLLPYVRVKNHKLQLNNLKKVYEQSK--QELKDFLKDKKPFKVA 313

Query: 444 SKELKNLQDEEITLNK----RLNETKKYEEKL---LSNQRKNNSELISTQEMIKNI---E 493
           S++L+ L DE   L K      N  K   +KL   LSNQR      IS Q++ K I    
Sbjct: 314 SEKLQLLSDESEGLKKIKEEEYNSLKTNHKKLIETLSNQR------ISIQDLKKKISYYR 367

Query: 494 KKKDNAEKLVNTTEKSITQTNNKLETL 520
            +++N  + V   E+ I+  N  LETL
Sbjct: 368 SRRENMRRKVEMAEQDISSRNKLLETL 394

 Score = 40.4 bits (93), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 28/100 (28%), Positives = 52/100 (52%), Gaps = 15/100 (15%)

Query: 1277 ISLTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNISNL--------SG 1328
            IS   ++++  + +G   E+ LV   D +SE      +  K  +R+++ L        SG
Sbjct: 941  ISTRFRKLF--LNVGSAGEVCLVKP-DLYSEWK----IEIKVKFRDVAELKKLDSHIQSG 993

Query: 1329 GEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIV 1368
            GE+ +S++  + +L ++   P  V+DEI+  +D RN  IV
Sbjct: 994  GERAVSTVLYMISLQEFTNAPFRVVDEINQGMDARNERIV 1033

>AEL337C Chr5 complement(14613..17906) [3294 bp, 1097 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL034W
           (SMC5)
          Length = 1097

 Score = 47.0 bits (110), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 49/181 (27%), Positives = 84/181 (46%), Gaps = 22/181 (12%)

Query: 172 LTNFKSYAGRQVVGPFHTNFS--AVVGPNGSGKSNVIDSMLFVFGFRANKM-RQGKLKDL 228
           LTNF +Y+    +  FH + S   ++GPNGSGKS  + ++      +   + R  +++D 
Sbjct: 51  LTNFVTYS----LAEFHMSPSLNMIIGPNGSGKSTFVCAICLGLAGKPEYIGRAKRVEDF 106

Query: 229 IHKSEKYPELSSCSVEIHFQYVIDDPNGGP--SKIDESKEKLVVMRKAFKNNSSKYYIND 286
           I         +  ++EI  +    + +G P  S  DE+     V+ KA +  +  YYIN 
Sbjct: 107 IKNG-----TAESTIEIQLRNS-RNVSGLPMISAEDEAINVRTVLMKARRKCA--YYING 158

Query: 287 KESSFTQVTTLLKNEGIDLDHKRFLILQGEVENIAQMKP-----KSEKEGDDGLLEYLED 341
           +  S  Q+  L+    I LD+    + Q  VE  A++K      ++ +  D  LL  LE 
Sbjct: 159 EPVSENQMRALVSMLNIQLDNLCQFLSQERVEEFARLKADKLLEQTVRSVDASLLGLLEQ 218

Query: 342 I 342
           +
Sbjct: 219 L 219

 Score = 39.3 bits (90), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 35/69 (50%), Gaps = 5/69 (7%)

Query: 1327 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFR-----NVSIVANYIKERTKDAQL 1381
            SGGE+ +S++  + AL  +   P  V+DEI+  +D R     + ++V N   E T    L
Sbjct: 992  SGGERAVSTVLYMIALQHFTNAPFRVVDEINQGMDTRYERIVHKAMVENACAENTSQYFL 1051

Query: 1382 IVISLRNNM 1390
            I   L  N+
Sbjct: 1052 ITPKLLTNL 1060

>ZYRO0G01584g Chr7 (120582..123848) [3267 bp, 1088 aa] {ON} similar
           to uniprot|Q08204 Saccharomyces cerevisiae YOL034W SMC5
           Structural maintenance of chromosomes (SMC) protein
           interacts with Rhc18p and Nse1p to form a large complex
           S. pombe homolog forms a heterodimer with S. pombe
           Rad18p that is involved in DNA repair
          Length = 1088

 Score = 47.0 bits (110), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 49/185 (26%), Positives = 87/185 (47%), Gaps = 22/185 (11%)

Query: 166 VIERLVLTNFKSYAGRQV-VGPFHTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGK 224
            I ++ L NF +Y   +  + P   + + ++GPNGSGKS  + ++      +   +++ K
Sbjct: 35  AIVKMRLENFVTYTLTEFDLSP---SLNMIIGPNGSGKSTFVCAVCLGLAGKPEFIKRSK 91

Query: 225 -LKDLIHKSEKYPELSSCSVEIHFQYVIDDPN--GGPSKIDESKEKLVVMRKAFKNNS-S 280
            ++D I   E        S+EI  +   + P   G P  +D   + + + R+  K+ S S
Sbjct: 92  RVEDFIKNGE-----DRGSIEITLK---NSPKVEGMPG-VDSEADTIKITRELIKSKSKS 142

Query: 281 KYYINDKESSFTQVTTLLKNEGIDLDHKRFLILQGEVENIAQMK-----PKSEKEGDDGL 335
           +Y IND+  S   V  L+    I LD+    + Q  VE  A++K      ++ +  D  L
Sbjct: 143 RYMINDRVVSEEDVRLLVSKLNIQLDNLCQFLSQERVEEFARLKSDKLLAETTRSIDAKL 202

Query: 336 LEYLE 340
           L+ LE
Sbjct: 203 LDVLE 207

 Score = 42.4 bits (98), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 30/103 (29%), Positives = 49/103 (47%), Gaps = 16/103 (15%)

Query: 1327 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRN-----VSIVANYIKERTKDAQL 1381
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN      S+V N   E T    L
Sbjct: 981  SGGERAVSTVLYMIALQEFTTAPFRVVDEINQGMDSRNERIVHKSMVENACAENTSQYFL 1040

Query: 1382 IVISLRNNMFELSKQ-----LVGIYKSENMTQSATLVNNDMLN 1419
            I   L  +++   K      + G +  + M +S      DM+N
Sbjct: 1041 ITPKLLTDLYYHEKMRVHCVMAGPWIPDPMKRS------DMIN 1077

>ZYRO0B12122g Chr2 (972611..975940) [3330 bp, 1109 aa] {ON} similar to
            uniprot|Q12749 Saccharomyces cerevisiae YLR383W RHC18
            Protein involved in structural maintenance of chromosomes
            required for interchromosomal and sister chromatid
            recombination
          Length = 1109

 Score = 46.6 bits (109), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 27/78 (34%), Positives = 40/78 (51%), Gaps = 3/78 (3%)

Query: 1311 FSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVAN 1370
            F + P  +  RN+  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N  I   
Sbjct: 997  FILTPNDEKARNVDTLSGGEKSFSQMALLLATWKPMRSRIIALDEFDVFMDQVNRQIGTK 1056

Query: 1371 YIKERTKD---AQLIVIS 1385
             I  + KD    Q I+I+
Sbjct: 1057 LILNKLKDIARTQTIIIT 1074

 Score = 40.4 bits (93), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 31/94 (32%), Positives = 49/94 (52%), Gaps = 14/94 (14%)

Query: 167 IERLVLTNFKSYAGRQV-VGPFHTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQG-K 224
           I+++VL NF  +   ++ +GP   NF  +VG NGSGKS ++ ++    G RA    +G  
Sbjct: 75  IKKVVLWNFMCHEHFELELGP-RLNF--IVGNNGSGKSAILTAITVGLGARAMDTNRGNS 131

Query: 225 LKDLIHKSEKYPELSSCSVEIHFQYVIDDPNGGP 258
           LKDLI +        S  + +H    +D+ N G 
Sbjct: 132 LKDLIREG-----CHSTKIRLH----LDNLNHGA 156

>KLLA0F07997g Chr6 complement(748561..751920) [3360 bp, 1119 aa]
           {ON} similar to uniprot|Q08204 YOL034W Saccharomyces
           cerevisiae YOL034W SMC5 Structural maintenance of
           chromosomes (SMC) protein, interacts with Rhc18p and
           Nse1p to form a large complex
          Length = 1119

 Score = 46.2 bits (108), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 49/189 (25%), Positives = 92/189 (48%), Gaps = 24/189 (12%)

Query: 166 VIERLVLTNFKSYAGRQVVGPFH--TNFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQ 222
            + +L LTNF +YA    +  FH   + + ++GPNGSGKS  + ++      +   + R 
Sbjct: 59  AVVKLKLTNFVTYA----LTEFHLSPSLNMIIGPNGSGKSTFVCAICLGLAGKPEYIGRS 114

Query: 223 GKLKDLIHKS--EKYPE--LSSCSVEIHFQYVIDDPNGGPSKIDESKEKLVVMRKAFKNN 278
            K+++ I     E   E  L + S  +H  + + + +     +    ++++ M K     
Sbjct: 115 KKVEEYIKNGTDEGVIEITLKNSSALLHSDFNMINTDDDVVHV----KRVLSMEK----K 166

Query: 279 SSKYYINDKESSFTQVTTLLKNEGIDLDHKRFLILQGEVENIAQMKP-----KSEKEGDD 333
            SKYYIN+K  +   V ++++   I LD+    + Q  VE  A++KP     ++ +  + 
Sbjct: 167 KSKYYINNKVVTEEVVKSMVRVLNIQLDNLCQFLSQERVEEFARLKPDTLLNETIRSIEA 226

Query: 334 GLLEYLEDI 342
           GLLE L ++
Sbjct: 227 GLLEKLSEL 235

 Score = 44.3 bits (103), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 35/128 (27%), Positives = 56/128 (43%), Gaps = 20/128 (15%)

Query: 1277 ISLTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNISNL--------SG 1328
            IS     ++  +   G  EL+  DS + +        +  K  +R+ S L        SG
Sbjct: 963  ISKKFSHLFAYVGSAGQVELKKPDSFNDW-------CIEIKVKFRDNSELQQLNPHVQSG 1015

Query: 1329 GEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVA-----NYIKERTKDAQLIV 1383
            GE+ +S++  + AL ++  +P  V+DEI+  +D  N  IV      N   E T    LI 
Sbjct: 1016 GERAVSTVLYMIALQQFTSSPFRVVDEINQGMDQTNERIVHRIMVENACAENTSQYFLIT 1075

