Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0E044008.257ON58958930590.0
Kpol_392.98.257ON59459017260.0
SAKL0H17160g8.257ON73952217120.0
KLTH0G13794g8.257ON72553117080.0
Kwal_56.236078.257ON72552217030.0
NDAI0J014008.257ON58859216520.0
KLLA0F19041g8.257ON76352216690.0
ZYRO0C01782g8.257ON73053216650.0
NCAS0B038708.257ON59659416490.0
Ecym_43138.257ON59760316470.0
KAFR0B055608.257ON60559016440.0
CAGL0B01727g8.257ON57758616400.0
Skud_4.3708.257ON71452216450.0
YDR109C8.257ON71552316380.0
TDEL0F038408.257ON72652916130.0
Suva_2.2698.257ON72552916070.0
Smik_4.3558.257ON70452415820.0
TPHA0B032408.257ON58558415650.0
KNAG0H032608.257ON58058615630.0
AGR092W8.257ON59659514920.0
YNL249C (MPA43)1.111ON5426035101e-56
Skud_14.891.111ON5696105051e-55
Suva_14.931.111ON5436044943e-54
TDEL0C059001.111ON5436164924e-54
ZYRO0F16016g1.111ON5425994891e-53
Smik_14.861.111ON5436034794e-52
Kwal_33.135301.111ON5346124478e-48
SAKL0C03432g1.111ON5476034214e-44
KLTH0F03080g1.111ON5336024189e-44
KNAG0F006601.111ON5356013985e-41
KLLA0C02937g1.111ON5165473384e-33
NCAS0A007801.111ON5495271697e-12
TPHA0K022804.9ON667224930.011
NCAS0C059004.9ON703171930.012
KNAG0J029204.9ON675189920.017
NDAI0H002204.9ON810152890.038
ACL069C4.9ON644184880.046
CAGL0E03916g4.9ON672184810.32
KLLA0E00595g4.9ON661138780.67
KNAG0C043507.436ON1004111780.80
KLTH0E05654g4.9ON686140751.8
NCAS0A146907.436ON1308128751.8
NCAS0A05290singletonON92677742.2
Suva_2.1673.240ON105446723.8
Ecym_46737.461ON120390715.9
TPHA0B048501.33ON500110706.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0E04400
         (589 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0E04400 Chr5 complement(1119643..1121412) [1770 bp, 589 aa] ...  1182   0.0  
Kpol_392.9 s392 (24389..26173) [1785 bp, 594 aa] {ON} (24389..26...   669   0.0  
SAKL0H17160g Chr8 (1516854..1519073) [2220 bp, 739 aa] {ON} simi...   664   0.0  
KLTH0G13794g Chr7 (1191104..1193281) [2178 bp, 725 aa] {ON} simi...   662   0.0  
Kwal_56.23607 s56 complement(618687..620864) [2178 bp, 725 aa] {...   660   0.0  
NDAI0J01400 Chr10 (321913..323679) [1767 bp, 588 aa] {ON} Anc_8....   640   0.0  
KLLA0F19041g Chr6 complement(1753543..1755834) [2292 bp, 763 aa]...   647   0.0  
ZYRO0C01782g Chr3 (137232..139424) [2193 bp, 730 aa] {ON} simila...   645   0.0  
NCAS0B03870 Chr2 (689411..691201) [1791 bp, 596 aa] {ON} Anc_8.257    639   0.0  
Ecym_4313 Chr4 (672950..674743) [1794 bp, 597 aa] {ON} similar t...   639   0.0  
KAFR0B05560 Chr2 (1138380..1140197) [1818 bp, 605 aa] {ON} Anc_8...   637   0.0  
CAGL0B01727g Chr2 complement(159373..161106) [1734 bp, 577 aa] {...   636   0.0  
Skud_4.370 Chr4 complement(645143..647287) [2145 bp, 714 aa] {ON...   638   0.0  
YDR109C Chr4 complement(673520..675667) [2148 bp, 715 aa] {ON} P...   635   0.0  
TDEL0F03840 Chr6 complement(705363..707543) [2181 bp, 726 aa] {O...   625   0.0  
Suva_2.269 Chr2 complement(467973..470150) [2178 bp, 725 aa] {ON...   623   0.0  
Smik_4.355 Chr4 complement(634853..636967) [2115 bp, 704 aa] {ON...   613   0.0  
TPHA0B03240 Chr2 (743153..744910) [1758 bp, 585 aa] {ON} Anc_8.2...   607   0.0  
KNAG0H03260 Chr8 (607908..609650) [1743 bp, 580 aa] {ON} Anc_8.2...   606   0.0  
AGR092W Chr7 (908750..910540) [1791 bp, 596 aa] {ON} Syntenic ho...   579   0.0  
YNL249C Chr14 complement(179394..181022) [1629 bp, 542 aa] {ON} ...   201   1e-56
Skud_14.89 Chr14 complement(168159..169868) [1710 bp, 569 aa] {O...   199   1e-55
Suva_14.93 Chr14 complement(174204..175835) [1632 bp, 543 aa] {O...   194   3e-54
TDEL0C05900 Chr3 (1062033..1063664) [1632 bp, 543 aa] {ON} Anc_1...   194   4e-54
ZYRO0F16016g Chr6 (1313995..1315623) [1629 bp, 542 aa] {ON} simi...   192   1e-53
Smik_14.86 Chr14 complement(158487..160118) [1632 bp, 543 aa] {O...   189   4e-52
Kwal_33.13530 s33 complement(268296..269900) [1605 bp, 534 aa] {...   176   8e-48
SAKL0C03432g Chr3 complement(325502..327145) [1644 bp, 547 aa] {...   166   4e-44
KLTH0F03080g Chr6 complement(268621..270222) [1602 bp, 533 aa] {...   165   9e-44
KNAG0F00660 Chr6 complement(114441..116048) [1608 bp, 535 aa] {O...   157   5e-41
KLLA0C02937g Chr3 complement(265205..266755) [1551 bp, 516 aa] {...   134   4e-33
NCAS0A00780 Chr1 complement(152317..153966) [1650 bp, 549 aa] {O...    70   7e-12
TPHA0K02280 Chr11 (490104..492107) [2004 bp, 667 aa] {ON} Anc_4....    40   0.011
NCAS0C05900 Chr3 (1214812..1216923) [2112 bp, 703 aa] {ON} Anc_4...    40   0.012
KNAG0J02920 Chr10 (561449..563476) [2028 bp, 675 aa] {ON} Anc_4....    40   0.017
NDAI0H00220 Chr8 complement(30959..33391) [2433 bp, 810 aa] {ON}...    39   0.038
ACL069C Chr3 complement(232439..234373) [1935 bp, 644 aa] {ON} S...    39   0.046
CAGL0E03916g Chr5 (371422..373440) [2019 bp, 672 aa] {ON} simila...    36   0.32 
KLLA0E00595g Chr5 complement(49243..51228) [1986 bp, 661 aa] {ON...    35   0.67 
KNAG0C04350 Chr3 complement(853661..856675) [3015 bp, 1004 aa] {...    35   0.80 
KLTH0E05654g Chr5 complement(499361..501421) [2061 bp, 686 aa] {...    33   1.8  
NCAS0A14690 Chr1 (2893776..2897702) [3927 bp, 1308 aa] {ON} Anc_...    33   1.8  
NCAS0A05290 Chr1 complement(1047369..1050149) [2781 bp, 926 aa] ...    33   2.2  
Suva_2.167 Chr2 complement(289751..292915) [3165 bp, 1054 aa] {O...    32   3.8  
Ecym_4673 Chr4 complement(1306433..1310044) [3612 bp, 1203 aa] {...    32   5.9  
TPHA0B04850 Chr2 complement(1136421..1137923) [1503 bp, 500 aa] ...    32   6.5  

>TBLA0E04400 Chr5 complement(1119643..1121412) [1770 bp, 589 aa]
           {ON} Anc_8.257 YDR109C
          Length = 589

 Score = 1182 bits (3059), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 575/589 (97%), Positives = 575/589 (97%)

Query: 1   MSYYIGVDVGTGSARACLIDLNGDILSIKELAIDRQELKPGYITQSTXXXXXXXXXXXXX 60
           MSYYIGVDVGTGSARACLIDLNGDILSIKELAIDRQELKPGYITQST             
Sbjct: 1   MSYYIGVDVGTGSARACLIDLNGDILSIKELAIDRQELKPGYITQSTNQIWNNICICIRN 60

Query: 61  XLQESNVDDISSKIKGIGFDATCSLVVLNSKTDQEVAVGPNFEDNDQNVILWMDHRALIE 120
            LQESNVDDISSKIKGIGFDATCSLVVLNSKTDQEVAVGPNFEDNDQNVILWMDHRALIE
Sbjct: 61  ILQESNVDDISSKIKGIGFDATCSLVVLNSKTDQEVAVGPNFEDNDQNVILWMDHRALIE 120

Query: 121 TVEINSTDSKCLKYVGGQMSVEMEIPKIKWLKNNMNPAVYKDCKFLDLPDFLTYKATGNS 180
           TVEINSTDSKCLKYVGGQMSVEMEIPKIKWLKNNMNPAVYKDCKFLDLPDFLTYKATGNS
Sbjct: 121 TVEINSTDSKCLKYVGGQMSVEMEIPKIKWLKNNMNPAVYKDCKFLDLPDFLTYKATGNS 180

Query: 181 IRSFCSAVCKQGLLPLGVEGSTKGWTEEFLLNIGLEDLMEDNFVKLGGPVKQDSQGKVSF 240
           IRSFCSAVCKQGLLPLGVEGSTKGWTEEFLLNIGLEDLMEDNFVKLGGPVKQDSQGKVSF
Sbjct: 181 IRSFCSAVCKQGLLPLGVEGSTKGWTEEFLLNIGLEDLMEDNFVKLGGPVKQDSQGKVSF 240

Query: 241 STAGEFIGYLSDKSSKIMGISSKCAVSSGIIDAYAGWIGTIAASTKEPIEQLNNFQDNLN 300
           STAGEFIGYLSDKSSKIMGISSKCAVSSGIIDAYAGWIGTIAASTKEPIEQLNNFQDNLN
Sbjct: 241 STAGEFIGYLSDKSSKIMGISSKCAVSSGIIDAYAGWIGTIAASTKEPIEQLNNFQDNLN 300

Query: 301 GMICSSGRLAVVAGTSTCHISLTNKPIFVPGVWGPYRDVLGHNFWCAEGGQSCTGALLQH 360
           GMICSSGRLAVVAGTSTCHISLTNKPIFVPGVWGPYRDVLGHNFWCAEGGQSCTGALLQH
Sbjct: 301 GMICSSGRLAVVAGTSTCHISLTNKPIFVPGVWGPYRDVLGHNFWCAEGGQSCTGALLQH 360

Query: 361 VLETHPAYKELCAISKQQDISVFEVLNNKIRELTHQRDLIDEVHLIKNLFFYGDFHGNRS 420
           VLETHPAYKELCAISKQQDISVFEVLNNKIRELTHQRDLIDEVHLIKNLFFYGDFHGNRS
Sbjct: 361 VLETHPAYKELCAISKQQDISVFEVLNNKIRELTHQRDLIDEVHLIKNLFFYGDFHGNRS 420

Query: 421 PVADEAMRGNIIGLSMDSSLNDLCRMYLGACEFIAQQTRHIVDIMTKSGYNLHSLYMSGG 480
           PVADEAMRGNIIGLSMDSSLNDLCRMYLGACEFIAQQTRHIVDIMTKSGYNLHSLYMSGG
Sbjct: 421 PVADEAMRGNIIGLSMDSSLNDLCRMYLGACEFIAQQTRHIVDIMTKSGYNLHSLYMSGG 480

Query: 481 QCRNELLMQLISNCVGLPVVIPKNIDTAVVFGSALMGACASELSKSHSDNTKKPDQILWD 540
           QCRNELLMQLISNCVGLPVVIPKNIDTAVVFGSALMGACASELSKSHSDNTKKPDQILWD
Sbjct: 481 QCRNELLMQLISNCVGLPVVIPKNIDTAVVFGSALMGACASELSKSHSDNTKKPDQILWD 540

Query: 541 VMCKMTGQGIVVSPQDPSSQVCKLLTVKYQIYLDMIATQKRYRSMVNGL 589
           VMCKMTGQGIVVSPQDPSSQVCKLLTVKYQIYLDMIATQKRYRSMVNGL
Sbjct: 541 VMCKMTGQGIVVSPQDPSSQVCKLLTVKYQIYLDMIATQKRYRSMVNGL 589

>Kpol_392.9 s392 (24389..26173) [1785 bp, 594 aa] {ON}
           (24389..26173) [1785 nt, 595 aa]
          Length = 594

 Score =  669 bits (1726), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/590 (54%), Positives = 429/590 (72%), Gaps = 7/590 (1%)

Query: 1   MSYYIGVDVGTGSARACLIDLNGDILSIKELAIDRQELKPGYITQSTXXXXXXXXXXXXX 60
           M++YIGVDVGTGS RAC+I+  G+ILS++   I ++ELKP YITQS+             
Sbjct: 1   MNHYIGVDVGTGSVRACVINDKGEILSLRSKDITKEELKPNYITQSSREIWQCICECVNY 60

Query: 61  XLQESNVDDISSKIKGIGFDATCSLVVLNSKTDQEVAVGPNFEDNDQNVILWMDHRALIE 120
            LQES +  I S + GIGFDATCSLVV++ +T QEV VGPNFED+++N+ILWMDHRA+ E
Sbjct: 61  VLQESQI--IPSSVLGIGFDATCSLVVIDKETQQEVGVGPNFEDDNRNIILWMDHRAVKE 118

Query: 121 TVEINSTDSKCLKYVGGQMSVEMEIPKIKWLKNNMNPAVYKDCKFLDLPDFLTYKATGNS 180
           T EIN+T  KCLKYVGG+MSVEME+PKIKWLKNN+   V+ +CKF DL D+LTYKAT   
Sbjct: 119 TDEINATGDKCLKYVGGKMSVEMELPKIKWLKNNLADGVFSNCKFFDLVDYLTYKATDKD 178

Query: 181 IRSFCSAVCKQGLLPLGVEGSTKGWTEEFLLNIGLEDLMEDNFVKLGGPVKQDSQGKVSF 240
           +RSF S VCKQGLLPLGVEGS  GW++EF   I L++L  DNF  +GG +  + Q + + 
Sbjct: 179 VRSFSSTVCKQGLLPLGVEGSDIGWSKEFFTKIDLDELSSDNFSAIGGSIHSE-QLENNI 237

Query: 241 STAGEFIGYLSDKSSKIMGISSKCAVSSGIIDAYAGWIGTIAASTKEPIEQLNNFQDNLN 300
            + GE++G+LS+ S+K +G+ + C V SGIIDAYAGW+GT+AA  +E I  +NN  D  +
Sbjct: 238 RSVGEYVGHLSEISAKELGLPTTCIVGSGIIDAYAGWVGTVAAKVEE-IGTINNDDDASS 296

Query: 301 GMICSSGRLAVVAGTSTCHISLTNKPIFVPGVWGPYRDVLGHNFWCAEGGQSCTGALLQH 360
            +  S G LAV+AGTSTCHI+L++KPIFV G+WGPYRDVL HNFWCAEGGQSCTGALL+H
Sbjct: 297 KLDSSIGNLAVIAGTSTCHITLSSKPIFVNGIWGPYRDVLSHNFWCAEGGQSCTGALLEH 356

Query: 361 VLETHPAYKELCAISKQQDISVFEVLNNKIRELTHQRDLIDEVHLIKNLFFYGDFHGNRS 420
           +L THPAY EL    ++  +  FE LNN++ EL  +      + L K+ F YGD+HGNRS
Sbjct: 357 ILTTHPAYPELHEQCEKHSVGSFEFLNNRLAELQKENSARSIISLGKHFFLYGDYHGNRS 416

Query: 421 PVADEAMRGNIIGLSMDSSLNDLCRMYLGACEFIAQQTRHIVDIMTKSGYNLHSLYMSGG 480
           P++DE+MR  IIG SMD+S++ L  MYL ACEFI+QQ+R I+  + K+G+ +  +YMSGG
Sbjct: 417 PISDESMRAAIIGQSMDTSIDSLAIMYLSACEFISQQSRQIISELVKAGHTIKKIYMSGG 476

Query: 481 QCRNELLMQLISNCVGLPVVIPKNIDTAVVFGSALMGACASE-LSKSHSDNTKKPD--QI 537
           Q RN+LLM+L+++C GLPVVIP+ ID +V+FGSA++GA A +  +  H D  K  D  + 
Sbjct: 477 QARNQLLMRLLADCTGLPVVIPRYIDASVIFGSAILGAVAVDAYNIKHLDGNKNWDHGKT 536

Query: 538 LWDVMCKMTGQGIVVSPQDPSSQVCKLLTVKYQIYLDMIATQKRYRSMVN 587
           LW+ MCK+T  G V++P   +     LL  KY+I+LDM  TQ++YR  ++
Sbjct: 537 LWNKMCKLTPPGTVINPNAVNHPDRVLLNAKYKIFLDMAETQRKYRRQID 586

>SAKL0H17160g Chr8 (1516854..1519073) [2220 bp, 739 aa] {ON} similar
           to uniprot|P53583 Saccharomyces cerevisiae YNL249C MPA43
           Mitochondrial protein of unknown function and similar to
           uniprot|Q04585 Saccharomyces cerevisiae YDR109C
           Hypothetical ORF
          Length = 739

 Score =  664 bits (1712), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/522 (60%), Positives = 395/522 (75%), Gaps = 2/522 (0%)

Query: 1   MSYYIGVDVGTGSARACLIDLNGDILSIKELAIDRQELKPGYITQSTXXXXXXXXXXXXX 60
           M+YY+GVDVGTGSARAC+ID  G+ILS+ E  I RQELKP YITQS+             
Sbjct: 32  MTYYVGVDVGTGSARACIIDNMGNILSLAERPIQRQELKPSYITQSSQEIWLAICYCVKS 91

Query: 61  XLQESNVDDISSKIKGIGFDATCSLVVLNSKTDQEVAVGPNFEDNDQNVILWMDHRALIE 120
            +++S V  +  KI GIGFDATCSLVV+   +D+EVAVGP+F + +QN+ILWMDHRA+ E
Sbjct: 92  VVKDSGV--LPEKIHGIGFDATCSLVVVEDDSDKEVAVGPDFFNTEQNIILWMDHRAIDE 149

Query: 121 TVEINSTDSKCLKYVGGQMSVEMEIPKIKWLKNNMNPAVYKDCKFLDLPDFLTYKATGNS 180
           T EIN+T+ KCLKYVGGQMSVEMEIPKIKWLKNN+    ++ CKF DL D+LT+KATG  
Sbjct: 150 TKEINATNDKCLKYVGGQMSVEMEIPKIKWLKNNLPREKFEKCKFFDLADYLTFKATGLE 209

Query: 181 IRSFCSAVCKQGLLPLGVEGSTKGWTEEFLLNIGLEDLMEDNFVKLGGPVKQDSQGKVSF 240
            RS+CS VCKQGLLP+GVE S +GW++EFL NIGLEDL +D+F KLGG +K D  G  +F
Sbjct: 210 TRSYCSTVCKQGLLPVGVESSKQGWSKEFLTNIGLEDLCQDDFRKLGGSIKSDGSGGSTF 269

Query: 241 STAGEFIGYLSDKSSKIMGISSKCAVSSGIIDAYAGWIGTIAASTKEPIEQLNNFQDNLN 300
            +AGE IG L   +++ +G+ + C V SG+IDAYAGW+GT+AA T   I +L    +   
Sbjct: 270 LSAGECIGSLDPSAAEELGLPAHCVVGSGVIDAYAGWVGTVAARTDVDIPELVEADNEKT 329

Query: 301 GMICSSGRLAVVAGTSTCHISLTNKPIFVPGVWGPYRDVLGHNFWCAEGGQSCTGALLQH 360
           G+  ++GRLA VAGTSTCHI+++  PIFV GVWGPYRDV+   FWCAEGGQSCTGALL H
Sbjct: 330 GIDHATGRLAAVAGTSTCHIAMSKDPIFVDGVWGPYRDVMAPGFWCAEGGQSCTGALLAH 389

Query: 361 VLETHPAYKELCAISKQQDISVFEVLNNKIRELTHQRDLIDEVHLIKNLFFYGDFHGNRS 420
           VL  HPAY EL  +S    +S F+ LN+++  LT QR     V L K+LFFYGD+HGNRS
Sbjct: 390 VLTIHPAYTELSHLSDAASVSKFDYLNSRLEVLTQQRGARSVVALAKHLFFYGDYHGNRS 449

Query: 421 PVADEAMRGNIIGLSMDSSLNDLCRMYLGACEFIAQQTRHIVDIMTKSGYNLHSLYMSGG 480
           P+AD +MR  +IG SMD+S++DL  MYLGACEFIAQQTR IV+ M+ SG+ + +++MSGG
Sbjct: 450 PIADPSMRAAVIGQSMDNSIDDLAIMYLGACEFIAQQTRQIVEKMSVSGHRIAAIFMSGG 509

Query: 481 QCRNELLMQLISNCVGLPVVIPKNIDTAVVFGSALMGACASE 522
           QCRN LLM+L+++C GLP+VIP+ ID AVVFGSAL+GA ASE
Sbjct: 510 QCRNGLLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASE 551

 Score = 58.2 bits (139), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 43/86 (50%), Gaps = 1/86 (1%)

Query: 502 PKNIDTAVVFGSALMGACASELSKSHSDNTKKPDQILWDVMCKMTGQGIVVSPQDPSSQV 561
           P+  + A+ FGS    A   +L+     +       LWDVM  MTG G VV P       
Sbjct: 641 PEEANAALSFGSKKATA-QEQLALEKEKSASGKGDALWDVMYNMTGGGKVVQPSSDDHPD 699

Query: 562 CKLLTVKYQIYLDMIATQKRYRSMVN 587
             LL  KY+I+LDM  TQ+RYR  V+
Sbjct: 700 RVLLDAKYKIFLDMAETQRRYREAVD 725

>KLTH0G13794g Chr7 (1191104..1193281) [2178 bp, 725 aa] {ON} similar
           to uniprot|Q04585 Saccharomyces cerevisiae YDR109C
           Hypothetical ORF
          Length = 725

 Score =  662 bits (1708), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/531 (59%), Positives = 398/531 (74%), Gaps = 6/531 (1%)

Query: 1   MSYYIGVDVGTGSARACLIDLNGDILSIKELAIDRQELKPGYITQSTXXXXXXXXXXXXX 60
           M YY+GVDVGTGSARAC+ID  G+ILS+ E  I R++LK  +ITQS+             
Sbjct: 32  MLYYVGVDVGTGSARACIIDSMGNILSLAERPIQREQLKANFITQSSQEIWQAVCHCVKS 91

Query: 61  XLQESNVDDISSKIKGIGFDATCSLVVLNSKTDQEVAVGPNFEDNDQNVILWMDHRALIE 120
            +++S V   + KI GIGFDATCSLVV+  +T++EVAVGP+F + DQN+ILWMDHRA+ E
Sbjct: 92  VVRDSGVP--AEKIHGIGFDATCSLVVVEEQTNKEVAVGPDFSNTDQNIILWMDHRAIEE 149

Query: 121 TVEINSTDSKCLKYVGGQMSVEMEIPKIKWLKNNMNPAVYKDCKFLDLPDFLTYKATGNS 180
           T  IN+T  KCLKYVGGQMSVEMEIPKIKWLKN++    + +CKF DL D+LT+KA+G  
Sbjct: 150 TQLINATGDKCLKYVGGQMSVEMEIPKIKWLKNHLPENKFNECKFFDLADYLTFKASGKE 209