Query: 1384 ISLRNNMF 1391
              L  N+F
Sbjct: 1076 PKLLTNLF 1083

>Kwal_26.7204 s26 complement(263266..266619) [3354 bp, 1117 aa] {ON}
           YOL034W - Protein required for cell viability [contig
           47] FULL
          Length = 1117

 Score = 45.8 bits (107), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 44/162 (27%), Positives = 75/162 (46%), Gaps = 18/162 (11%)

Query: 167 IERLVLTNFKSYAGRQVVGPFH--TNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGK 224
           I +L L NF +Y+    +  FH   + + ++GPNGSGKS  + ++      +   + +GK
Sbjct: 69  IVKLRLENFVTYS----LTEFHLSPSLNMIIGPNGSGKSTFVCAVCLGLAGKPEYIGRGK 124

Query: 225 LKDLIHKSEKYPELSSCSVEIHFQYVIDDPN--GGPSKIDESKEKLVVMRKAFKNNSSKY 282
             D   K+ +   L    +E+  +    DP   G    +D + +   V R  +    S+Y
Sbjct: 125 RVDSFIKNGENRGL----IEVTLK---RDPGRTGSFVAVDGTTK---VSRVLWVGKKSEY 174

Query: 283 YINDKESSFTQVTTLLKNEGIDLDHKRFLILQGEVENIAQMK 324
           Y+ND+  S   V  L+    I LD+    + Q  VE  A++K
Sbjct: 175 YLNDEPVSELTVKNLMGELNIQLDNLCQFLSQERVEEFARLK 216

 Score = 42.4 bits (98), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 36/69 (52%), Gaps = 5/69 (7%)

Query: 1327 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVA-----NYIKERTKDAQL 1381
            SGGE+ +S++  + AL ++   P  ++DEI+  +D RN  IV      N   E+T    L
Sbjct: 1012 SGGERAVSTVLYMIALQEFTSAPFRIVDEINQGMDTRNERIVHKAMVENACAEKTSQYIL 1071

Query: 1382 IVISLRNNM 1390
            +   L  N+
Sbjct: 1072 VTPKLLTNL 1080

>NCAS0I00570 Chr9 complement(90806..94093) [3288 bp, 1095 aa] {ON}
           Anc_7.101 YOL034W
          Length = 1095

 Score = 45.8 bits (107), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 59/231 (25%), Positives = 106/231 (45%), Gaps = 32/231 (13%)

Query: 167 IERLVLTNFKSYAGRQVVGPFHTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQGKL 225
           I ++ L NF +Y  R        + + ++GPNGSGKS  + ++      +   + R  ++
Sbjct: 38  IVKIKLQNFVTY--RLTEFNLSPSLNMIIGPNGSGKSTFVCAVCLGLAGKPEFIGRAKRV 95

Query: 226 KDLIHKSEKYPELSSCSVEIHFQYVIDDPNGGPSKID-----ESKEKLVVMRKAFKNNS- 279
            D I   E      +  +EI F    +DP    S ++       K+ L V R   ++ + 
Sbjct: 96  DDFIKNGE-----DTSRIEI-FLKNYEDPTELQSSLNLKFNLAGKDLLKVTRLIQRDGNK 149

Query: 280 --SKYYINDKESSFTQVTTLLKNEGIDLDHKRFLILQGEVENIAQMKP-----KSEKEGD 332
             S Y+INDK  +   +  L+K   I LD+    + Q  VE  A++K      ++ +  D
Sbjct: 150 CKSDYFINDKPVTENVIKNLVKFLNIQLDNLCQFLSQERVEEFARLKSDKLLVETVRSID 209

Query: 333 DGLLEYLEDIIGTSHYKVQIEHNLSKVEALNEICIEKENRFNIVEKEKDSL 383
             LL+ L+D+  + + +  +E         NE+ I K+ RFN +E +++ L
Sbjct: 210 AQLLQILDDLKSSQNDETTLE---------NEVDI-KQKRFNELETDRNKL 250

 Score = 41.6 bits (96), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 27/42 (64%)

Query: 1327 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIV 1368
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV
Sbjct: 990  SGGERAVSTVLYMIALQEFTSAPFRVVDEINQGMDARNERIV 1031

>TDEL0E01340 Chr5 complement(265681..269001) [3321 bp, 1106 aa] {ON}
            Anc_4.237 YLR383W
          Length = 1106

 Score = 45.8 bits (107), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 44/85 (51%), Gaps = 3/85 (3%)

Query: 1304 PFSEGVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFR 1363
            P  + + +++ P     RN+  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  
Sbjct: 987  PAKQLMIYTLTPNDNRPRNVDTLSGGEKSFSQMALLLATWKPMRSRIIALDEFDVFMDQV 1046

Query: 1364 NVSIVANYIKERTKD---AQLIVIS 1385
            N  +    I E+ K+    Q I+I+
Sbjct: 1047 NRKMGTRLILEKLKNNSRTQTIIIT 1071

>NCAS0J01390 Chr10 (242118..245408) [3291 bp, 1096 aa] {ON} Anc_4.237
          Length = 1096

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/68 (36%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 1321 RNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKD-- 1378
            RN+  LSGGEK+ S LAL+ A  K   + +  +DE D  +D  N  I    + ++ KD  
Sbjct: 992  RNVDTLSGGEKSFSQLALLLATWKPMRSRIIALDEFDVFMDQVNRRIGTTLVVKKLKDLA 1051

Query: 1379 -AQLIVIS 1385
              Q I+I+
Sbjct: 1052 RTQTIIIT 1059

 Score = 37.4 bits (85), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 39/65 (60%), Gaps = 5/65 (7%)

Query: 167 IERLVLTNFKSYAGRQV-VGPFHTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQG-K 224
           I+++ L NF  +   ++ +GP   NF  +VG NGSGKS ++ ++    G +A+   +G  
Sbjct: 64  IKKVSLRNFMCHENFELELGP-KLNF--IVGSNGSGKSAILTAITIALGAKASDTNRGNS 120

Query: 225 LKDLI 229
           LK+LI
Sbjct: 121 LKELI 125

>Skud_12.468 Chr12 (825378..828740) [3363 bp, 1120 aa] {ON} YLR383W
            (REAL)
          Length = 1120

 Score = 44.3 bits (103), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/68 (36%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 1321 RNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKD-- 1378
            RN+  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N  I    I ++ KD  
Sbjct: 1020 RNVDTLSGGEKSFSQMALLLATWKPMRSRIIALDEFDVFMDQVNRKIGTTLIVKKLKDIA 1079

Query: 1379 -AQLIVIS 1385
              Q I+I+
Sbjct: 1080 RTQTIIIT 1087

 Score = 38.5 bits (88), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 38/65 (58%), Gaps = 3/65 (4%)

Query: 167 IERLVLTNFKSYAGRQVVGPFHTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQG-KL 225
           I++++L NF  +   ++      NF  +VG NGSGKS ++ ++    G +A++  +G  L
Sbjct: 88  IKKVILRNFMCHEHFELELGSRLNF--IVGNNGSGKSAILTAITIGLGAKASETNRGSSL 145

Query: 226 KDLIH 230
           KDLI 
Sbjct: 146 KDLIR 150

>NDAI0J02180 Chr10 (529566..532892) [3327 bp, 1108 aa] {ON} Anc_4.237
            YLR383W
          Length = 1108

 Score = 44.3 bits (103), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 33/107 (30%), Positives = 51/107 (47%), Gaps = 15/107 (14%)

Query: 1294 AELELVDSLD--PFSEGVTFSVMPPK----------KSWRNISNLSGGEKTLSSLALVFA 1341
            A+L+   SL    F+  +TF +   K          +  RN+  LSGGEK+ S LAL+ A
Sbjct: 969  ADLDFRASLKVRKFTGNLTFQIAERKLDMLILTANDEKARNVDTLSGGEKSFSQLALLLA 1028

Query: 1342 LHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKD---AQLIVIS 1385
              K   + +  +DE D  +D  N  I    + ++ KD    Q I+I+
Sbjct: 1029 TWKPMRSRIIALDEFDVFMDQVNRRIGTTLVVKKLKDLLRTQTIIIT 1075

 Score = 41.6 bits (96), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 30/94 (31%), Positives = 51/94 (54%), Gaps = 14/94 (14%)

Query: 167 IERLVLTNFKSYAGRQV-VGPFHTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQG-K 224
           I++++L NF  +   ++ +GP   NF  +VG NGSGKS V+ ++    G +A+   +G  
Sbjct: 76  IKKVILRNFMCHEHFELDLGP-RLNF--IVGNNGSGKSAVLTAITIGLGAKASDTNRGNA 132

Query: 225 LKDLIHKSEKYPELSSCSVEIHFQYVIDDPNGGP 258
           +KDLI +        S  V +    V+D+ + GP
Sbjct: 133 MKDLIREG-----CYSAKVTL----VLDNSHAGP 157

>Smik_12.470 Chr12 (824001..827345) [3345 bp, 1114 aa] {ON} YLR383W
            (REAL)
          Length = 1114

 Score = 44.3 bits (103), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/68 (36%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 1321 RNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKD-- 1378
            RN+  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N  I    I ++ KD  
Sbjct: 1014 RNVDTLSGGEKSFSQMALLLATWKPMRSRIIALDEFDVFMDQVNRKIGTTLIVKKLKDIA 1073

Query: 1379 -AQLIVIS 1385
              Q I+I+
Sbjct: 1074 RTQTIIIT 1081

 Score = 38.9 bits (89), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 48/93 (51%), Gaps = 12/93 (12%)

Query: 167 IERLVLTNFKSYAGRQVVGPFHTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQG-KL 225
           I++++L NF  +   ++      NF  +VG NGSGKS ++ ++    G +A++  +G  L
Sbjct: 82  IKKVILRNFMCHEHFELELGSRLNF--IVGNNGSGKSAILTAITIGLGAKASETNRGSSL 139

Query: 226 KDLIHKSEKYPELSSCSVEIHFQYVIDDPNGGP 258
           KDLI +        S  + +H    +D+ N G 
Sbjct: 140 KDLIREG-----CYSAKITLH----LDNSNYGA 163

>Suva_10.500 Chr10 (850833..854180) [3348 bp, 1115 aa] {ON} YLR383W
            (REAL)
          Length = 1115

 Score = 44.3 bits (103), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/68 (36%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 1321 RNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKD-- 1378
            RN+  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N  I    I ++ KD  
Sbjct: 1015 RNVDTLSGGEKSFSQMALLLATWKPMRSRIIALDEFDVFMDQVNRKIGTTLIVKKLKDIA 1074

Query: 1379 -AQLIVIS 1385
              Q I+I+
Sbjct: 1075 RTQTIIIT 1082

 Score = 38.1 bits (87), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 38/64 (59%), Gaps = 3/64 (4%)

Query: 167 IERLVLTNFKSYAGRQVVGPFHTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQG-KL 225
           I++++L NF  +   ++      NF  +VG NGSGKS ++ ++    G +A++  +G  L
Sbjct: 83  IKKVILRNFMCHEHFELELGSRLNF--IVGNNGSGKSAILTAITIGLGAKASETNRGSSL 140

Query: 226 KDLI 229
           KDLI
Sbjct: 141 KDLI 144

>YLR383W Chr12 (885288..888632) [3345 bp, 1114 aa] {ON}  SMC6Component
            of the SMC5-SMC6 complex; this complex plays a key role
            in the removal of X-shaped DNA structures that arise
            between sister chromatids during DNA replication and
            repair; homologous to S. pombe rad18
          Length = 1114

 Score = 44.3 bits (103), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/68 (36%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 1321 RNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKD-- 1378
            RN+  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N  I    I ++ KD  
Sbjct: 1014 RNVDTLSGGEKSFSQMALLLATWKPMRSRIIALDEFDVFMDQVNRKIGTTLIVKKLKDIA 1073

Query: 1379 -AQLIVIS 1385
              Q I+I+
Sbjct: 1074 RTQTIIIT 1081

 Score = 38.5 bits (88), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 38/65 (58%), Gaps = 3/65 (4%)

Query: 167 IERLVLTNFKSYAGRQVVGPFHTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQG-KL 225
           I++++L NF  +   ++      NF  +VG NGSGKS ++ ++    G +A++  +G  L
Sbjct: 82  IKKVILRNFMCHEHFELELGSRLNF--IVGNNGSGKSAILTAITIGLGAKASETNRGSSL 139

Query: 226 KDLIH 230
           KDLI 
Sbjct: 140 KDLIR 144

>CAGL0H05071g Chr8 (486899..490231) [3333 bp, 1110 aa] {ON} similar to
            uniprot|Q12749 Saccharomyces cerevisiae YLR383w RHC18
          Length = 1110

 Score = 43.5 bits (101), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 40/76 (52%), Gaps = 3/76 (3%)

Query: 1313 VMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1372
            + P    +R +S  SGGEK+ S +AL+ A  +   + +  +DE D  +D  N  I +  I
Sbjct: 1007 LTPNDDRYREVSTFSGGEKSYSQMALLLATWRPMRSRIIALDEFDVFMDQVNRKIGSKLI 1066

Query: 1373 KERTKD---AQLIVIS 1385
             ++ KD    Q I+I+
Sbjct: 1067 VKKLKDIPNTQTIIIT 1082

 Score = 40.8 bits (94), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 39/65 (60%), Gaps = 5/65 (7%)

Query: 167 IERLVLTNFKSYAGRQV-VGPFHTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQG-K 224
           I++L L NF  +    V +GP   NF  +VG NGSGKS ++ ++    G +A++  +G  
Sbjct: 80  IKKLTLHNFMCHRNFDVELGP-GLNF--IVGKNGSGKSAILTAITIGLGAKASETNRGSS 136

Query: 225 LKDLI 229
           LKDLI
Sbjct: 137 LKDLI 141

>Ecym_5344 Chr5 (696147..699455) [3309 bp, 1102 aa] {ON} similar to
           Ashbya gossypii AER044W
          Length = 1102

 Score = 43.1 bits (100), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 39/65 (60%), Gaps = 5/65 (7%)

Query: 167 IERLVLTNFKSYAGRQV-VGPFHTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQG-K 224
           I+R+ L NF  +   ++  GP   NF  +VG NGSGKS ++ ++  VFG +A+   +G  
Sbjct: 62  IKRITLKNFMCHEHFELEFGPM-LNF--IVGSNGSGKSAILTAITIVFGAKASDTNRGTS 118

Query: 225 LKDLI 229
           LK LI
Sbjct: 119 LKSLI 123

 Score = 35.0 bits (79), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 33/68 (48%), Gaps = 3/68 (4%)

Query: 1321 RNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKD-- 1378
            RN+  LSGGEK+ S + L+ +        +  +DE D  +D  N +I    I ++     
Sbjct: 1001 RNVDTLSGGEKSFSQITLLLSTWSTMRARVIALDEFDVFMDQVNRTIGTKMIMKKLSSNI 1060

Query: 1379 -AQLIVIS 1385
              Q I+I+
Sbjct: 1061 RTQTIIIT 1068

>Skud_15.121 Chr15 (218825..222106) [3282 bp, 1093 aa] {ON} YOL034W
            (REAL)
          Length = 1093

 Score = 43.1 bits (100), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 27/96 (28%), Positives = 45/96 (46%), Gaps = 11/96 (11%)

Query: 1327 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KDAQLIV 1383
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q  +
Sbjct: 987  SGGERAVSTVLYMIALQEFTSAPFRVVDEINQGMDSRNERIVHKAMVENACAENTSQYFL 1046

Query: 1384 ISLRNNMFELSKQLVGIYKSENMTQSATLVNNDMLN 1419
            I+         K L G+Y  E M     +  + + N
Sbjct: 1047 IT--------PKLLTGLYYHEKMRVHCVMAGSWIPN 1074

>TDEL0H03490 Chr8 (578645..581956) [3312 bp, 1103 aa] {ON} Anc_7.101
            YOL034W
          Length = 1103

 Score = 42.7 bits (99), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 27/85 (31%), Positives = 39/85 (45%), Gaps = 15/85 (17%)

Query: 1327 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRN-----VSIVANYIKERTKDAQL 1381
            SGGE+ +S++  + AL +Y   P  ++DEI+  +D  N      S+V N   E T    L
Sbjct: 998  SGGERAVSTVLYMIALQQYTTAPFRIVDEINQGMDSHNERIVHKSMVINACAENTSQYFL 1057

Query: 1382 IVISLRNNMFELSKQLVGIYKSENM 1406
            I   L          L G+Y  E M
Sbjct: 1058 ITPKL----------LTGLYYHEKM 1072

 Score = 34.3 bits (77), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 39/162 (24%), Positives = 72/162 (44%), Gaps = 17/162 (10%)

Query: 169 RLVLTNFKSYAGRQVVGPF--HTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQGKL 225
           +L + NF +Y     V  F    + + ++GPNGSGKS  + ++      +   + R  KL
Sbjct: 48  KLRMENFVTYK----VAEFDLSPSLNMIIGPNGSGKSTFVCAVCIGLAGKPRFIGRSSKL 103

Query: 226 KDLIHKSEKYPELSSCSVEIHFQYVIDDPNGGPSKIDESKEKLVVMRKAFKNN--SSKYY 283
           +D I   E+        VE+  +   +  +   S I +S ++++ + +    +   S Y 
Sbjct: 104 EDFIKNGEE-----KGLVEVTLKKPAEVEH---SPIVKSHDQVIKITRHLSRSKRDSDYQ 155

Query: 284 INDKESSFTQVTTLLKNEGIDLDHKRFLILQGEVENIAQMKP 325
           IND E   + V +++    I LD+    + Q  V + A   P
Sbjct: 156 INDIEVPESLVKSIISQLNIQLDNLCQFLSQERVASFAGQSP 197

>KLLA0E05303g Chr5 complement(472583..475879) [3297 bp, 1098 aa] {ON}
            similar to uniprot|Q12749 Saccharomyces cerevisiae
            YLR383W RHC18 Protein involved in structural maintenance
            of chromosomes required for interchromosomal and sister
            chromatid recombination
          Length = 1098

 Score = 42.7 bits (99), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 29/92 (31%), Positives = 46/92 (50%), Gaps = 7/92 (7%)

Query: 1321 RNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI-----KER 1375
            RN+  LSGGEK+ S +AL+ A      + +  +DE D  +D  N  I  N I     K+ 
Sbjct: 997  RNVDTLSGGEKSFSQIALLLATWLTMRSRIIALDEFDVFMDQVNRKIGTNLIIRRLGKDV 1056

Query: 1376 TKDAQLIVISLRN--NMFELSKQLVGIYKSEN 1405
              D Q I+I+ ++   M  +  +   I+K +N
Sbjct: 1057 KSDTQTIIITPQDIGKMANIDDKYFNIHKMKN 1088

 Score = 39.7 bits (91), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 38/65 (58%), Gaps = 5/65 (7%)

Query: 167 IERLVLTNFKSYAGRQV-VGPFHTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQG-K 224
           I+ + LTNF  ++   + +GP   NF  +VG NGSGKS ++ ++    G +A    +G  
Sbjct: 64  IKEIKLTNFMCHSNFSLRLGP-RLNF--IVGNNGSGKSAILTAITIGLGAKATTTNRGTS 120

Query: 225 LKDLI 229
           LKDLI
Sbjct: 121 LKDLI 125

>Kpol_483.10 s483 (21646..25002) [3357 bp, 1118 aa] {ON}
           (21646..25002) [3357 nt, 1119 aa]
          Length = 1118

 Score = 42.7 bits (99), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 44/82 (53%), Gaps = 8/82 (9%)

Query: 167 IERLVLTNFKSYAGRQVVGPFHTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQG-KL 225
           I +++L NF  +    V    + NF  +VG NGSGKS ++ +++   G +A++  +G  L
Sbjct: 73  IRKVILRNFMCHENFSVELTPNLNF--IVGNNGSGKSAILTAIIVALGVKASETSRGSSL 130

Query: 226 KDLIHKSEKYPELSSCSVEIHF 247
           K+LI K       +S  V +H 
Sbjct: 131 KELIRKG-----CNSSKVTLHL 147

 Score = 39.7 bits (91), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 1321 RNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKD-- 1378
            R++  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N ++    I ++  D  
Sbjct: 1018 RSVDTLSGGEKSFSQMALLLATWKPMKSRIIALDEFDVFMDQVNRTVGIKLIIKKLHDLY 1077

Query: 1379 -AQLIVIS 1385
              Q I+I+
Sbjct: 1078 KTQTIIIT 1085

>TBLA0I02890 Chr9 (683688..686984) [3297 bp, 1098 aa] {ON} Anc_4.237
            YLR383W
          Length = 1098