Query: 181 IRSFCSAVCKQGLLPLGVEGSTKGWTEEFLLNIGLEDLMEDNFVKLGGPVKQDSQGKVSF 240
            RSFCS VCKQGLLP+GVEGS +GW+ EFL  IGLE+L+ED+F ++GG VK   +GK +F
Sbjct: 210 TRSFCSTVCKQGLLPVGVEGSAEGWSREFLTEIGLEELIEDDFRRIGGSVKNSDKGK-NF 268

Query: 241 STAGEFIGYLSDKSSKIMGISSKCAVSSGIIDAYAGWIGTIAASTKEPIEQLNNFQDNLN 300
            +AGEFIG +    ++ +G+S+ C V SG+IDAYAGW+GT+AA T   I  L        
Sbjct: 269 LSAGEFIGAIDATVAEELGLSNHCVVGSGVIDAYAGWVGTVAARTDVSIPALVKTDQEKV 328

Query: 301 GMICSSGRLAVVAGTSTCHISLTNKPIFVPGVWGPYRDVLGHNFWCAEGGQSCTGALLQH 360
           GM  ++GRLA VAGTSTCHI+++  PIFV GVWGPYRD L  NFWCAEGGQSCTGALL H
Sbjct: 329 GMDRATGRLAAVAGTSTCHIAMSRDPIFVDGVWGPYRDALATNFWCAEGGQSCTGALLAH 388

Query: 361 VLETHPAYKELCAISKQQDISVFEVLNNKIRELTHQRDLIDEVHLIKNLFFYGDFHGNRS 420
           VL THPAY EL  ++    +S F+ LN+++  L  Q+     VHL K+LFFYGD+HGNRS
Sbjct: 389 VLTTHPAYTELSQLADAASVSKFDYLNSRLETLAQQQKARSVVHLAKHLFFYGDYHGNRS 448

Query: 421 PVADEAMRGNIIGLSMDSSLNDLCRMYLGACEFIAQQTRHIVDIMTKSGYNLHSLYMSGG 480
           P+AD +MR  IIG SMD+S++DL  MYLGACEFIAQQTR IVD M  SG++L +++MSGG
Sbjct: 449 PIADPSMRAAIIGQSMDNSIDDLALMYLGACEFIAQQTRQIVDKMCTSGHDLSAIFMSGG 508

Query: 481 QCRNELLMQLISNCVGLPVVIPKNIDTAVVFGSALMGACASE---LSKSHS 528
           QCRN LLM+L+++C GLP+VIP+ ID AVVFGSAL+GA ASE   LS +HS
Sbjct: 509 QCRNGLLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASESFDLSGTHS 559

 Score = 52.0 bits (123), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 33/50 (66%)

Query: 538 LWDVMCKMTGQGIVVSPQDPSSQVCKLLTVKYQIYLDMIATQKRYRSMVN 587
           +W+VM  MTG G VV P    +    LL  KY+I+LDM  TQ++YR++V+
Sbjct: 671 MWNVMYNMTGGGKVVQPAAEENADRVLLNAKYKIFLDMAETQRKYRTIVD 720

>Kwal_56.23607 s56 complement(618687..620864) [2178 bp, 725 aa] {ON}
           YDR109C - Hypothetical ORF [contig 176] FULL
          Length = 725

 Score =  660 bits (1703), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/522 (59%), Positives = 395/522 (75%), Gaps = 3/522 (0%)

Query: 1   MSYYIGVDVGTGSARACLIDLNGDILSIKELAIDRQELKPGYITQSTXXXXXXXXXXXXX 60
           M YYIGVDVGTGSARAC+ID  G+ILS+ E  I R++LKP +ITQS+             
Sbjct: 32  MLYYIGVDVGTGSARACIIDSMGNILSLAERPIQREQLKPNFITQSSQEIWQAVCHCVKS 91

Query: 61  XLQESNVDDISSKIKGIGFDATCSLVVLNSKTDQEVAVGPNFEDNDQNVILWMDHRALIE 120
            +++S V   S KI GIGFDATCSLVV+   +++EVAVGP+F++ +QN+ILWMDHRA+ E
Sbjct: 92  VVRDSGVP--SEKIHGIGFDATCSLVVVEEGSNKEVAVGPDFQNTNQNIILWMDHRAIEE 149

Query: 121 TVEINSTDSKCLKYVGGQMSVEMEIPKIKWLKNNMNPAVYKDCKFLDLPDFLTYKATGNS 180
           T +IN+T  KCLKYVGGQMSVEMEIPKIKWLKN++    + +CKF DL D+LT+KA+G  
Sbjct: 150 TEQINATGDKCLKYVGGQMSVEMEIPKIKWLKNHLPNNKFDECKFFDLADYLTFKASGKE 209

Query: 181 IRSFCSAVCKQGLLPLGVEGSTKGWTEEFLLNIGLEDLMEDNFVKLGGPVKQDSQGKVSF 240
            RSFCS VCKQGLLP+GVEGS +GW+ EFL  IGLED +ED+F K+GG VK   +GK +F
Sbjct: 210 TRSFCSTVCKQGLLPVGVEGSKEGWSREFLTEIGLEDFIEDDFRKIGGSVKNSDKGK-NF 268

Query: 241 STAGEFIGYLSDKSSKIMGISSKCAVSSGIIDAYAGWIGTIAASTKEPIEQLNNFQDNLN 300
            +AGEF+G +    ++ +G+S+ C V SG+IDAYAGW+GT+AA T   I  L        
Sbjct: 269 LSAGEFVGAIDPAVAEELGLSNHCVVGSGVIDAYAGWVGTVAARTDVSIPALVKIDQEKV 328

Query: 301 GMICSSGRLAVVAGTSTCHISLTNKPIFVPGVWGPYRDVLGHNFWCAEGGQSCTGALLQH 360
           GM  ++GRLA VAGTSTCHI+++  PIFV GVWGPYRD L  NFWCAEGGQSCTGALL H
Sbjct: 329 GMDRATGRLAAVAGTSTCHIAMSRDPIFVDGVWGPYRDALATNFWCAEGGQSCTGALLAH 388

Query: 361 VLETHPAYKELCAISKQQDISVFEVLNNKIRELTHQRDLIDEVHLIKNLFFYGDFHGNRS 420
           V+ THPAY EL  ++    +S F+ LN+++  L  Q+     VHL ++LFFYGD+HGNRS
Sbjct: 389 VMTTHPAYTELSQLADAASVSKFDYLNSRLETLAQQQKSRSVVHLARHLFFYGDYHGNRS 448

Query: 421 PVADEAMRGNIIGLSMDSSLNDLCRMYLGACEFIAQQTRHIVDIMTKSGYNLHSLYMSGG 480
           P+AD +MR  IIG SMD+S++DL  MYLGACEFIAQQTR IV+ MT SG+++ +++MSGG
Sbjct: 449 PIADPSMRAAIIGQSMDNSIDDLALMYLGACEFIAQQTRQIVEKMTTSGHDMAAIFMSGG 508

Query: 481 QCRNELLMQLISNCVGLPVVIPKNIDTAVVFGSALMGACASE 522
           QCRN LLM+L+++C GLP+VIP+ ID AVVFGSAL+GA ASE
Sbjct: 509 QCRNGLLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASE 550

 Score = 56.2 bits (134), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 35/50 (70%)

Query: 538 LWDVMCKMTGQGIVVSPQDPSSQVCKLLTVKYQIYLDMIATQKRYRSMVN 587
           +W+VM  MTG G VV P    +   KLL VKY+I+LDM  TQ++YR++VN
Sbjct: 671 MWNVMYNMTGGGKVVQPCPEDNPDRKLLDVKYKIFLDMAETQRKYRNLVN 720

>NDAI0J01400 Chr10 (321913..323679) [1767 bp, 588 aa] {ON} Anc_8.257
          Length = 588

 Score =  640 bits (1652), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/592 (54%), Positives = 428/592 (72%), Gaps = 17/592 (2%)

Query: 3   YYIGVDVGTGSARACLIDLNGDILSIKELAIDRQELKPGYITQSTXXXXXXXXXXXXXXL 62
           YYIGVDVGTGS RAC+ID  G I S  EL+I RQELK   ITQS+              +
Sbjct: 7   YYIGVDVGTGSVRACIIDDLGTIKSQAELSIHRQELKTDCITQSSQEIWRAVCFCVKKVV 66

Query: 63  QESNVDDISSKIKGIGFDATCSLVVLNSKTDQEVAVGPNFEDNDQNVILWMDHRALIETV 122
            E        ++KGIGFDATCSLVV++  T++ VAVGP+F D++Q++ILWMDHRAL ET 
Sbjct: 67  NELGC--TRDQVKGIGFDATCSLVVVDKVTNRGVAVGPDFNDSNQDIILWMDHRALKETK 124

Query: 123 EINSTDSKCLKYVGGQMSVEMEIPKIKWLKNNMNPAVYKDCKFLDLPDFLTYKATGNSIR 182
           EINST+ +CLKYVGGQMS+EME+PKIKWLK +M+  V+  C+F DL D+LT+KATG   R
Sbjct: 125 EINSTNDECLKYVGGQMSIEMELPKIKWLKRHMSKDVFARCEFYDLADYLTFKATGRKTR 184

Query: 183 SFCSAVCKQGLLPLGVEGSTKGWTEEFLLNIGLEDLMEDNFVKLGGPVKQDSQGKVSFST 242
           SFCS VCKQG++P+GVEGS  GW+++FL NI LE+L  +++ KLGG V   S G+ +F T
Sbjct: 185 SFCSVVCKQGMVPMGVEGSKLGWSKDFLRNIDLEELTYNDYAKLGGSV-SGSHGR-NFLT 242

Query: 243 AGEFIGYLSDKSSKIMGISSKCAVSSGIIDAYAGWIGTIAASTKEPIEQLNNFQDNLNGM 302
           AGE+I  L+D++ + + +S +C V SGIIDAYAGW+GT+ + T + +EQL        GM
Sbjct: 243 AGEYIAPLNDQAIEELELSKECIVGSGIIDAYAGWLGTVGSGTVD-LEQLFRV-----GM 296

Query: 303 ICSSGRLAVVAGTSTCHISLTNKPIFVPGVWGPYRDVLGHNFWCAEGGQSCTGALLQHVL 362
             + GRLA VAGTSTCHI L+  PIFVPGVWGPY+D +   +WC EGGQSCTGALLQHVL
Sbjct: 297 ANAIGRLAAVAGTSTCHIVLSKDPIFVPGVWGPYKDTITKGYWCTEGGQSCTGALLQHVL 356

Query: 363 ETHPAYKELCAISKQQDISVFEVLNNKIRELTHQRDLIDEVHLIKNLFFYGDFHGNRSPV 422
           +THP+YKEL  IS++  ++ F+ LN ++ E+  + +    + L K++FFYGD HGNRSP+
Sbjct: 357 QTHPSYKELEEISEKNGMNKFDYLNTRLAEMAKRSNERSVLCLAKHIFFYGDLHGNRSPL 416

Query: 423 ADEAMRGNIIGLSMDSSLNDLCRMYLGACEFIAQQTRHIVDIMTKSGYNLHSLYMSGGQC 482
           AD +M+G I+GLSMD+SL++L + YL ACEFIAQQ R I++ M  +G+ + ++YMSGGQC
Sbjct: 417 ADPSMKGAIVGLSMDTSLDNLAKTYLAACEFIAQQNRQIIEAMCDAGHEISAIYMSGGQC 476

Query: 483 RNELLMQLISNCVGLPVVIPKNIDTAVVFGSALMGACAS---ELSKSHSDNTKKPDQILW 539
           RN LLM+L+++C GL V+IP+ ID+AVVFG+A++GA AS   +L+ S SD     + ILW
Sbjct: 477 RNSLLMKLLADCSGLSVIIPEYIDSAVVFGAAILGASASKLYQLNGSESDTVINTENILW 536