 Score = 42.0 bits (97), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 37/71 (52%), Gaps = 3/71 (4%)

Query: 1318 KSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTK 1377
            K  RN+  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N       I ++ K
Sbjct: 995  KEPRNVDTLSGGEKSFSQIALLLATWKPMRSRIIALDEYDVFMDQVNRKTSTQLIVQKLK 1054

Query: 1378 D---AQLIVIS 1385
            D    Q I+I+
Sbjct: 1055 DDSRTQTIIIT 1065

 Score = 40.4 bits (93), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 39/65 (60%), Gaps = 5/65 (7%)

Query: 167 IERLVLTNFKSYAGRQV-VGPFHTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQG-K 224
           I+++ L NF  +   ++ +GP   NF  +VG NGSGKS ++ ++    G +AN   +G  
Sbjct: 71  IKKIKLVNFMCHEHFELTLGP-RLNF--IVGNNGSGKSAILTAITIGLGAKANSTNRGNS 127

Query: 225 LKDLI 229
           LKDLI
Sbjct: 128 LKDLI 132

>TBLA0E02190 Chr5 complement(534078..537347) [3270 bp, 1089 aa] {ON}
            Anc_7.101 YOL034W
          Length = 1089

 Score = 42.0 bits (97), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 24/69 (34%), Positives = 35/69 (50%), Gaps = 5/69 (7%)

Query: 1327 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSI-----VANYIKERTKDAQL 1381
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  I     V N   E T    L
Sbjct: 984  SGGERAVSTVLYMIALQEFTSAPFRVVDEINQGMDSRNERIIHKAMVENACAENTSQYFL 1043

Query: 1382 IVISLRNNM 1390
            I   L  N+
Sbjct: 1044 ITPKLLTNL 1052

>Suva_15.133 Chr15 (232441..235719) [3279 bp, 1092 aa] {ON} YOL034W
            (REAL)
          Length = 1092

 Score = 42.0 bits (97), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 53/202 (26%), Positives = 90/202 (44%), Gaps = 29/202 (14%)

Query: 1204 IESLDAEIENLEEQLEHSTANIEILEEYVRRLSEYKK----RKSDLDESISEKETAKEET 1259
            I+ L++EI      + H  + I IL++ V  L E ++    +  DL+ +   K   KE+ 
Sbjct: 870  IDKLESEIA----MVNHDESAITILDQVVTELRELEQIVPQQTKDLEIT---KAKLKEDH 922

Query: 1260 EVLKKKRLEEFTTGFDIISLTLKEMYQMITMGGNAELELVDSLDPFSEG-----VTFSVM 1314
             +L+ K L+E  +    IS     ++  +   G   LE       ++E      V F   
Sbjct: 923  AILEPK-LDEIVSK---ISTRFARLFNNVGSAGAVHLE---KPKDYAEWKIEVMVKFRDN 975

Query: 1315 PPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVA----- 1369
             P K   + +  SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV      
Sbjct: 976  APLKKLDSHTQ-SGGERAVSTVLYMIALQEFTSAPFRVVDEINQGMDSRNERIVHKAMVE 1034

Query: 1370 NYIKERTKDAQLIVISLRNNMF 1391
            N   E T    LI   L  +++
Sbjct: 1035 NACAENTSQYFLITPKLLTDLY 1056

 Score = 36.2 bits (82), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 40/162 (24%), Positives = 76/162 (46%), Gaps = 16/162 (9%)

Query: 190 NFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQGKLKDLIHKSEKYPELSSCSVEIHFQ 248
           + + ++GPNGSGKS  + ++      +   + R  K++D I   +      +  +EI  +
Sbjct: 63  SLNMIIGPNGSGKSTFVCAVCLGLAGKPEYIGRSKKVEDFIKNGQ-----DTSRIEITLK 117

Query: 249 YVIDDPNGGPSK-IDESKEKLVVMRKAFKN-NSSKYYINDKESSFTQVTTLLKNEGIDLD 306
              + P     + I+   E + V R   ++   S Y IND++ S   V TL+    I LD
Sbjct: 118 ---NSPKIHDIEFINTHDETIKVTRIITRSKRRSDYLINDEQVSENVVKTLVAQLNIQLD 174

Query: 307 HKRFLILQGEVENIAQMKP-----KSEKEGDDGLLEYLEDII 343
           +    + Q  VE  A++K      ++ +  D  LL+ L++++
Sbjct: 175 NLCQFLSQERVEEFARLKSVKLLVETIRSIDASLLDVLDELM 216

>TPHA0L00600 Chr12 complement(102317..105670) [3354 bp, 1117 aa] {ON}
            Anc_7.101 YOL034W
          Length = 1117

 Score = 41.6 bits (96), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 36/70 (51%), Gaps = 5/70 (7%)

Query: 1327 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRN-----VSIVANYIKERTKDAQL 1381
            SGGEK +S++  + AL ++   P  V+DEI+  +D RN      S+V N   + T    L
Sbjct: 1012 SGGEKAVSTVFYMIALQEFTIAPFRVVDEINQGMDPRNEKIVHQSMVENACADNTSQYFL 1071

Query: 1382 IVISLRNNMF 1391
            I   L   +F
Sbjct: 1072 ITPKLLTGLF 1081

 Score = 32.7 bits (73), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 95/367 (25%), Positives = 165/367 (44%), Gaps = 53/367 (14%)

Query: 167 IERLVLTNFKSYAGRQV-VGPFHTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQGK 224
           I ++ L NF +Y   +  + P   + + ++GPNGSGKS  + ++      +   + R   
Sbjct: 66  IIKIKLHNFVTYEFTEFDLSP---SLNMIIGPNGSGKSTFVCAVCLGLAGKPEYIGRSRN 122

Query: 225 LKDLIHKSEKYPELSSCSVEIHFQYVIDDPNGGPSKIDESKEKLVVMRKAFKNNS-SKYY 283
           + D I   E++ E+    + +     I D  G    + E  + + + R   ++   S+Y 
Sbjct: 123 VDDYIKNDEEHGEIE---ITLKNSEAIHDVEG----VLEGSDTITITRILTRSKKKSEYK 175

Query: 284 INDKESSFTQVTTLLKNEGIDLDHKRFLILQGEVENIAQMKPKSEKEGDDGLLEYLEDII 343
           IND   +   V  L+    I LD+    + Q  VE  A++K  SE+     LLE  E + 
Sbjct: 176 INDSLVTEATVKELVSLLNIQLDNLCQFLSQERVEEFARLK--SER-----LLE--ETVR 226

Query: 344 GTSHYKVQIEHNLSKVEALNEICIEKENRFNIVEKEKDSLVDGKNEALKYLANEKNL--- 400
                 + I +NL +++   E+ I+ E     V  + + L   +    KY   EK++   
Sbjct: 227 SIDPSLLTILNNLKELQT-TELDIQTE-----VTNDNNKLGSLRKRREKY---EKSVASY 277

Query: 401 -VLAKSKKYQHQLYIDNKKLTSTLAKITDAQENYDKELEKYSTISKELKNLQDEEITLNK 459
            V  K+K   H L ++ K L    AK+ + ++ +    E+Y    K+LK LQ ++   N+
Sbjct: 278 EVFNKTK---HSLQVNTKLLP--YAKVNEYKDQFKSLKEEYKAAKKKLKALQQDKEPFNR 332

Query: 460 RLNETKKYEEKLLSNQRKNNSELISTQEMIKNIEKKKDN---AEKLVNTTEKSITQTNNK 516
              E    E KL+  +R+ +S LIS Q       K KDN   A K +N  ++SI     +
Sbjct: 333 ---EKDILERKLIDTERRTSSTLISFQ-------KAKDNLKLATKDLNDIQESIHTKKKQ 382

Query: 517 LETLNNQ 523
           +E   N+
Sbjct: 383 IEYYKNR 389

>KAFR0D01330 Chr4 complement(263879..267121) [3243 bp, 1080 aa] {ON}
            Anc_7.101 YOL034W
          Length = 1080

 Score = 41.6 bits (96), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 38/77 (49%), Gaps = 5/77 (6%)

Query: 1327 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVA-----NYIKERTKDAQL 1381
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV      N   E T    L
Sbjct: 975  SGGERAVSTVLYMIALQEFTAAPFRVVDEINQGMDQRNERIVHRAMVENACAENTSQYFL 1034

Query: 1382 IVISLRNNMFELSKQLV 1398
            I   L  +++   K  V
Sbjct: 1035 ITPKLLTDLYYHEKMAV 1051

 Score = 40.8 bits (94), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 48/184 (26%), Positives = 83/184 (45%), Gaps = 28/184 (15%)

Query: 167 IERLVLTNFKSYAGRQV-VGPFHTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQGK 224
           I +L L N  +Y+  +  + P   + + +VGPNGSGKS  + ++      +   + R  K
Sbjct: 37  IVKLRLQNVMTYSITEFNLSP---SLNMLVGPNGSGKSTFVCAVCLGLAGKPEYIGRSKK 93

Query: 225 LKDLIHKSEKYPELSSCSVEIHFQYVIDDPNGGPSKIDESKEKLVVMRKAFKNNS-SKYY 283
           + + I   E   ++ +  +  H       PN          E + + R   +N   S+YY
Sbjct: 94  IDNFIKNGENTAQIDTF-LRGHM------PN----------EVIKITRIMTRNKKKSEYY 136

Query: 284 INDKESSFTQVTTLLKNEGIDLDHKRFLILQGEVENIAQMKP-----KSEKEGDDGLLEY 338
           I+D  S+ T V  L     I LD+    + Q  VE+ A++K      ++ +  +  LLE 
Sbjct: 137 IDDSPSTETAVRKLASELNIQLDNLCQFLSQEHVEDFAKLKSDKLLIETIRSINPSLLET 196

Query: 339 LEDI 342
           LED+
Sbjct: 197 LEDL 200

>NDAI0A08450 Chr1 (1947452..1950811) [3360 bp, 1119 aa] {ON} Anc_7.101
            YOL034W
          Length = 1119

 Score = 41.6 bits (96), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 27/42 (64%)

Query: 1327 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIV 1368
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV
Sbjct: 1014 SGGERAVSTVLYMIALQEFTAAPFRVVDEINQGMDSRNERIV 1055