Query: 540 DVMCKMT--GQGIVVSPQDPSSQVCKLLTVKYQIYLDMIATQKRYRSMVNGL 589
             M KMT  G  I+  P+D   ++  LL  KY+I+LDM   QKRYR++V+ +
Sbjct: 537 STMNKMTKVGSYIMPVPKDHPDRI--LLDAKYKIFLDMADRQKRYRAIVDAV 586

>KLLA0F19041g Chr6 complement(1753543..1755834) [2292 bp, 763 aa]
           {ON} similar to uniprot|Q04585 Saccharomyces cerevisiae
           YDR109C Hypothetical ORF
          Length = 763

 Score =  647 bits (1669), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/522 (60%), Positives = 391/522 (74%), Gaps = 8/522 (1%)

Query: 1   MSYYIGVDVGTGSARACLIDLNGDILSIKELAIDRQELKPGYITQSTXXXXXXXXXXXXX 60
           M YY+GVDVGTGSARAC+ID  G+ILS+ E  I R ELKP YITQS+             
Sbjct: 34  MVYYVGVDVGTGSARACVIDNLGNILSLAERPIQRHELKPNYITQSSQEIWNAICYCVKN 93

Query: 61  XLQESNVDDISSKIKGIGFDATCSLVVLNSKTDQEVAVGPNFEDNDQNVILWMDHRALIE 120
            +++S VD     I GIGFDATCSLVV+++  +++V VGP+F DN QN+ILWMDHRA+ E
Sbjct: 94  VVRDSGVD--PRTIHGIGFDATCSLVVVDN-NNEDVGVGPDFTDNLQNIILWMDHRAIEE 150

Query: 121 TVEINSTDSKCLKYVGGQMSVEMEIPKIKWLKNNMNPAVYKDCKFLDLPDFLTYKATGNS 180
           T EIN+T  KCLKYVGGQMSVEMEIPKIKWLKNN+    +  CKF DL D+LT+KATG+ 
Sbjct: 151 TEEINATGDKCLKYVGGQMSVEMEIPKIKWLKNNIPEKKFAQCKFFDLADYLTFKATGSE 210

Query: 181 IRSFCSAVCKQGLLPLGVEGSTKGWTEEFLLNIGLEDLMEDNFVKLGGPVKQDSQGKVSF 240
           IRS+CS VCKQGLLPLGVEGS  GW++EFL  IGLE+L+ D+F KLGG V +      +F
Sbjct: 211 IRSYCSTVCKQGLLPLGVEGSKNGWSKEFLQEIGLEELIADDFAKLGGSVTE-----TTF 265

Query: 241 STAGEFIGYLSDKSSKIMGISSKCAVSSGIIDAYAGWIGTIAASTKEPIEQLNNFQDNLN 300
            +AGE IG L+++S+  +G+S+ C V SG+IDAYAGW+GT+AA T   I  L    +  +
Sbjct: 266 LSAGECIGTLTEESAAELGLSTHCVVGSGVIDAYAGWVGTVAARTDVEIPALVKSDEVKH 325

Query: 301 GMICSSGRLAVVAGTSTCHISLTNKPIFVPGVWGPYRDVLGHNFWCAEGGQSCTGALLQH 360
           G+  ++GRLA VAGTSTCHI+++  PIFV GVWGPYRDV+   FW AEGGQSCTGALL H
Sbjct: 326 GIDRATGRLAAVAGTSTCHIAMSKDPIFVKGVWGPYRDVMAPGFWLAEGGQSCTGALLAH 385

Query: 361 VLETHPAYKELCAISKQQDISVFEVLNNKIRELTHQRDLIDEVHLIKNLFFYGDFHGNRS 420
           VL THPAY EL  +S   ++S F+ LN+++  L  QR     V L K+LFFYGD+HGNRS
Sbjct: 386 VLTTHPAYAELSQLSDAANVSKFDYLNSRLELLAQQRKASSVVALAKHLFFYGDYHGNRS 445

Query: 421 PVADEAMRGNIIGLSMDSSLNDLCRMYLGACEFIAQQTRHIVDIMTKSGYNLHSLYMSGG 480
           P+AD +MR  IIG SMD+S++DL  MYLGACEFIAQQTR IV+ M  SG+ L +++MSGG
Sbjct: 446 PIADPSMRAAIIGQSMDNSIDDLSIMYLGACEFIAQQTRQIVEQMCNSGHELAAIFMSGG 505

Query: 481 QCRNELLMQLISNCVGLPVVIPKNIDTAVVFGSALMGACASE 522
           QCRN LLM+L+++C GLP+VIP+ ID AVVFGSAL+GA ASE
Sbjct: 506 QCRNGLLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASE 547

 Score = 54.3 bits (129), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 34/50 (68%)

Query: 538 LWDVMCKMTGQGIVVSPQDPSSQVCKLLTVKYQIYLDMIATQKRYRSMVN 587
           LW+VM  MTG G VV P +  +    LL  KY+I+LDM ATQ++YR +V+
Sbjct: 711 LWEVMYNMTGGGKVVWPTEEDAPDRLLLNAKYKIFLDMAATQQKYRKLVD 760

>ZYRO0C01782g Chr3 (137232..139424) [2193 bp, 730 aa] {ON} similar
           to uniprot|Q04585 Saccharomyces cerevisiae YDR109C
           Hypothetical ORF
          Length = 730

 Score =  645 bits (1665), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/532 (59%), Positives = 393/532 (73%), Gaps = 3/532 (0%)

Query: 1   MSYYIGVDVGTGSARACLIDLNGDILSIKELAIDRQELKPGYITQSTXXXXXXXXXXXXX 60
           M YYIGVDVGTGSARACLID  G+I+S+ E  I R+ELKP YITQS+             
Sbjct: 31  MIYYIGVDVGTGSARACLIDSMGNIMSLAEKPIQREELKPTYITQSSKEIWSAICYCVKT 90

Query: 61  XLQESNVDDISSKIKGIGFDATCSLVVLNSKTDQEVAVGPNFEDNDQNVILWMDHRALIE 120
            +++S VD    +I GIGFDATCSLV +NSK   +V VGP+FE+ DQN+ILWMDHRA+ E
Sbjct: 91  VVRDSGVD--IERIHGIGFDATCSLVAVNSKDGADVPVGPDFENPDQNIILWMDHRAVQE 148

Query: 121 TVEINSTDSKCLKYVGGQMSVEMEIPKIKWLKNNMNPAVYKDCKFLDLPDFLTYKATGNS 180
           T EINST+   LKYVGGQMS+EMEIPKIKWLKN+M    + D  F DL DFLTYKATG  
Sbjct: 149 TAEINSTNHPVLKYVGGQMSIEMEIPKIKWLKNHMPREKFNDTVFFDLADFLTYKATGLG 208

Query: 181 IRSFCSAVCKQGLLPLGVEGSTKGWTEEFLLNIGLEDLMEDNFVKLGGPVK-QDSQGKVS 239
            RSF S+VCKQGLLPLGVEGS  GW+ EFL  I L +L+ ++F KLGG VK +    + +
Sbjct: 209 TRSFNSSVCKQGLLPLGVEGSNNGWSGEFLNLIDLPELVANDFAKLGGSVKPKGDDHRSN 268

Query: 240 FSTAGEFIGYLSDKSSKIMGISSKCAVSSGIIDAYAGWIGTIAASTKEPIEQLNNFQDNL 299
           F +AG+++G LS +++  +G++  C V SG+IDAYAGW+GT+AA T E I +L   +   
Sbjct: 269 FLSAGQYVGALSPEAAADLGLADHCVVGSGVIDAYAGWVGTVAAQTDEEIPELAKCEKGK 328

Query: 300 NGMICSSGRLAVVAGTSTCHISLTNKPIFVPGVWGPYRDVLGHNFWCAEGGQSCTGALLQ 359
            G+  ++GRLA VAGTSTCH++L+  PIFVPGVWGPYRDV+   FWCAEGGQSCTGALL 
Sbjct: 329 LGVDKATGRLAAVAGTSTCHVALSRDPIFVPGVWGPYRDVMAPGFWCAEGGQSCTGALLA 388

Query: 360 HVLETHPAYKELCAISKQQDISVFEVLNNKIRELTHQRDLIDEVHLIKNLFFYGDFHGNR 419
           HVL THPAY +L  +S+   +S F+ LN+++  L + R     V L K+LFFYGD+HGNR
Sbjct: 389 HVLSTHPAYTDLEHLSESAGLSKFDYLNSRLEYLVNARKERSVVALAKHLFFYGDYHGNR 448

Query: 420 SPVADEAMRGNIIGLSMDSSLNDLCRMYLGACEFIAQQTRHIVDIMTKSGYNLHSLYMSG 479
           SP+AD  MR  IIG SMD+S++DL   YLGACEFIAQQTR IV+IM KSG+N+ S++MSG
Sbjct: 449 SPIADNTMRAAIIGQSMDNSVDDLALQYLGACEFIAQQTRQIVEIMCKSGHNISSIFMSG 508

Query: 480 GQCRNELLMQLISNCVGLPVVIPKNIDTAVVFGSALMGACASELSKSHSDNT 531
           GQCRN LLM+L+++C GLP++IP+ ID AVVFGSAL+GA ASE   +H   T
Sbjct: 509 GQCRNGLLMRLLADCTGLPIIIPRYIDAAVVFGSALLGAVASESYNAHHTKT 560

 Score = 51.6 bits (122), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 35/58 (60%)

Query: 530 NTKKPDQILWDVMCKMTGQGIVVSPQDPSSQVCKLLTVKYQIYLDMIATQKRYRSMVN 587
           +T    + LW VM  MTG G VV P   ++    LL  KY+I+LDM  TQ++YRS ++
Sbjct: 661 DTNSNGEELWKVMYDMTGGGKVVRPNPDTNPDRVLLNAKYKIFLDMANTQRQYRSAID 718

>NCAS0B03870 Chr2 (689411..691201) [1791 bp, 596 aa] {ON} Anc_8.257
          Length = 596

 Score =  639 bits (1649), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/594 (53%), Positives = 422/594 (71%), Gaps = 22/594 (3%)

Query: 3   YYIGVDVGTGSARACLIDLNGDILSIKELAIDRQELKPGYITQSTXXXXXXXXXXXXXXL 62
           YY+G+DVGTGS RAC++D  G++LS+ E +I+R+ELKP +ITQST              +
Sbjct: 16  YYVGIDVGTGSVRACVVDSCGNMLSLVEKSINREELKPNFITQSTREIWQACCFCVKTAI 75

Query: 63  QESNVDDISSKIKGIGFDATCSLVVLNSKTDQEVAVGPNFEDNDQNVILWMDHRALIETV 122
           ++  VD   S + GIGFDATCSLV +   TD++V VGPNFE+ D NVILWMDHRA+ E  
Sbjct: 76  EQCKVD--KSLVLGIGFDATCSLVAIEKGTDKQVGVGPNFENRDMNVILWMDHRAVKEAN 133

Query: 123 EINSTDSKCLKYVGGQMSVEMEIPKIKWLKNNMNPAVYKDCKFLDLPDFLTYKATGNSIR 182
           EIN+T+ KCLKYVGG MSVEM+IPKIKWLKNNM+P ++K C+F +L D+LT+KATG   R
Sbjct: 134 EINATNDKCLKYVGGAMSVEMDIPKIKWLKNNMDPNMFKKCEFFELADYLTFKATGKRTR 193

Query: 183 SFCSAVCKQGLLPLGVEGSTKGWTEEFLLNIGLEDLMEDNFVKLGGPVKQDSQGKVSFST 242
           SFCS VCKQG LP GVEGS++GW++EFL +IGLEDL  +++  LGG +K DSQ   +F +
Sbjct: 194 SFCSVVCKQGFLPNGVEGSSEGWSKEFLSSIGLEDLAGNSYDSLGGALKNDSQD--NFQS 251