 Score = 37.0 bits (84), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 54/227 (23%), Positives = 95/227 (41%), Gaps = 32/227 (14%)

Query: 167 IERLVLTNFKSYAGRQV-VGPFHTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQGK 224
           I ++ L NF +Y   +  + P   + + ++GPNGSGKS  + +       +   + R  +
Sbjct: 52  IVKIKLENFVTYKLTEFNLSP---SLNMIIGPNGSGKSTFVCAACLGLAGKPEYIGRSKR 108

Query: 225 LKDLIHKSEKYPELSSCSVEIHFQYV--------------IDDPNGGPSKIDESKEKLVV 270
           + D I   E         +EI  + V               ++ NG    +   +  L+ 
Sbjct: 109 VDDYIKNGE-----DRSKIEIFLKNVESMDKLKNFNNNNNKNNNNGAQVDLKCGQLDLIK 163

Query: 271 MRKAFKNNSSK--YYINDKESSFTQVTTLLKNEGIDLDHKRFLILQGEVENIAQMKP--- 325
             +    +  K  YYINDK  S   V  L+K   I LD+    + Q  VE  A++K    
Sbjct: 164 FTRIIHRDKKKSDYYINDKPVSELTVKNLVKALSIQLDNLCQFLSQERVEEFARLKSDKL 223

Query: 326 --KSEKEGDDGLLEYLEDIIGTSHYKVQIEHNLS-KVEALNEICIEK 369
             ++ +  D  LL+ LE++    + +  +E  L  K +   E+C E+
Sbjct: 224 LVETVRSIDPNLLDILEELKVLQNEEQTVEDELEIKQKRYTELCNER 270

>AER044W Chr5 (714355..717666) [3312 bp, 1103 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR383W (RHC18)
          Length = 1103

 Score = 41.2 bits (95), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 39/65 (60%), Gaps = 5/65 (7%)

Query: 167 IERLVLTNFKSYAGRQV-VGPFHTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQG-K 224
           ++R+ L NF  +   ++  GP   NF  +VG NGSGKS ++ ++  VFG +A+   +G  
Sbjct: 62  MKRITLKNFMCHEHFELEFGP-RLNF--IVGSNGSGKSAILTAITVVFGAKASDTNRGVS 118

Query: 225 LKDLI 229
           LK LI
Sbjct: 119 LKSLI 123

 Score = 35.4 bits (80), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 26/52 (50%)

Query: 1321 RNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1372
            RN+  LSGGEK+ S + L+ +        +  +DE D  +D  N +I    I
Sbjct: 1002 RNVDTLSGGEKSFSQITLLLSTWSTMRARIIALDEFDVFMDQVNRTIGTRMI 1053

>Smik_15.131 Chr15 (226115..229396) [3282 bp, 1093 aa] {ON} YOL034W
            (REAL)
          Length = 1093

 Score = 40.8 bits (94), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 27/42 (64%)

Query: 1327 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIV 1368
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV
Sbjct: 987  SGGERAVSTVLYMIALQEFTSAPFRVVDEINQGMDSRNERIV 1028

 Score = 35.8 bits (81), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 36/159 (22%), Positives = 73/159 (45%), Gaps = 12/159 (7%)

Query: 190 NFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQGKLKDLIHKSEKYPELSSCSVEIHFQ 248
           + + ++GPNGSGKS  + ++      +   + R  +++D I   +   ++S   + +   
Sbjct: 63  SLNMIIGPNGSGKSTFVCAVCLGLAGKPEYIGRSKRVEDFIKNGQ---DVSRIEITLKNS 119

Query: 249 YVIDDPNGGPSKIDESKEKLVVMRKAFKNNSSKYYINDKESSFTQVTTLLKNEGIDLDHK 308
             ++D     +  +  K   ++ R   +   S Y IND E S + V  L+    I LD+ 
Sbjct: 120 PKVNDIENVNAHDETIKITRIITRSKRR---SDYLINDCEVSESVVKALVAQLNIQLDNL 176

Query: 309 RFLILQGEVENIAQMKP-----KSEKEGDDGLLEYLEDI 342
              + Q  VE  A++K      ++ +  D  LL+ L+++
Sbjct: 177 CQFLSQERVEEFARLKSVKLLVETIRSIDSSLLDVLDEL 215

>YOL034W Chr15 (259923..263204) [3282 bp, 1093 aa] {ON}  SMC5Component
            of the SMC5-SMC6 complex; this complex plays a key role
            in the removal of X-shaped DNA structures that arise
            between sister chromatids during DNA replication and
            repair; binds single-stranded DNA and has ATPase
            activity; S. pombe homolog forms a heterodimer with S.
            pombe Rad18p that is involved in DNA repair
          Length = 1093

 Score = 40.8 bits (94), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 27/42 (64%)

Query: 1327 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIV 1368
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV
Sbjct: 987  SGGERAVSTVLYMIALQEFTSAPFRVVDEINQGMDSRNERIV 1028

 Score = 39.3 bits (90), Expect = 0.098,   Method: Compositional matrix adjust.
 Identities = 37/138 (26%), Positives = 64/138 (46%), Gaps = 11/138 (7%)

Query: 190 NFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQGKLKDLIHKSEKYPELSSCSVEIHFQ 248
           + + ++GPNGSGKS  + ++      +   + R  K++D I   +   +     +EI  +
Sbjct: 63  SLNMIIGPNGSGKSTFVCAVCLGLAGKPEYIGRSKKVEDFIKNGQDVSK-----IEITLK 117

Query: 249 YVIDDPN-GGPSKIDESKEKLVVMRKAFKN-NSSKYYINDKESSFTQVTTLLKNEGIDLD 306
              + PN      ID   E + + R   ++   S Y IND + S + V TL+    I LD
Sbjct: 118 ---NSPNVTDIEYIDARDETIKITRIITRSKRRSDYLINDYQVSESVVKTLVAQLNIQLD 174

Query: 307 HKRFLILQGEVENIAQMK 324
           +    + Q  VE  A++K
Sbjct: 175 NLCQFLSQERVEEFARLK 192

>TPHA0B00840 Chr2 complement(194812..198171) [3360 bp, 1119 aa] {ON}
            Anc_4.237 YLR383W
          Length = 1119

 Score = 40.8 bits (94), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 1321 RNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKD-- 1378
            R I NLSGGEK+ + +AL+ A  K   + +  +DE D  +D  N  I    + ++ K+  
Sbjct: 1019 RTIDNLSGGEKSFAQMALLLATWKPMRSRIIALDEFDVFMDQVNRKIGTGLLVKKLKNQT 1078

Query: 1379 -AQLIVIS 1385
              Q I+I+
Sbjct: 1079 RTQTIIIT 1086

 Score = 37.4 bits (85), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 38/65 (58%), Gaps = 5/65 (7%)

Query: 167 IERLVLTNFKSYAGRQV-VGPFHTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQG-K 224
           I+++ L NF  +   ++  GP   NF  +VG NGSGKS V+ ++    G +A+   +G  
Sbjct: 85  IKKIKLRNFMCHENFEMEFGP-RLNF--IVGNNGSGKSAVLTAITIGLGAKASDTNRGNS 141

Query: 225 LKDLI 229
           LKDLI
Sbjct: 142 LKDLI 146

>KAFR0A06040 Chr1 complement(1222239..1225547) [3309 bp, 1102 aa]
           {ON} Anc_4.237 YLR383W
          Length = 1102

 Score = 40.4 bits (93), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 33/125 (26%), Positives = 63/125 (50%), Gaps = 14/125 (11%)

Query: 167 IERLVLTNFKSYAGRQV-VGPFHTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQG-K 224
           +++++L NF  +   ++ +GP   NF  +VG NGSGKS ++ ++    G +A++  +G  
Sbjct: 72  LKKVILRNFMCHENFEMELGP-RLNF--IVGNNGSGKSAILTAIAVGLGVKASETNRGVS 128

Query: 225 LKDLIHKSEKYPELSSCSVEIHFQYVIDDPNGGPSKIDESKEKLVVMRKAFKNNSSKYYI 284
           LKDLI +        S S +I     +D+   G  K D   + +++ R   ++    + +
Sbjct: 129 LKDLIRE-------GSYSAKITL--YLDNSRIGSYKSDVYGDTIIIERTLKRDGPPSFSL 179

Query: 285 NDKES 289
             KE 
Sbjct: 180 KTKEG 184

 Score = 39.3 bits (90), Expect = 0.096,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 35/68 (51%), Gaps = 3/68 (4%)

Query: 1321 RNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKD-- 1378
            R++  LSGGEK+ S +AL+ A      + +  +DE D  +D  N  I    I +  KD  
Sbjct: 1002 RDVDTLSGGEKSFSQMALLLATWAPMRSRITALDEFDVFMDQVNRKIGTGLIVKTLKDNA 1061

Query: 1379 -AQLIVIS 1385
              Q I+I+
Sbjct: 1062 RTQTIIIT 1069

>KLTH0D02816g Chr4 complement(272310..275594) [3285 bp, 1094 aa]
           {ON} similar to uniprot|Q08204 Saccharomyces cerevisiae
           YOL034W SMC5 Structural maintenance of chromosomes (SMC)
           protein interacts with Rhc18p and Nse1p to form a large
           complex S. pombe homolog forms a heterodimer with S.
           pombe Rad18p that is involved in DNA repair
          Length = 1094

 Score = 40.4 bits (93), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 45/165 (27%), Positives = 73/165 (44%), Gaps = 23/165 (13%)

Query: 167 IERLVLTNFKSYAGRQVVGPFHTNFS--AVVGPNGSGKSNVIDSMLFVFGFRANKM-RQG 223
           I  L L NF +YA    +  FH + S   ++GPNGSGKS  + ++      +   + R  
Sbjct: 47  IVTLRLENFVTYA----LTEFHMSPSLNMIIGPNGSGKSTFVCAVCLGLAGKPEYIGRST 102

Query: 224 KLKDLIHKSEKYPELSSC---SVEIHFQYVIDDPNGGPSKIDESKEKLVVMRKAFKNN-S 279
           K++D I   E    +        E   +YV  D   G +K         V R   +N  +
Sbjct: 103 KIEDYIKNGEDRSVIEVTLKRDPEAEDRYVASD---GTTK---------VTRVLHRNRKA 150