Query: 243 AGEFIGYLSDKSSKIMGISSKCAVSSGIIDAYAGWIGTIAASTKEPIEQLNNFQDNLNGM 302
           +G+ +G LS+++   +G+S  C V +GIIDAYAG IGTIAA T E   Q+ N  D+  G+
Sbjct: 252 SGKCLGPLSNEAVIELGLSENCVVGAGIIDAYAGLIGTIAA-TSEGSHQIKN--DSSIGL 308

Query: 303 ICSSGRLAVVAGTSTCHISLTNKPIFVPGVWGPYRDVLGHNFWCAEGGQSCTGALLQHVL 362
             + GRLA VAGTSTCH+ L+  P+FVPGVWGPYRDV+   +WCAEGGQ+CTG LL +VL
Sbjct: 309 QNAIGRLASVAGTSTCHLLLSKDPVFVPGVWGPYRDVVADGYWCAEGGQTCTGELLSYVL 368

Query: 363 ETHPAYKELCAISKQQDISVFEVLNNKIRELTHQRDLIDEVHLIKNLFFYGDFHGNRSPV 422
             HPA+KEL   S    I  F+ LNN + ELT +  +  ++ L K++FFYGD+ GNRSP 
Sbjct: 369 SIHPAFKELINASGVAKIDKFQYLNNMLDELTIKHKVNSKLQLAKHIFFYGDYRGNRSPY 428

Query: 423 ADEAMRGNIIGLSMDSSLNDLCRMYLGACEFIAQQTRHIVDIMTKSGYNLHSLYMSGGQC 482
           AD  M   IIG SM+ +L +L   YL ACEFIAQQTR IV+ + K+G ++  +YMSGGQC
Sbjct: 429 ADPMMSAAIIGQSMNHNLENLAVTYLAACEFIAQQTRQIVETIRKAGTHVSYIYMSGGQC 488

Query: 483 RNELLMQLISNCVGLPVVIPKNIDTAVVFGSALMGACASELSKSHSDNTKKPDQI----- 537
           RN+LLM+L+S+C GLP+++PK +D AVVFG+A++GA A        D ++K  +I     
Sbjct: 489 RNKLLMKLLSDCTGLPIMLPKYVDAAVVFGAAILGATA--------DASRKSVEIECDFG 540

Query: 538 --LWDVMCKMTGQGIVVSPQDPSSQVCKLLTVKYQIYLDMIATQKRYRSMVNGL 589
             LW+ M +MT  G ++ P D +    KLL VKYQI+LDM  TQ++YR MV+ +
Sbjct: 541 FMLWETMDRMTPHGTLLEPNDVNHPDRKLLDVKYQIFLDMAETQRKYRQMVDDI 594

>Ecym_4313 Chr4 (672950..674743) [1794 bp, 597 aa] {ON} similar to
           Ashbya gossypii AGR092W
          Length = 597

 Score =  639 bits (1647), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/603 (53%), Positives = 416/603 (68%), Gaps = 29/603 (4%)

Query: 1   MSYYIGVDVGTGSARACLIDLNGDILSIKELAIDRQELKPGYITQSTXXXXXXXXXXXXX 60
           + +YIGVDVGT S RAC++D++G ILS+    I RQE++P Y+TQS+             
Sbjct: 2   LQHYIGVDVGTESVRACVVDVHGTILSLASKPISRQEIQPNYLTQSSNEIWRAICFCIRK 61

Query: 61  XLQESNVDDISSKIKGIGFDATCSLVVLNSKTDQEVAVGPNFEDNDQNVILWMDHRALIE 120
            + +S V  +   I GIGFDATCSLVVL   T++ VAVGPNF+D +Q++ILWMDHRA+ E
Sbjct: 62  IICDSQV--VKDSIIGIGFDATCSLVVLEEVTNKGVAVGPNFDDFEQDIILWMDHRAIDE 119

Query: 121 TVEINSTDSKCLKYVGGQMSVEMEIPKIKWLKNNMNPAVYKDCKFLDLPDFLTYKATGNS 180
             EINST  +CLKYVGG+MS+EM+IPKIKWLKNN+    +  C+F DLPDFLTY+ATGN 
Sbjct: 120 VNEINSTGHRCLKYVGGKMSIEMQIPKIKWLKNNLPQGKFDKCEFYDLPDFLTYRATGNK 179

Query: 181 IRSFCSAVCKQGLLPLGVEGSTKGWTEEFLLNIGLEDLMEDNFVKLGGPVKQDSQGKVSF 240
            RSFCS VCK GLLPLGV+GSTKGW ++   +IGL +L    F KLGG V   S    +F
Sbjct: 180 CRSFCSTVCKMGLLPLGVDGSTKGWPQDLFEDIGLAELCRREFSKLGGVV---SSTASNF 236

Query: 241 STAGEFIGYLSDKSSKIMGISSKCAVSSGIIDAYAGWIGTIAASTKEPIEQLNNFQDNLN 300
            +AG+++G+LSD+++  +G+++KC V+SG+IDAYAGW+GTIAA        +    D   
Sbjct: 237 LSAGDYVGHLSDEAAADLGLTTKCIVASGLIDAYAGWVGTIAAG-------ITLGSDGQE 289

Query: 301 GMICSSGRLAVVAGTSTCHISLTNKPIFVPGVWGPYRDVLGHNFWCAEGGQSCTGALLQH 360
             + SS RLA VAGTSTCHI+++  P F+ GVWGPYRD L   +W  EGGQSCTGALL H
Sbjct: 290 SELASS-RLATVAGTSTCHITISKCPHFMDGVWGPYRDALMPGYWVTEGGQSCTGALLAH 348

Query: 361 VLETHPAYKELCAISKQQDISVFEVLNNKIRELTHQRDLIDEVHLIKNLFFYGDFHGNRS 420
           VL++HPAY  LC ++K Q IS F+ +NN++ EL  +R       L K+LFFYGD+HGNRS
Sbjct: 349 VLKSHPAYDTLCKLAKNQGISKFDFINNRLEELKEERGAQSVAALGKHLFFYGDYHGNRS 408

Query: 421 PVADEAMRGNIIGLSMDSSLNDLCRMYLGACEFIAQQTRHIVDIMTKSGYNLHSLYMSGG 480
           P+AD  MR  IIG SMD S++DL  M LGACEFIAQQTR IV+ + +SG+ + S+YMSGG
Sbjct: 409 PIADPNMRATIIGQSMDVSVDDLAIMTLGACEFIAQQTRQIVEHIKQSGHEITSIYMSGG 468

Query: 481 QCRNELLMQLISNCVGLPVVIPKNIDTAVVFGSALMGACASE---------------LSK 525
           QCRN +L++L++NC  LP+V+PK ID AVVFGSAL+G  ASE               + +
Sbjct: 469 QCRNLVLIKLLANCTKLPIVLPKYIDAAVVFGSALLGVAASEKYLHGCSDTASVSTIVDQ 528

Query: 526 SHSDNTKKPDQ-ILWDVMCKMTGQGIVVSPQDPSSQVCKLLTVKYQIYLDMIATQKRYRS 584
               +  KP Q ILW VM  +TG G ++ P +      +LL  KY+I+LDMI TQKRYR 
Sbjct: 529 QRITSELKPKQSILWTVMANLTGIGQIIEPSNMLDSEIRLLDQKYEIFLDMIETQKRYRD 588

Query: 585 MVN 587
           +V 
Sbjct: 589 LVT 591

>KAFR0B05560 Chr2 (1138380..1140197) [1818 bp, 605 aa] {ON}
           Anc_8.257 YDR109C
          Length = 605

 Score =  637 bits (1644), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/590 (52%), Positives = 415/590 (70%), Gaps = 15/590 (2%)

Query: 3   YYIGVDVGTGSARACLIDLNGDILSIKELAIDRQELKPGYITQSTXXXXXXXXXXXXXXL 62
           ++IGVDVGTGS RAC+ID  GDIL++ +  I R+ELKPG+ITQS+              +
Sbjct: 20  HFIGVDVGTGSVRACVIDRKGDILALVDKPISREELKPGFITQSSEEIWDSICFCVRKVI 79

Query: 63  QESNVDDISSKIKGIGFDATCSLVVLNSKTDQEVAVGPNFEDNDQNVILWMDHRALIETV 122
            ++ +   ++K+ GIGFDATCSL V++  T + +AVGP F  NDQN+I+WMDHRA  ET 
Sbjct: 80  ADAKIP--ANKVIGIGFDATCSLAVVDKDTLEGLAVGPQFSKNDQNIIMWMDHRASQETD 137

Query: 123 EINSTDSKCLKYVGGQMSVEMEIPKIKWLKNNMNPAVYKDCKFLDLPDFLTYKATGNSIR 182
           EINS     LKYVGG+MS+EME+PKIKWLKN+M    ++   F DLPD+LT+KATG   R
Sbjct: 138 EINSIYDAPLKYVGGKMSIEMEMPKIKWLKNHMPRETFRKAVFFDLPDYLTFKATGMQNR 197

Query: 183 SFCSAVCKQGLLPLGVEGSTKGWTEEFLLNIGLEDLMEDNFVKLGGPVKQDSQGKVSFST 242
           S CSAVCKQGLLP+GVEGST+GW+  FL N GL +L+E+ F ++GGP         +F +
Sbjct: 198 SLCSAVCKQGLLPIGVEGSTEGWSRTFLSNTGLPELIENEFERIGGP----GNNSRNFLS 253

Query: 243 AGEFIGYLSDKSSKIMGISSKCAVSSGIIDAYAGWIGTIAASTKEPIEQLNNFQDNLNGM 302
           AGE++  LS  S + +G++  C V SG+IDAYAG IGTIAA     I++    QD+ NG 
Sbjct: 254 AGEYVSTLSKSSGEQLGLTESCVVGSGLIDAYAGLIGTIAAR----IDESARTQDDANGQ 309

Query: 303 ICSS--GRLAVVAGTSTCHISLTNKPIFVPGVWGPYRDVLGHNFWCAEGGQSCTGALLQH 360
              +  GRLA VAGTSTCHI+L++KPIFV GVWGPY+D+L  ++WCAEGGQSCTG LL+H
Sbjct: 310 DLQNAIGRLAAVAGTSTCHITLSDKPIFVNGVWGPYKDILAKDYWCAEGGQSCTGELLKH 369

Query: 361 VLETHPAYKELCAISKQQDISVFEVLNNKIRELTHQRDLIDEVHLIKNLFFYGDFHGNRS 420
           V+ THPAY+EL   + +  + +FE LN  IR+L  Q+     + L K LF YGD+HGNRS
Sbjct: 370 VITTHPAYEELKIKAAKSKLDLFECLNEIIRDLAEQKGTCTILELTKGLFLYGDYHGNRS 429

Query: 421 PVADEAMRGNIIGLSMDSSLNDLCRMYLGACEFIAQQTRHIVDIMTKSGYNLHSLYMSGG 480
           P+AD  MR +IIG SMD+++  L  +YL ACEFIA QTRHI+  M ++G+++ S+YMSGG
Sbjct: 430 PIADPRMRASIIGQSMDTTVESLALIYLAACEFIAHQTRHIITKMNEAGHSIRSIYMSGG 489

Query: 481 QCRNELLMQLISNCVGLPVVIPKNIDTAVVFGSALMGACASEL---SKSHSDNTKKPDQI 537
           QCRN +LM+L+++  GLPVVIPK ID AVVFG+AL+GA A ++    +++ D   + +  
Sbjct: 490 QCRNNILMELLADFTGLPVVIPKYIDAAVVFGAALIGATAWDVFNQCETNDDRVPQVEHT 549

Query: 538 LWDVMCKMTGQGIVVSPQDPSSQVCKLLTVKYQIYLDMIATQKRYRSMVN 587
           LW+ M KMTG G  ++P+        LL  KY+IY+DM  TQK+YRS+++
Sbjct: 550 LWNAMVKMTGNGTTIAPKVNRHASQALLNTKYKIYMDMAKTQKKYRSLID 599

>CAGL0B01727g Chr2 complement(159373..161106) [1734 bp, 577 aa] {ON}
           similar to uniprot|Q04585 Saccharomyces cerevisiae
           YDR109c
          Length = 577

 Score =  636 bits (1640), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/586 (54%), Positives = 411/586 (70%), Gaps = 14/586 (2%)

Query: 1   MSYYIGVDVGTGSARACLIDLNGDILSIKELAIDRQELKPGYITQSTXXXXXXXXXXXXX 60
           M YYIGVDVG+GS RAC++D  G +LS+    I ++E  PG++TQS+             
Sbjct: 1   MGYYIGVDVGSGSVRACVVDDQGAMLSMATRDISKEEKLPGHVTQSSNEIWDAVCYCVKS 60

Query: 61  XLQESNVDDISSKIKGIGFDATCSLVVLNSKTDQEVAVGPNFEDNDQNVILWMDHRALIE 120
            +  SNV++    I GIGFDATCSLVVLN  + + VA GPNF++N+QN+I+WMDHRA+ E
Sbjct: 61  AIGNSNVNN--GDILGIGFDATCSLVVLNKDSFEPVAAGPNFDNNNQNIIMWMDHRAIEE 118

Query: 121 TVEINSTDSKCLKYVGGQMSVEMEIPKIKWLKNNMNPAVYKDCKFLDLPDFLTYKATGNS 180
           T EIN +   CLKYVGGQMSVEMEIPKIKWLKN+M P  +K   F+DLPD+LT+ A+G +
Sbjct: 119 TKEINRSGDPCLKYVGGQMSVEMEIPKIKWLKNHMAPEEFKKLVFMDLPDYLTFMASGVN 178

Query: 181 IRSFCSAVCKQGLLPLGVEGSTKGWTEEFLLNIGLEDLMEDNFVKLGGPVKQDSQGKVSF 240
            RS+CSAVCKQG LP GVEGS+KGW+ EFL  IGLE++ + NF  LGGP +  +     F
Sbjct: 179 TRSYCSAVCKQGFLPKGVEGSSKGWSTEFLTKIGLEEISQSNFNALGGPNESGN-----F 233

Query: 241 STAGEFIGYLSDKSSKIMGISSKCAVSSGIIDAYAGWIGTIAASTKEPIEQLNNFQDNLN 300
           + AG  +  +S+   K   I+  C V SGIIDAYAGWIGT+A+ST   IE  NN ++ ++
Sbjct: 234 TYAGNQLSTVSESFIKSTNINPGCIVGSGIIDAYAGWIGTVASST---IEVPNN-KEVVD 289

Query: 301 GMICSSGRLAVVAGTSTCHISLTNKPIFVPGVWGPYRDVLGHNFWCAEGGQSCTGALLQH 360
              C+ GRLA VAGTSTCHI L+   IFVPGVWGPYRDVL  ++WCAEGGQS TGALL H
Sbjct: 290 IEECA-GRLAAVAGTSTCHIVLSKTSIFVPGVWGPYRDVLVPDYWCAEGGQSFTGALLAH 348

Query: 361 VLETHPAYKELCAISKQQDISVFEVLNNKIRELTHQRDLIDEVHLIKNLFFYGDFHGNRS 420
           +L  HP+  EL  + KQ+++  F  LNN I EL+ + +L   + L K+ F YGD+HGNRS
Sbjct: 349 ILSIHPSANELSNLVKQRNVDKFSFLNNYILELSRKNNLETPLLLTKDFFLYGDYHGNRS 408

Query: 421 PVADEAMRGNIIGLSMDSSLNDLCRMYLGACEFIAQQTRHIVDIMTKSGYNLHSLYMSGG 480
           P+AD  MR  IIG SMD+S++DL R YL ACEFIA QT+HI+D +  +G+ + ++YMSGG
Sbjct: 409 PIADPNMRAAIIGQSMDTSMDDLARTYLAACEFIAHQTKHIIDTLMNAGHTIKAIYMSGG 468

Query: 481 QCRNELLMQLISNCVGLPVVIPKNIDTAVVFGSALMGACASELSKSHSDNTKKPDQILWD 540
           QCRN +LMQLI+NC GLP++IPK ID+AVVFGSA++GA A   SK++SD  K    +LW 
Sbjct: 469 QCRNNILMQLIANCTGLPLIIPKYIDSAVVFGSAILGAMAYSSSKNNSD--KGGADLLWS 526

Query: 541 VMCKMTGQGIVVSPQDPSSQVCKLLTVKYQIYLDMIATQKRYRSMV 586
            M  MT  G  V P    S   KL+ VK++I+LDM  TQ+ YR +V
Sbjct: 527 TMSNMTPDGTTVFPATEDSIERKLINVKHKIFLDMAKTQQTYRQLV 572

>Skud_4.370 Chr4 complement(645143..647287) [2145 bp, 714 aa] {ON}
           YDR109C (REAL)
          Length = 714

 Score =  638 bits (1645), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/522 (57%), Positives = 387/522 (74%), Gaps = 6/522 (1%)

Query: 1   MSYYIGVDVGTGSARACLIDLNGDILSIKELAIDRQELKPGYITQSTXXXXXXXXXXXXX 60
           + +Y+GVDVGTGSARAC+ID +G++LS+ E  I R+EL+P +ITQS+             
Sbjct: 37  VKFYVGVDVGTGSARACIIDQSGNMLSLAEKPIKREELRPNFITQSSREIWDAVCHCVKA 96

Query: 61  XLQESNVDDISSKIKGIGFDATCSLVVLNSKTDQEVAVGPNFEDNDQNVILWMDHRALIE 120
            +QES VD    ++ G+GFDATCSLVV+++   + VAVGP+F  NDQN+ILWMDHRA+ E
Sbjct: 97  VIQESRVD--PDRVHGMGFDATCSLVVVSATDAKGVAVGPDFTKNDQNIILWMDHRAMKE 154

Query: 121 TVEINSTDSKCLKYVGGQMSVEMEIPKIKWLKNNMNPAVYKDCKFLDLPDFLTYKATGNS 180
           T EINS++ KCLKYVGGQMSVEMEIPKIKWLKNN+   +++DCKF DLPD+LT+KATG  
Sbjct: 155 TEEINSSEDKCLKYVGGQMSVEMEIPKIKWLKNNLRSELFQDCKFFDLPDYLTFKATGKE 214

Query: 181 IRSFCSAVCKQGLLPLGVEGSTKGWTEEFLLNIGLEDLMEDNFVKLGGPVKQDSQGKVSF 240
            RSF SAVCKQG LP GVEGS  GW+EEFL  IGL +L+E +F KLGG ++     K +F
Sbjct: 215 NRSFSSAVCKQGFLPAGVEGSNLGWSEEFLNTIGLSELIESDFEKLGGSLRH----KKNF 270

Query: 241 STAGEFIGYLSDKSSKIMGISSKCAVSSGIIDAYAGWIGTIAASTKEPIEQLNNFQDNLN 300
            +AGE IG L  K+++ +G++  C VSSG+IDAYAGW+GT+AA  + PI  L   +DN  
Sbjct: 271 LSAGECIGSLDWKAARELGLTENCVVSSGLIDAYAGWVGTVAAKPESPIRGLAENEDNTY 330

Query: 301 GMICSSGRLAVVAGTSTCHISLTNKPIFVPGVWGPYRDVLGHNFWCAEGGQSCTGALLQH 360
               + GRLA VAGTSTCHI L+  PIFV G+WGPYRDVL   FW AEGGQSCTG LL H
Sbjct: 331 NYNGAIGRLAAVAGTSTCHILLSKDPIFVHGIWGPYRDVLARGFWAAEGGQSCTGVLLDH 390

Query: 361 VLETHPAYKELCAISKQQDISVFEVLNNKIRELTHQRDLIDEVHLIKNLFFYGDFHGNRS 420
           V++ HPAY EL  ++    +S FE LN+ +  +  +R+    + L ++LFFYGD+HGNRS
Sbjct: 391 VIKIHPAYTELSQLTNAAGVSKFEYLNSMLETMVKKRNERSVISLARHLFFYGDYHGNRS 450

Query: 421 PVADEAMRGNIIGLSMDSSLNDLCRMYLGACEFIAQQTRHIVDIMTKSGYNLHSLYMSGG 480
           P+AD  MR  IIG SMD+S+ DL   YL ACEFI+QQTR IV++M KSG+ + +++MSGG
Sbjct: 451 PIADSNMRACIIGQSMDNSVEDLAITYLSACEFISQQTRQIVEVMLKSGHKIDAIFMSGG 510

Query: 481 QCRNELLMQLISNCVGLPVVIPKNIDTAVVFGSALMGACASE 522
           QCRN+LL +L+++C GLP+VIP+ ID AVVFGSAL+GA ASE
Sbjct: 511 QCRNDLLTRLLADCSGLPIVIPRYIDGAVVFGSALLGAAASE 552

 Score = 56.2 bits (134), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 27/53 (50%), Positives = 33/53 (62%)

Query: 537 ILWDVMCKMTGQGIVVSPQDPSSQVCKLLTVKYQIYLDMIATQKRYRSMVNGL 589
           ILW VM ++TG    V+P   +     LL  KYQI+LDM  TQKRYR MV+ L
Sbjct: 656 ILWKVMQELTGDAKAVNPNKATHPDRILLDTKYQIFLDMAETQKRYRHMVDNL 708

>YDR109C Chr4 complement(673520..675667) [2148 bp, 715 aa] {ON}
           Putative kinase
          Length = 715

 Score =  635 bits (1638), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/523 (57%), Positives = 392/523 (74%), Gaps = 12/523 (2%)

Query: 3   YYIGVDVGTGSARACLIDLNGDILSIKELAIDRQELKPGYITQSTXXXXXXXXXXXXXXL 62
           +Y+GVDVGTGSARAC+ID +G++LS+ E  I R++L   +ITQS+              +
Sbjct: 39  FYVGVDVGTGSARACVIDQSGNMLSLAEKPIKREQLISNFITQSSREIWNAVCYCVRTVV 98

Query: 63  QESNVDDISSKIKGIGFDATCSLVVLNSKTDQEVAVGPNFEDNDQNVILWMDHRALIETV 122
           +ES VD    +++GIGFDATCSLVV+++   +E+AVGP+F +NDQN+ILWMDHRA+ ET 
Sbjct: 99  EESGVD--PERVRGIGFDATCSLVVVSATNFEEIAVGPDFTNNDQNIILWMDHRAMKETE 156

Query: 123 EINSTDSKCLKYVGGQMSVEMEIPKIKWLKNNMNPAVYKDCKFLDLPDFLTYKATGNSIR 182
           EINS+  KCLKYVGGQMSVEMEIPKIKWLKNN+   +++DCKF DLPD+LT+KATG   R
Sbjct: 157 EINSSGDKCLKYVGGQMSVEMEIPKIKWLKNNLEAGIFQDCKFFDLPDYLTFKATGKENR 216

Query: 183 SFCSAVCKQGLLPLGVEGSTKGWTEEFLLNIGLEDLMEDNFVKLGGPVKQDSQGKVSFST 242
           SFCSAVCKQG LP+GVEGS  GW++EFL +IGL +L +++F +LGG +++    K +F T
Sbjct: 217 SFCSAVCKQGFLPVGVEGSDIGWSKEFLNSIGLSELTKNDFERLGGSLRE----KKNFLT 272

Query: 243 AGEFIGYLSDKSSKIMGISSKCAVSSGIIDAYAGWIGTIAASTKEPIEQL---NNFQDNL 299
           AGE I  L  K++  +G++  C VSSGIIDAYAGW+GT+AA  +  ++ L    N++ + 
Sbjct: 273 AGECISPLDKKAACQLGLTEHCVVSSGIIDAYAGWVGTVAAKPESAVKGLAETENYKKDF 332

Query: 300 NGMICSSGRLAVVAGTSTCHISLTNKPIFVPGVWGPYRDVLGHNFWCAEGGQSCTGALLQ 359
           NG I   GRLA VAGTSTCHI L+  PIFV GVWGPYRDVL   FW AEGGQSCTG LL 
Sbjct: 333 NGAI---GRLAAVAGTSTCHILLSKNPIFVHGVWGPYRDVLARGFWAAEGGQSCTGVLLD 389