Query: 280 SKYYINDKESSFTQVTTLLKNEGIDLDHKRFLILQGEVENIAQMK 324
           S+Y++N +  + + V  L+    I LD+    + Q  VE  A++K
Sbjct: 151 SEYFLNGQSVTESAVKRLVSELNIQLDNLCQFLSQERVEEFARLK 195

 Score = 38.5 bits (88), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 25/42 (59%)

Query: 1327 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIV 1368
            SGGE+ +S++  + AL      P  V+DEI+  +D RN  IV
Sbjct: 989  SGGERAVSTVLYMIALQDVTSAPFRVVDEINQGMDSRNERIV 1030

>TBLA0I00910 Chr9 complement(170526..173945) [3420 bp, 1139 aa] {ON}
            Anc_7.441 YBL105C
          Length = 1139

 Score = 40.0 bits (92), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 30/92 (32%), Positives = 47/92 (51%), Gaps = 7/92 (7%)

Query: 1130 LTIREISQNLESFDERLEKYDISKN--GATEDTQHTSSALNSVSNINTDTMDIDSTDNEI 1187
            + IRE  QN++  +E L+K+ ++ N  G+T D  H SS     SN NT+T       + I
Sbjct: 40   MNIREAQQNIKYLEETLQKFQLTSNDQGSTTDPTHISS-----SNGNTNTAKGYGQLSTI 94

Query: 1188 NPGIKRLSELEINELDIESLDAEIENLEEQLE 1219
                   S L++ + D  SL   I+ + +QLE
Sbjct: 95   GKNENTYSRLDLVKYDCPSLAQRIQYMLQQLE 126

>KNAG0B06010 Chr2 (1178430..1181783) [3354 bp, 1117 aa] {ON} Anc_4.237
            YLR383W
          Length = 1117

 Score = 40.0 bits (92), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 1321 RNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKD-- 1378
            R++  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N  I    I ++ K+  
Sbjct: 1014 RDVDTLSGGEKSFSQMALLLATWKPMRSRIIALDEFDVFMDQVNRKIGTALIVKKLKNES 1073

Query: 1379 -AQLIVIS 1385
              Q I+I+
Sbjct: 1074 RTQTIIIT 1081

 Score = 38.9 bits (89), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 40/65 (61%), Gaps = 5/65 (7%)

Query: 167 IERLVLTNFKSYAGRQV-VGPFHTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQG-K 224
           I+++VL NF  +   ++ +GP   NF  +VG NGSGKS ++ ++    G +A +  +G  
Sbjct: 82  IKKVVLKNFMCHEHFEMDLGP-KLNF--IVGNNGSGKSAILTAITVGLGAKAAETNRGNS 138

Query: 225 LKDLI 229
           LKDLI
Sbjct: 139 LKDLI 143

>Kpol_1044.13 s1044 complement(23616..26927) [3312 bp, 1103 aa] {ON}
            complement(23616..26927) [3312 nt, 1104 aa]
          Length = 1103

 Score = 39.7 bits (91), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 25/42 (59%)

Query: 1327 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIV 1368
            SGGEK +S+   + +L  +   P  V+DEI+  +D RN  I+
Sbjct: 995  SGGEKAVSTALYIISLQNFTKAPFRVVDEINQGMDSRNEKII 1036

 Score = 34.3 bits (77), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 39/177 (22%), Positives = 81/177 (45%), Gaps = 15/177 (8%)

Query: 167 IERLVLTNFKSYAGRQVVGPFHTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLK 226
           I ++ + NF +Y    V      +F+ ++GPNGSGKS V+ ++      + +   +G + 
Sbjct: 51  IIKIKMKNFMTYG--LVEYQLCPSFNMIIGPNGSGKSTVVCALGLGLASKLDITGRGDIV 108

Query: 227 DLIHKSEKYPELSSCSVEIHFQYVIDDPNGGPSKIDESKEKLVVMRK-AFKNNSSKYYIN 285
               ++ K    +S  +EI  +Y   D       ++ ++E + + R+ +     S Y IN
Sbjct: 109 TQYIQNGK----TSGKIEITLKY--SDRIKNVKGVNPNRETVTIKREISIDAKKSNYKIN 162

Query: 286 DKESSFTQVTTLLKNEGIDLDHKRFLILQGEVENIAQMKPKSEKEGDDGLLEYLEDI 342
           +   +   V  ++    I LD+    + Q  +++ A++K      G+  LLE +  +
Sbjct: 163 NTVVNEKDVRDIVSKLNIQLDNLCQYLPQERLKDFARLK------GEKLLLETIRAV 213

>SAKL0H03322g Chr8 complement(314365..317700) [3336 bp, 1111 aa]
           {ON} similar to uniprot|Q12749 Saccharomyces cerevisiae
           YLR383W RHC18 Protein involved in structural maintenance
           of chromosomes required for interchromosomal and sister
           chromatid recombination
          Length = 1111

 Score = 39.3 bits (90), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 39/65 (60%), Gaps = 5/65 (7%)

Query: 167 IERLVLTNFKSYAGRQV-VGPFHTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQG-K 224
           I++++L NF  +   ++ +GP   NF  +VG NGSGKS V+ ++    G +A    +G  
Sbjct: 75  IKKVILKNFMCHEHFELELGP-RLNF--IVGNNGSGKSAVLTAITIGLGAKATDTNRGSS 131

Query: 225 LKDLI 229
           LKDLI
Sbjct: 132 LKDLI 136

 Score = 38.1 bits (87), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 29/52 (55%)

Query: 1321 RNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1372
            RN+  LSGGEK+ S ++L+ A  +   + +  +DE D  +D  N +I    I
Sbjct: 1010 RNVDTLSGGEKSFSQISLLLATWRPMRSRIIALDEFDVFMDQVNRTIGTKLI 1061

>CAGL0F01155g Chr6 complement(116762..120079) [3318 bp, 1105 aa] {ON}
            similar to uniprot|Q08204 Saccharomyces cerevisiae
            YOL034w SMC5
          Length = 1105

 Score = 39.3 bits (90), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 35/131 (26%), Positives = 57/131 (43%), Gaps = 16/131 (12%)

Query: 1266 RLEEFTTGFDIISLTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNISN 1325
            RLE   +G   I     E+++ +   G   L     L  FS+     +M   +    +S 
Sbjct: 940  RLESIVSG---IGRKFSELFKDVGTAGGVTLNRKSKL--FSDW-KLEIMVQFRDEGKLSG 993

Query: 1326 L-----SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALD-----FRNVSIVANYIKER 1375
            L     SGGE+ +S++  + AL K+   P  V+DEI+  +D       + ++V N  +E 
Sbjct: 994  LDSHTQSGGERAVSTVLYMIALQKFTQAPFRVVDEINQGMDTNFERLVHKAMVQNACEEG 1053

Query: 1376 TKDAQLIVISL 1386
            T    LI   L
Sbjct: 1054 TSQYFLITPKL 1064

 Score = 34.7 bits (78), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 52/221 (23%), Positives = 96/221 (43%), Gaps = 37/221 (16%)

Query: 167 IERLVLTNFKSYAGRQV-VGPFHTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQGK 224
           I ++ L NF +Y   +  + P   + + ++GPNGSGKS  + ++      +   + R  +
Sbjct: 38  IVKIRLENFVTYNYTEFNLSP---SLNMIIGPNGSGKSTYVCAVCLGLAGKPEYIGRSKQ 94

Query: 225 LKDLIHKSEKYPELSSCSVEIHFQYVIDDPN-------------------GGPSKIDESK 265
           ++D I   +      +  +EI  +   DDPN                    G   I  + 
Sbjct: 95  VEDFIKNGQ-----DTSKIEIVLK---DDPNIDIEFLGSSFHRIRNNGNYKGLLTITRNL 146

Query: 266 EKLV-VMRKAFKNNSSKYYINDKESSFTQVTTLLKNEGIDLDHKRFLILQGEVENIAQMK 324
           EK   + R   K  + +Y IN   ++ + V  L+    I LD+    + Q  VE  A+++
Sbjct: 147 EKRTKIGRNLEKRRTQEYSINGLPTTESNVRNLVSKFHIQLDNLCQFLSQERVEEFAKLR 206

Query: 325 PKSEKEGDDGLLEYLEDIIGTSHYKVQIEHNLSKVEALNEI 365
           P  EK  D+ +     +++  S ++V  +  L ++E  NEI
Sbjct: 207 P--EKLLDETIRAIDSELL--SMFEVLKKLQLQEIEMSNEI 243

>TBLA0A05300 Chr1 (1297764..1299887) [2124 bp, 707 aa] {ON} Anc_1.67
            YLR188W
          Length = 707

 Score = 38.1 bits (87), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 31/76 (40%), Positives = 45/76 (59%), Gaps = 5/76 (6%)

Query: 1324 SNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT-KDAQLI 1382
            + LSGG+K   +LA  F L   +PT L V+DE  +ALD R+ SIVA  +K+R  K    I
Sbjct: 600  TQLSGGQKQRVALARAFLL---EPT-LLVLDEATSALDPRSESIVAQTLKQRCAKGFTTI 655

Query: 1383 VISLRNNMFELSKQLV 1398
             I+ R +  + S ++V
Sbjct: 656  SIAHRVSTIKHSSRVV 671

>Kwal_26.9380 s26 (1189521..1192829) [3309 bp, 1102 aa] {ON} YLR383W
            (RHC18) - involved in recombination repair [contig 72]
            FULL
          Length = 1102

 Score = 38.1 bits (87), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 43/85 (50%), Gaps = 6/85 (7%)

Query: 1305 FSEG-VTFSVMPPKKSW-RNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDF 1362
            FS+G +T  V  P     RN+  LSGGEK+ S  +L+ A  +   + +  +DE D  +D 
Sbjct: 984  FSKGALTMLVKTPNDDQPRNVDTLSGGEKSFSQTSLLLATWRPMRSRIIALDEFDVFMDQ 1043

Query: 1363 RNVSI----VANYIKERTKDAQLIV 1383
             N  I    + N + + T+   +I+
Sbjct: 1044 VNRQIGTKLIMNKLSKETRTQTIII 1068

 Score = 37.4 bits (85), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 26/75 (34%), Positives = 43/75 (57%), Gaps = 5/75 (6%)