Query: 360 HVLETHPAYKELCAISKQQDISVFEVLNNKIRELTHQRDLIDEVHLIKNLFFYGDFHGNR 419
           H++ THPA+ EL  ++    +S FE LN  +  L  +R +   + L K+LFFYGD+HGNR
Sbjct: 390 HLITTHPAFTELSHMANLAGVSKFEYLNKILETLVEKRKVRSVISLAKHLFFYGDYHGNR 449

Query: 420 SPVADEAMRGNIIGLSMDSSLNDLCRMYLGACEFIAQQTRHIVDIMTKSGYNLHSLYMSG 479
           SP+AD  MR  IIG SMD+S+ DL  MYL ACEFI+QQTR I+++M KSG+ +++++MSG
Sbjct: 450 SPIADPNMRACIIGQSMDNSIEDLAVMYLSACEFISQQTRQIIEVMLKSGHEINAIFMSG 509

Query: 480 GQCRNELLMQLISNCVGLPVVIPKNIDTAVVFGSALMGACASE 522
           GQCRN LLM+L+++C GLP+VIP+ +D AVVFGSAL+GA ASE
Sbjct: 510 GQCRNSLLMRLLADCTGLPIVIPRYVDAAVVFGSALLGAAASE 552

 Score = 55.1 bits (131), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 34/51 (66%)

Query: 537 ILWDVMCKMTGQGIVVSPQDPSSQVCKLLTVKYQIYLDMIATQKRYRSMVN 587
            LW VM ++TG   +V+P + +     LL  KYQI+LDMI TQ++YR MV+
Sbjct: 657 FLWKVMQELTGNARIVNPNEKTHPDRILLDTKYQIFLDMIETQRKYRRMVD 707

>TDEL0F03840 Chr6 complement(705363..707543) [2181 bp, 726 aa] {ON}
           Anc_8.257 YDR109C
          Length = 726

 Score =  625 bits (1613), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/529 (56%), Positives = 386/529 (72%), Gaps = 5/529 (0%)

Query: 1   MSYYIGVDVGTGSARACLIDLNGDILSIKELAIDRQELKPGYITQSTXXXXXXXXXXXXX 60
           M YY+GVDVGTGSARAC+ID  G+ILS+ E  I R+ELKP YITQS+             
Sbjct: 32  MIYYVGVDVGTGSARACIIDNTGNILSLAEKPIQREELKPNYITQSSQEIWQSICHCVKS 91

Query: 61  XLQESNVDDISSKIKGIGFDATCSLVVLNSKTDQEVAVGPNFEDNDQNVILWMDHRALIE 120
            +++S V     +I GIGFDATCSLVV++ + D+EV VGP F +NDQN++LWMDHRA+ E
Sbjct: 92  VVRDSGVP--VERIHGIGFDATCSLVVVDDE-DKEVGVGPVFANNDQNIVLWMDHRAIAE 148

Query: 121 TVEINSTDSKCLKYVGGQMSVEMEIPKIKWLKNNMNPAVYKDCKFLDLPDFLTYKATGNS 180
           T EIN+T+ KCLKYVGGQMSVEMEIPKIKWLKNN+    +  CKF DL D+LT+KAT   
Sbjct: 149 TNEINATNDKCLKYVGGQMSVEMEIPKIKWLKNNLPKEQFDKCKFFDLADYLTFKATNKD 208

Query: 181 IRSFCSAVCKQGLLPLGVEGSTKGWTEEFLLNIGLEDLMEDNFVKLGGPVKQDSQGKV-- 238
            RSFCS VCKQGL+P+GVEGS +GW+++FL  I L +L+E+ F +   P    +      
Sbjct: 209 TRSFCSTVCKQGLIPIGVEGSKEGWSKDFLNTINLPELVENVFCQDRWPATATAADGTTH 268

Query: 239 SFSTAGEFIGYLSDKSSKIMGISSKCAVSSGIIDAYAGWIGTIAASTKEPIEQLNNFQDN 298
           SF +AGE++G L +++++ +G+   C V SG+IDAYAGW+GT+AA T   +  L      
Sbjct: 269 SFLSAGEYVGALDEEAAEELGLPVHCVVGSGVIDAYAGWVGTVAAQTDVELPDLAEADRT 328

Query: 299 LNGMICSSGRLAVVAGTSTCHISLTNKPIFVPGVWGPYRDVLGHNFWCAEGGQSCTGALL 358
             G+  ++GRLA VAGTSTCHI+L+  P+FV GVWGPYRDV+ H FW AEGGQSCTGALL
Sbjct: 329 KKGIDRATGRLAAVAGTSTCHIALSRDPVFVNGVWGPYRDVMAHGFWAAEGGQSCTGALL 388

Query: 359 QHVLETHPAYKELCAISKQQDISVFEVLNNKIRELTHQRDLIDEVHLIKNLFFYGDFHGN 418
            HV+ THPA+ EL  +S   +IS F+ LN+++  L  QR     V L K+L+FYGD+HGN
Sbjct: 389 AHVMSTHPAFTELSHLSDAANISKFDYLNSRLETLVQQRGDRSVVALAKHLYFYGDYHGN 448

Query: 419 RSPVADEAMRGNIIGLSMDSSLNDLCRMYLGACEFIAQQTRHIVDIMTKSGYNLHSLYMS 478
           RSP+AD +MR  IIG SMD+S++DL  MYLGACEFIAQQTR IV+ M  +G+ + +++MS
Sbjct: 449 RSPIADPSMRAAIIGQSMDNSIDDLAIMYLGACEFIAQQTRQIVEKMCDAGHQISTIFMS 508

Query: 479 GGQCRNELLMQLISNCVGLPVVIPKNIDTAVVFGSALMGACASELSKSH 527
           GGQCRN LLM+L+++C GLP++IP+ ID AVVFGSAL+GA ASE   SH
Sbjct: 509 GGQCRNGLLMRLLADCTGLPIIIPRYIDAAVVFGSALLGAVASESFNSH 557

 Score = 53.5 bits (127), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 27/52 (51%), Positives = 36/52 (69%), Gaps = 4/52 (7%)

Query: 538 LWDVMCKMTGQGIVV--SPQDPSSQVCKLLTVKYQIYLDMIATQKRYRSMVN 587
           LWDVM +MTG G VV  SP+D   +V  LL  KY+I+LDM  +Q+RYR  ++
Sbjct: 669 LWDVMYQMTGGGKVVRPSPEDDPDRV--LLNAKYKIFLDMADSQRRYREAID 718

>Suva_2.269 Chr2 complement(467973..470150) [2178 bp, 725 aa] {ON}
           YDR109C (REAL)
          Length = 725

 Score =  623 bits (1607), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/529 (56%), Positives = 385/529 (72%), Gaps = 6/529 (1%)

Query: 3   YYIGVDVGTGSARACLIDLNGDILSIKELAIDRQELKPGYITQSTXXXXXXXXXXXXXXL 62
           +++GVDVGTGS RAC+ID  G ILS+ E  I R+E++  +ITQS+              L
Sbjct: 43  FHVGVDVGTGSTRACIIDQFGKILSLAEKPIKREEVRSNFITQSSKEIWDAVCHCVKAVL 102

Query: 63  QESNVDDISSKIKGIGFDATCSLVVLNSKTDQEVAVGPNFEDNDQNVILWMDHRALIETV 122
           QES VD    K+ GIGFDATCSLVV+++   + +AVGP+F +NDQN+ILWMDHRA+ ET 
Sbjct: 103 QESEVD--PKKVHGIGFDATCSLVVVSATDLKGIAVGPDFSNNDQNIILWMDHRAMKETE 160

Query: 123 EINSTDSKCLKYVGGQMSVEMEIPKIKWLKNNMNPAVYKDCKFLDLPDFLTYKATGNSIR 182
           EINST  KCLKYVGGQMSVEM+IPKIKWLKNN+   ++KDCKF +LPD+LT+KATG   R
Sbjct: 161 EINSTGDKCLKYVGGQMSVEMDIPKIKWLKNNLEAEIFKDCKFFNLPDYLTFKATGKENR 220

Query: 183 SFCSAVCKQGLLPLGVEGSTKGWTEEFLLNIGLEDLMEDNFVKLGGPVKQDSQGKVSFST 242
           SF SAVCKQG LP GVE S  GW+EEFL +IGL +L  ++F +LGG ++     K +F +
Sbjct: 221 SFASAVCKQGFLPAGVESSKLGWSEEFLNSIGLSELTTNDFERLGGSLRD----KKNFLS 276

Query: 243 AGEFIGYLSDKSSKIMGISSKCAVSSGIIDAYAGWIGTIAASTKEPIEQLNNFQDNLNGM 302
           AGE +G+L   S+  +G++  C V SGIIDAYAGW+GT+AA     I  L+  +   N +
Sbjct: 277 AGECVGFLDVNSACELGLTQHCIVGSGIIDAYAGWVGTVAAKPSSAIPGLSENEHEKNDI 336

Query: 303 ICSSGRLAVVAGTSTCHISLTNKPIFVPGVWGPYRDVLGHNFWCAEGGQSCTGALLQHVL 362
             + GRLA VAGTSTCHI L+  PIFV GVWGPYRDVL  NFW AEGGQSCTGALL HV+
Sbjct: 337 NSAIGRLAAVAGTSTCHILLSKDPIFVHGVWGPYRDVLARNFWTAEGGQSCTGALLAHVI 396

Query: 363 ETHPAYKELCAISKQQDISVFEVLNNKIRELTHQRDLIDEVHLIKNLFFYGDFHGNRSPV 422
           +THPA+ EL  ++    IS+FE LN+ +  L  +R+    V L K+ FFYGD+HGNRSP+
Sbjct: 397 KTHPAFTELSQLADAASISIFEYLNSMLETLVQKRNERSVVSLAKHFFFYGDYHGNRSPI 456

Query: 423 ADEAMRGNIIGLSMDSSLNDLCRMYLGACEFIAQQTRHIVDIMTKSGYNLHSLYMSGGQC 482
           AD  MR  IIG SMD+S+ DL   YLGACEFI+QQTR I++ M ++G+ + +++MSGGQC
Sbjct: 457 ADPNMRACIIGQSMDNSVEDLAVTYLGACEFISQQTRQIIEAMLENGHRIDAIFMSGGQC 516

Query: 483 RNELLMQLISNCVGLPVVIPKNIDTAVVFGSALMGACASELSKSHSDNT 531
           RN LLM+L+++C GLP++IP+ ID AVVFGSAL+GA ASE S   ++ T
Sbjct: 517 RNGLLMRLLADCTGLPIMIPRYIDAAVVFGSALLGAAASEASDLANEKT 565

 Score = 55.1 bits (131), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 35/51 (68%)

Query: 537 ILWDVMCKMTGQGIVVSPQDPSSQVCKLLTVKYQIYLDMIATQKRYRSMVN 587
           +LW VM ++TG+  VV+P D +     LL  KYQI+LDM   Q++YR+MV+
Sbjct: 664 LLWKVMQELTGEAKVVNPNDKTHPDRILLDTKYQIFLDMAENQRKYRNMVD 714

>Smik_4.355 Chr4 complement(634853..636967) [2115 bp, 704 aa] {ON}
           YDR109C (REAL)
          Length = 704

 Score =  613 bits (1582), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/524 (55%), Positives = 389/524 (74%), Gaps = 12/524 (2%)

Query: 3   YYIGVDVGTGSARACLIDLNGDILSIKELAIDRQELKPGYITQSTXXXXXXXXXXXXXXL 62
           +Y+GVDVGTGS RAC+ID +G+ILS+ E  I R+EL   +ITQS+              +
Sbjct: 30  FYVGVDVGTGSTRACIIDKSGNILSLAEKPIKREELLSNFITQSSREIWNAVCYCVRKVI 89