Query: 167 IERLVLTNFKSYAGRQV-VGPFHTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQG-K 224
           I+++ L NF  +   ++ +GP   NF  +VG NGSGKS V+ ++    G +A    +G  
Sbjct: 70  IKKVQLRNFMCHEHFELELGP-RLNF--IVGNNGSGKSAVLTAITIGLGAKATDTNRGSS 126

Query: 225 LKDLIHKSEKYPELS 239
           LKDLI +  +  ++S
Sbjct: 127 LKDLIREGCQSSKIS 141

>KLTH0D14080g Chr4 (1149555..1152863) [3309 bp, 1102 aa] {ON}
           similar to uniprot|Q12749 Saccharomyces cerevisiae
           YLR383W RHC18 Protein involved in structural maintenance
           of chromosomes required for interchromosomal and sister
           chromatid recombination
          Length = 1102

 Score = 38.1 bits (87), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 38/65 (58%), Gaps = 5/65 (7%)

Query: 167 IERLVLTNFKSYAGRQV-VGPFHTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQG-K 224
           I+R+ L NF  +   ++ +GP   NF  +VG NGSGKS V+ ++    G +A    +G  
Sbjct: 69  IKRVQLRNFMCHEHFELELGP-RLNF--IVGNNGSGKSAVLTAITIGLGAKAADTNRGSS 125

Query: 225 LKDLI 229
           LKDLI
Sbjct: 126 LKDLI 130

 Score = 36.6 bits (83), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 32/67 (47%), Gaps = 10/67 (14%)

Query: 1305 FSEGVTFSV----------MPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMD 1354
            FS G+ F+            P  +  RN+   SGGEK+ S ++L+ A  +   + +  +D
Sbjct: 976  FSGGLNFNFSKETLNMLVKTPNDEKPRNVDTFSGGEKSFSQISLLLATWRPMRSRIIALD 1035

Query: 1355 EIDAALD 1361
            E D  +D
Sbjct: 1036 EFDVFMD 1042

>NCAS0B08700 Chr2 (1674262..1676409) [2148 bp, 715 aa] {ON} Anc_1.67
          Length = 715

 Score = 35.4 bits (80), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 44/86 (51%), Gaps = 11/86 (12%)

Query: 1305 FSEGVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRN 1364
            F EGV   V P     R  + LSGG+K   +LA  F LH      L ++DE  +ALD ++
Sbjct: 572  FPEGVNTLVGP-----RG-TQLSGGQKQRIALARAFLLHP----ALLILDEATSALDSQS 621

Query: 1365 VSIVANYIKERTKDAQLIVISLRNNM 1390
              IVA  + ER  +  L  IS+ + +
Sbjct: 622  EEIVAKNLSERV-ELGLTTISIAHRL 646

>AFR683C Chr6 complement(1697786..1699819) [2034 bp, 677 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YLR188W
            (MDL1)
          Length = 677

 Score = 34.3 bits (77), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 29/108 (26%), Positives = 59/108 (54%), Gaps = 11/108 (10%)

Query: 1305 FSEGVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRN 1364
            F EG+  +V P        + LSGG+K   +LA  F     +   + ++DE  +ALD ++
Sbjct: 555  FPEGLQTAVGPRG------TQLSGGQKQRVALARAF----LQDPAILILDEATSALDSKS 604

Query: 1365 VSIVANYIKERTKDAQL-IVISLRNNMFELSKQLVGIYKSENMTQSAT 1411
              IVA+ + +R ++A++ I I+ R +  + S +++ + K  ++ ++ T
Sbjct: 605  EDIVASTLLQRCQEAKITISIAHRKSTIQHSTRVIVLDKLGHVLETGT 652

>KAFR0B05630 Chr2 complement(1156621..1161168) [4548 bp, 1515 aa] {ON}
            Anc_8.303 YDR135C
          Length = 1515

 Score = 34.3 bits (77), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 41/81 (50%), Gaps = 4/81 (4%)

Query: 1324 SNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKDAQLIV 1383
            SNLS G++ L  LA    +    P+ + V+DE  AA+D     IV   I+   KD  ++ 
Sbjct: 1407 SNLSVGQRQLMCLARALLI----PSKILVLDEATAAVDVETDKIVQETIRTAFKDRTILT 1462

Query: 1384 ISLRNNMFELSKQLVGIYKSE 1404
            I+ R N    S +++ + K E
Sbjct: 1463 IAHRLNTIMDSDRIIVLDKGE 1483

>NDAI0A04830 Chr1 (1102282..1105095) [2814 bp, 937 aa] {ON}
           Anc_3.419 YPR105C
          Length = 937

 Score = 33.9 bits (76), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 42/148 (28%), Positives = 68/148 (45%), Gaps = 18/148 (12%)

Query: 394 LANEKNLVLAKSKKYQHQLYIDNK-----KLTSTL----AKITDAQENYDKELEKYSTIS 444
           +ANE   +L   KK    LY  N      K+ ST+    +KI  A    +  +     + 
Sbjct: 268 IANESRKILTFEKKNLSNLYYSNALLHLFKIVSTIINDHSKIISASYGKNYMIHVMENVE 327

Query: 445 KE-------LKNLQDEEITLNKRLNETKKYEEKLLSNQRKNNS--ELISTQEMIKNIEKK 495
           KE       L ++ +E   L++ +N  K + EK  +  +KN S    IST E+  ++E K
Sbjct: 328 KEADLQAGLLLDIFNESRNLDQIVNNIKHWNEKYQNKDKKNYSIKRSISTDELQNDMENK 387

Query: 496 KDNAEKLVNTTEKSITQTNNKLETLNNQ 523
            +N   + N++ K I    N+L TL N+
Sbjct: 388 NNNTSTIDNSSNKDIMIPMNQLSTLINE 415

>NDAI0D04420 Chr4 (1033897..1039641) [5745 bp, 1914 aa] {ON} Anc_4.238
            YDL058W
          Length = 1914

 Score = 33.9 bits (76), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 29/123 (23%), Positives = 66/123 (53%), Gaps = 9/123 (7%)

Query: 880  VAYNSLK-EMNQEILHMKEQIPATELNISKTTIEIEYCENEIKQLISQLKEKQE----IH 934
             AY ++K E+ + +LHM EQ+   E   ++   ++   E ++  +  QL++K +    + 
Sbjct: 1025 AAYEAVKNELEESMLHMNEQLKELETEKAEGDQKLANLEEKLNMMKKQLEDKDQQLTKLC 1084

Query: 935  DQESNNNDEIKVADDKLQALKKEYYSLNDQTKVTKQEIEKLRQQIMDA----GGIELKMQ 990
            + E+NN  ++  A++ + +LK +  +  ++ + +  E+EKL+ ++ D     G  E ++ 
Sbjct: 1085 EGEANNKKQLVTAEETISSLKADKETFMEKLEASGLEVEKLQTELKDTKLQHGEAETRLT 1144

Query: 991  NSK 993
            N K
Sbjct: 1145 NMK 1147

>Smik_14.370 Chr14 complement(655563..657380) [1818 bp, 605 aa] {ON}
            YNR039C (REAL)
          Length = 605

 Score = 33.1 bits (74), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 19/76 (25%), Positives = 41/76 (53%), Gaps = 2/76 (2%)

Query: 1168 NSVSNINTDTMDIDSTDNEINPGIK--RLSELEINELDIESLDAEIENLEEQLEHSTANI 1225
            NS ++  T T  ++S  +++NP ++   +S L I  ++ +++     N     E+ T   
Sbjct: 469  NSSADATTHTQQVESKSSKVNPPVRPRSMSSLPIATMNTKTVKTAFINPTTSTENPTTIK 528

Query: 1226 EILEEYVRRLSEYKKR 1241
             ++++ + RLSE+K R
Sbjct: 529  NMIKDQIERLSEFKSR 544

>Ecym_1072 Chr1 (137296..139347) [2052 bp, 683 aa] {ON} similar to
            Ashbya gossypii AFR683C
          Length = 683

 Score = 33.1 bits (74), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 25/97 (25%), Positives = 56/97 (57%), Gaps = 7/97 (7%)

Query: 1324 SNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKDAQL-I 1382
            + LSGG+K   ++A  F L    P+ L ++DE  +ALD ++  I+A  ++ R++  ++ I
Sbjct: 567  TQLSGGQKQRIAIARAFIL---DPSIL-ILDEATSALDSQSEDIIAQALRARSESGKITI 622

Query: 1383 VISLRNNMFELSKQLVGIYKSENMTQSATLVNNDMLN 1419
             I+ R +  E S +++ + ++  ++++      D++N
Sbjct: 623  SIAHRISTIEHSNRVIVLSRNGGVSETGAFC--DLIN 657

>KNAG0D04340 Chr4 complement(786487..793149) [6663 bp, 2220 aa] {ON}
            Anc_4.238 YDL058W
          Length = 2220

 Score = 33.1 bits (74), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 40/163 (24%), Positives = 77/163 (47%), Gaps = 36/163 (22%)

Query: 822  LDGKLIDISGTMSGGGNYVLRGLMKLGQDLPENDFEQTSPEEVQKLERELEILEKNFKVA 881
            L+G++ D  GT+       L G++K            +  E +Q+L   ++  EKN +  
Sbjct: 1135 LNGRIADYEGTIEE-----LNGIIK------------SHEETIQELSSSIDDREKNIQKL 1177

Query: 882  YNSLKEMNQEILHMKEQIPATELNISKTTIEIEYCENEIKQLISQLKEKQE-----IHDQ 936
              S+ E+N EI+ +KE           T  E+E C +  ++ +++L EK E     I   
Sbjct: 1178 NTSINELNSEIVELKE-----------TNQELEECVSRHEKTVTELNEKIEKSDPIISSY 1226

Query: 937  ESNNND---EIKVADDKLQALKKEYYSLNDQTKVTKQEIEKLR 976
            E+   D   +I  ++DK+ + + +Y  L ++  + ++EIE  +
Sbjct: 1227 EAEIKDLKQKISSSEDKITSQELKYKELQEKVTLLEKEIETFK 1269

>KLLA0F19888g Chr6 complement(1839682..1854429) [14748 bp, 4915 aa]
            {ON} similar to uniprot|Q12019 Saccharomyces cerevisiae
            YLR106C MDN1 Huge dynein-related AAA-type ATPase
            (midasin) forms extended pre-60S particle with the Rix1
            complex (Rix1p-Ipi1p-Ipi3p) may mediate ATP-dependent
            remodeling of 60S subunits and subsequent export from
            nucleoplasm to cytoplasm
          Length = 4915

 Score = 33.5 bits (75), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 27/73 (36%), Positives = 42/73 (57%), Gaps = 8/73 (10%)

Query: 412  LYIDNKKLTSTLAKITDAQENYDKELEKYSTISKELKNLQDEEITLNKRLNETKKYEEKL 471
            +YI  K L+  ++KIT+  +NY   LE    ISKE K L++E  T+       KK ++KL
Sbjct: 3603 IYITQKNLSIYISKITN--QNYPDLLEYALYISKEAKRLREETPTV------YKKEKKKL 3654

Query: 472  LSNQRKNNSELIS 484
            L+  +   S+L+S
Sbjct: 3655 LATLKTQKSKLLS 3667

>ZYRO0F17050g Chr6 complement(1417445..1419589) [2145 bp, 714 aa] {ON}
            similar to uniprot|P33310 Saccharomyces cerevisiae
            YLR188W MDL1 Half-type ATP-binding cassette (ABC)
            transporter of the inner mitochondrial membrane mediates
            export of peptides generated upon proteolysis of
            mitochondrial proteins plays a role in the regulation of
            cellular resistance to oxidative stress
          Length = 714

 Score = 33.1 bits (74), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 37/67 (55%), Gaps = 5/67 (7%)

Query: 1324 SNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKDAQLIV 1383
            + LSGG+K   +LA  F L       L V+DE  +ALD ++  IVA  ++ER +   L  
Sbjct: 588  AQLSGGQKQRVALARAFLLDP----ALLVLDEATSALDSQSEEIVARTLQERVRRG-LTT 642

Query: 1384 ISLRNNM 1390
            IS+ + +
Sbjct: 643  ISIAHRI 649

>TDEL0H00150 Chr8 (15728..16606) [879 bp, 292 aa] {ON} 
          Length = 292

 Score = 32.3 bits (72), Expect = 7.5,   Method: Composition-based stats.
 Identities = 21/81 (25%), Positives = 37/81 (45%), Gaps = 1/81 (1%)

Query: 825 KLIDISGTMSGGGNYVLRGLMKLGQDLPENDFEQTSPEEVQKLERELEILEKNFKVAYNS 884
           KL+ I+G     G  +  G    G DL   D+ Q  P+  Q+L  E +I  K ++V    
Sbjct: 40  KLVVITGASGAIGGAICEGFASAGADLCLLDY-QYDPKREQQLMEEFDIKAKAYQVDITD 98

Query: 885 LKEMNQEILHMKEQIPATELN 905
             E+ + I  ++E     +++
Sbjct: 99  ADEVRRCINSIREDFQGRDID 119

>AFR286W Chr6 (951485..956761) [5277 bp, 1758 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YKR095W (MLP1) and
            YIL149C (MLP2)
          Length = 1758

 Score = 33.1 bits (74), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 43/157 (27%), Positives = 70/157 (44%), Gaps = 29/157 (18%)

Query: 863  EVQKLERELEILEKNFKVAYNSLKEMNQEILHMKE------QIPATELNISKTTIEIEYC 916
            E+Q+L++EL ++  N +     L E NQ++   +E      Q    ELNI K  +E+E+ 
Sbjct: 187  EIQRLQQELALVRSNAEWTTGQLNEKNQQLNSYREKTNGEIQSTQVELNIVKNELEVEHA 246

Query: 917  ENEIKQLISQLKEKQ-EIHDQESNNNDEIKVADDKLQALKKEYYS-----------LNDQ 964
                   ++ L+ K  E+  Q  +   E K   D L + K+E+             LN Q
Sbjct: 247  N------VAALRSKNGELSKQLQDALCETKRLTDSLHSEKQEFAREMALKQRLIELLNGQ 300

Query: 965  TKVTKQEIEKLRQQIMDAGGIELKMQNSKVTSLVNQL 1001
                KQ++EK    +   GG    M +S+   L+N L
Sbjct: 301  VATMKQDLEKAY-DVAKNGG----MSDSERERLLNDL 332

>KAFR0C05940 Chr3 complement(1182174..1183421) [1248 bp, 415 aa] {ON}
            Anc_5.624 YOR032C
          Length = 415

 Score = 32.7 bits (73), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 29/100 (29%), Positives = 47/100 (47%), Gaps = 11/100 (11%)

Query: 1192 KRLSELEINELDIESLDAEIENLEEQLEHSTAN--IEILEEYVRRLSEYKKRKSDLDESI 1249
            K+L+   IN++D+  LD  +E   +  + S  N  IE +     +  EYK +   L+++I
Sbjct: 241  KKLAHQAINDIDLHQLDG-LEPARKLNKGSILNKTIEYINHLQSKCDEYKLKNRFLEDTI 299

Query: 1250 SEKETAKEETEVLKKKRLEEFTTGFDIISLTLKEMYQMIT 1289
                TA+E   +LK+           I +L L  MY  IT
Sbjct: 300  ERVCTAEESAAILKQAE--------GIQTLPLPSMYSTIT 331

>TDEL0B02190 Chr2 complement(389562..394994) [5433 bp, 1810 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1810

 Score = 32.7 bits (73), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 41/71 (57%), Gaps = 5/71 (7%)

Query: 387  KNEALKYL----ANEKNLVLAKSKKYQHQLYIDNKKLTSTLAKITDAQENYDKELEKYST 442
            KNE LK L    ++E +L   K K+Y  +LY   K L    A    AQ+NY++EL+K++ 
Sbjct: 1001 KNEILKKLVSLESSEHSLGQVK-KEYDQKLYQLQKDLEQQTAYANIAQKNYEEELQKHAE 1059

Query: 443  ISKELKNLQDE 453
            +SK +  L+ E
Sbjct: 1060 VSKIISQLRSE 1070

>Kpol_1033.28 s1033 complement(69924..74519) [4596 bp, 1531 aa] {ON}
            complement(69924..74519) [4596 nt, 1532 aa]
          Length = 1531

 Score = 32.7 bits (73), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 41/80 (51%), Gaps = 4/80 (5%)

Query: 1325 NLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKDAQLIVI 1384
            NLS G++ L  LA    +    P+ + ++DE  AA+D    S++   I+   KD  ++ I
Sbjct: 1425 NLSVGQRQLMCLARALLV----PSKILILDEATAAVDVETDSLIQETIRTAFKDRTILTI 1480

Query: 1385 SLRNNMFELSKQLVGIYKSE 1404
            + R N    S ++V + K E
Sbjct: 1481 AHRLNTIMDSDKIVVLDKGE 1500

>TPHA0B04210 Chr2 complement(987462..991373) [3912 bp, 1303 aa] {ON}
            Anc_1.110 YNL250W
          Length = 1303

 Score = 32.7 bits (73), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 31/130 (23%), Positives = 59/130 (45%), Gaps = 20/130 (15%)

Query: 862  EEVQKLERELEILEKNFKVAYNSLKEMNQEILHMKEQIPATELN-------ISKTTIEIE 914
            EEV  +E  L   EK+ K+  N + E+N  I  +K+Q     LN       +SKT  + +
Sbjct: 895  EEVSNIEVRLNSFEKDVKLLQNKITEINANITKLKDQHDKAALNKKEIIEGLSKTMDQFK 954

Query: 915  YCENEIKQLISQLKEKQEIHDQESNNNDEIKVADDKLQALKKEYYSLNDQTKVTKQEIEK 974
              +N IK+              E   N ++K  +++L+  K +  ++N         + K
Sbjct: 955  TLQNSIKEF-------------ELTGNADLKACNEELEDYKSKLKNINVAIDQKTANLSK 1001

Query: 975  LRQQIMDAGG 984
            L+++++D+  
Sbjct: 1002 LKEELIDSNS 1011

>KLLA0F15950g Chr6 (1477113..1478522) [1410 bp, 469 aa] {ON} similar
           to uniprot|P20449 Saccharomyces cerevisiae YOR046C DBP5
           Cytoplasmic ATP-dependent RNA helicase of the DEAD-box
           family involved in mRNA export from the nucleus
          Length = 469

 Score = 32.3 bits (72), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 26/93 (27%), Positives = 47/93 (50%), Gaps = 4/93 (4%)

Query: 332 DDGLLEYLEDIIGTSHYKVQIEHNLSKVEALNEI---CIEKENRFNIVEKEKDSLVDGKN 388
           DDG+ +Y + II T+   ++++ N   V A+ ++   C  +E+++ I+ +    L  G +
Sbjct: 262 DDGVRQYAKKIIPTA-VSLELQKNEVNVSAIKQLFMDCDNEEHKYTILSELYGLLTIGSS 320

Query: 389 EALKYLANEKNLVLAKSKKYQHQLYIDNKKLTS 421
                     NL+ AK KK  HQ+ I +  L S
Sbjct: 321 IIFVKTKQTANLLYAKLKKEGHQVSILHGDLQS 353

>TBLA0B03720 Chr2 complement(857518..859401) [1884 bp, 627 aa] {ON}
           Anc_8.699 YPL169C
          Length = 627

 Score = 32.3 bits (72), Expect = 10.0,   Method: Compositional matrix adjust.
 Identities = 19/75 (25%), Positives = 38/75 (50%), Gaps = 1/75 (1%)

Query: 393 YLANEKNLV-LAKSKKYQHQLYIDNKKLTSTLAKITDAQENYDKELEKYSTISKELKNLQ 451
           YL++ +N+  ++  K  Q +LY+  + + ++   +   + + D +   YS  +  L  L 
Sbjct: 336 YLSSSRNITKISSEKAVQQRLYMGQEAINNSFKSLPMTKHHLDDDPNGYSVQTISLSQLN 395

Query: 452 DEEITLNKRLNETKK 466
              ITL+   NET+K
Sbjct: 396 GFMITLHGYFNETEK 410

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.310    0.129    0.342 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 145,040,144
Number of extensions: 6818445
Number of successful extensions: 54697
Number of sequences better than 10.0: 1987
Number of HSP's gapped: 53106
Number of HSP's successfully gapped: 4527
Length of query: 1422
Length of database: 53,481,399
Length adjustment: 122
Effective length of query: 1300
Effective length of database: 39,492,147
Effective search space: 51339791100
Effective search space used: 51339791100
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 72 (32.3 bits)