Query: 63  QESNVDDISSKIKGIGFDATCSLVVLNSKTDQEVAVGPNFEDNDQNVILWMDHRALIETV 122
           QE+ VD   ++I GIGFDATCSLVV+++   +E+AVGP+F +NDQN+ILWMDHRA+ ET 
Sbjct: 90  QEAGVD--PARIHGIGFDATCSLVVVSATDFKEIAVGPDFTNNDQNIILWMDHRAMKETE 147

Query: 123 EINSTDSKCLKYVGGQMSVEMEIPKIKWLKNNMNPAVYKDCKFLDLPDFLTYKATGNSIR 182
           EIN + + CLKYVGGQMSVEMEIPKIKWLKNN+   +++DCKF DLPD+LT++ATG   R
Sbjct: 148 EINFSGNTCLKYVGGQMSVEMEIPKIKWLKNNLESGIFQDCKFFDLPDYLTFRATGKENR 207

Query: 183 SFCSAVCKQGLLPLGVEGSTKGWTEEFLLNIGLEDLMEDNFVKLGGPVKQDSQGKVSFST 242
           SF S VCKQG LP GVEGS  GW+++FL +IGL +L +++F KLGG ++       +F +
Sbjct: 208 SFSSVVCKQGFLPEGVEGSNLGWSKQFLDSIGLSELTDNDFEKLGGSLRNQK----NFLS 263

Query: 243 AGEFIGYLSDKSSKIMGISSKCAVSSGIIDAYAGWIGTIAASTKEPIEQLN---NFQDNL 299
           AGE IG L  K+++ +G++  C VSSGIIDAYAGW+GT+AA  +  I+ L    +++ + 
Sbjct: 264 AGECIGPLDGKAARQLGLTEYCVVSSGIIDAYAGWVGTVAAKPESEIKGLTENEDYKHDF 323

Query: 300 NGMICSSGRLAVVAGTSTCHISLTNKPIFVPGVWGPYRDVLGHNFWCAEGGQSCTGALLQ 359
           NG I   GRLA VAGTSTCHI L+   IFV G+WGPYRDVL   FW AEGGQSCTG LL 
Sbjct: 324 NGAI---GRLAAVAGTSTCHILLSKSSIFVHGIWGPYRDVLARGFWAAEGGQSCTGVLLD 380

Query: 360 HVLETHPAYKELCAISKQQDISVFEVLNNKIRELTHQRDLIDEVHLIKNLFFYGDFHGNR 419
           HV+ THPA+ +L  ++   ++S FE LN+ +  L  +R     + L K+LFFYGD+ GNR
Sbjct: 381 HVITTHPAFSKLSQLADAANVSKFEYLNSVLENLVEKRKERSVIFLAKHLFFYGDYRGNR 440

Query: 420 SPVADEAMRGNIIGLSMDSSLNDLCRMYLGACEFIAQQTRHIVDIMTKSGYNLHSLYMSG 479
           SP+AD  MR  IIG SMD+S++DL  +YLGACEFI+QQTR I+++M KSG+ +++++MSG
Sbjct: 441 SPIADPNMRACIIGQSMDNSIDDLAVIYLGACEFISQQTRQIIEVMLKSGHAINAVFMSG 500

Query: 480 GQCRNELLMQLISNCVGLPVVIPKNIDTAVVFGSALMGACASEL 523
           GQCRN LLM+L+++C GLP+VIP+ ID AVVFGSAL+GA AS++
Sbjct: 501 GQCRNGLLMRLLADCTGLPIVIPRYIDGAVVFGSALLGAAASKV 544

 Score = 53.1 bits (126), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 32/51 (62%)

Query: 537 ILWDVMCKMTGQGIVVSPQDPSSQVCKLLTVKYQIYLDMIATQKRYRSMVN 587
           ILW VM ++TG   V+ P   +     LL  KYQI+LDM+ TQ+ YR MV+
Sbjct: 646 ILWKVMQELTGNAKVICPNTKTHPDRILLDTKYQIFLDMVETQRNYRRMVD 696

>TPHA0B03240 Chr2 (743153..744910) [1758 bp, 585 aa] {ON} Anc_8.257
           YDR109C
          Length = 585

 Score =  607 bits (1565), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/584 (51%), Positives = 408/584 (69%), Gaps = 8/584 (1%)

Query: 1   MSYYIGVDVGTGSARACLIDLNGDILSIKELAIDRQELKPGYITQSTXXXXXXXXXXXXX 60
           MS YIGVDVGTGSARAC+ + NG+IL+++   I +QEL+ G+ITQS+             
Sbjct: 1   MSNYIGVDVGTGSARACITNKNGEILAVEVKDISKQELQLGFITQSSNEIWDAILDIIKR 60

Query: 61  XLQESNVDDISSKIKGIGFDATCSLVVLNSKTDQEVAVGPNFEDNDQNVILWMDHRALIE 120
            +  SNVD   S I GI FDATCSLVV +  + + +AVGPNF+D++QN+ILWMDHRA  E
Sbjct: 61  VIDISNVD--PSSIDGIAFDATCSLVVFDKNSLEPIAVGPNFDDSNQNIILWMDHRAASE 118

Query: 121 TVEINSTDSKCLKYVGGQMSVEMEIPKIKWLKNNMNPAVYKDCKFLDLPDFLTYKATGNS 180
           T  INST+ K LKYVGG+MSVE E+PKIKWLK++++P  +  C FLDL DFLTYKATG  
Sbjct: 119 TDLINSTNDKRLKYVGGKMSVEFELPKIKWLKDHLSPETFHRCVFLDLADFLTYKATGKI 178

Query: 181 IRSFCSAVCKQGLLPLGVEGSTKGWTEEFLLNIGLEDLMEDNFVKLGGPVKQDSQGKVSF 240
           + SF SAVCKQGLLP GVEGS  GW++EFL  IGLE+L  +NF KLGG +        +F
Sbjct: 179 VHSFSSAVCKQGLLPTGVEGSKLGWSKEFLEKIGLEELSTNNFEKLGGSINLKEG---NF 235

Query: 241 STAGEFIGYLSDKSSKIMGISSKCAVSSGIIDAYAGWIGTIAASTKEPIEQLNNFQDNLN 300
              G+ +G++  K + +  + + C V +G+IDAY+GW+GT+A+   + +   ++    LN
Sbjct: 236 LIPGDLVGHVDKKFAGLANLPNHCVVGTGVIDAYSGWVGTVASDVSDRV--CSDSPQELN 293

Query: 301 GMICSSGRLAVVAGTSTCHISLTNKPIFVPGVWGPYRDVLGHNFWCAEGGQSCTGALLQH 360
            +  S GR+AVV+GTSTCHI L+ +P+F+ GVWGPYRDVL  N W  EGGQS TGALL +
Sbjct: 294 KIEGSLGRIAVVSGTSTCHIVLSKQPLFISGVWGPYRDVLAENMWATEGGQSFTGALLDN 353

Query: 361 VLETHPAYKELCAISKQQDISVFEVLNNKIRELTHQRDLIDEVHLIKNLFFYGDFHGNRS 420
           ++ETHPAY+EL  I+ +Q+ ++F  L+ K+ EL   R L    +L KN+F YGD++GNRS
Sbjct: 354 IIETHPAYQELERITSRQNKNIFVYLDEKLEELRVNRKLDSVFYLTKNMFIYGDYYGNRS 413

Query: 421 PVADEAMRGNIIGLSMDSSLNDLCRMYLGACEFIAQQTRHIVDIMTKSGYNLHSLYMSGG 480
           P+AD  M G IIG +MDSS+NDL   YL ACEFIA QTRHI+D +   G+ + ++YMSGG
Sbjct: 414 PLADPLMSGMIIGQTMDSSINDLAIKYLAACEFIALQTRHIIDTLVTHGHGITAIYMSGG 473

Query: 481 QCRNELLMQLISNCVGLPVVIPKNIDTAVVFGSALMGACASELSKSHSDNTKKP-DQILW 539
            C+N+LLM+LISNC  LP+V+ K ID++VVFG+A++G+ A++++    +  +   + +LW
Sbjct: 474 HCKNKLLMELISNCCVLPLVLSKYIDSSVVFGAAILGSVAAKINSMKENKLEYSLNDVLW 533

Query: 540 DVMCKMTGQGIVVSPQDPSSQVCKLLTVKYQIYLDMIATQKRYR 583
             M  MT +G ++ P+   S + K L  KY++YLDMI T  +YR
Sbjct: 534 SQMKLMTPKGTLMMPKSEKSVLRKYLQAKYEVYLDMIDTNIKYR 577

>KNAG0H03260 Chr8 (607908..609650) [1743 bp, 580 aa] {ON} Anc_8.257
           YDR109C
          Length = 580

 Score =  606 bits (1563), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/586 (52%), Positives = 398/586 (67%), Gaps = 19/586 (3%)

Query: 3   YYIGVDVGTGSARACLIDLNGDILSIKELAIDRQELKPGYITQSTXXXXXXXXXXXXXXL 62
           YYIGVDVGTGSARA ++  +G  L+++E  I RQEL+  +ITQS+              +
Sbjct: 6   YYIGVDVGTGSARAVMLQHDGAALALEEHPIKRQELRVDFITQSSSEIWSAVCHCVRGVV 65

Query: 63  QESNVDDISSKIKGIGFDATCSLVVLNSKTDQEVAVGPNFEDNDQNVILWMDHRALIETV 122
            +S V+     +KGIGFDATCSLV +++ T   V VGPNF+D+ QN+ILWMDHRA  ET 
Sbjct: 66  TKSGVN--PRLVKGIGFDATCSLVAVDAVTGDAVPVGPNFDDSTQNIILWMDHRATRETD 123

Query: 123 EINSTDSKCLKYVGGQMSVEMEIPKIKWLKNNMNPAVYKDCKFLDLPDFLTYKATGNSIR 182
            IN+T  +CLKYVGGQMSVEME+PKIKWLK +M    +  CKF DLPD+LT+ AT    R
Sbjct: 124 AINATGDRCLKYVGGQMSVEMELPKIKWLKGHMPRGQFTKCKFFDLPDYLTFMATAKDRR 183

Query: 183 SFCSAVCKQGLLPLGVEGSTKGWTEEFLLNIGLEDLMEDNFVKLGGPVKQDSQGKVSFST 242
           SFCSAVCKQGLLP GV+GS   W+ EFL  +GL +L++ NFV+LGG     S+ K  F T
Sbjct: 184 SFCSAVCKQGLLPPGVDGSEGHWSPEFLEAVGLSELIDTNFVQLGG----TSESKPKFLT 239

Query: 243 AGEFIGYLSDKSSKIMGISSKCAVSSGIIDAYAGWIGTIAASTKEPIEQLNNFQDNLNGM 302
           AG+ +G L+ ++S+  G+S+ C V+SG+IDAYAGWIG++ A   +            +G+
Sbjct: 240 AGQPVGQLTLEASEQFGLSTSCIVASGVIDAYAGWIGSVGAKFDQ--------SHKSSGL 291

Query: 303 ICSSGRLAVVAGTSTCHISLTNKPIFVPGVWGPYRDVLGHNFWCAEGGQSCTGALLQHVL 362
             +  RLA++AGTSTCHI L+  P FVPGVWGPYRDVL   +WCAEGGQSCTGALL H+L
Sbjct: 292 DVAITRLALIAGTSTCHIMLSKGPQFVPGVWGPYRDVLIPGYWCAEGGQSCTGALLAHIL 351

Query: 363 ETHPAYKELCAISKQQDISVFEVLNNKIRELTHQRDLIDEVHLIKNLFFYGDFHGNRSPV 422
           ETHPA++EL  ++ +Q +S FE L   +  L  +R + + + L ++ F YGDFHGNRSP+
Sbjct: 352 ETHPAHEELVRLAAKQQVSHFEYLGLMLDTLMMKRQVRNVLELSRSFFLYGDFHGNRSPL 411

Query: 423 ADEAMRGNIIGLSMDSSLNDLCRMYLGACEFIAQQTRHIVDIMTKSGYNLHSLYMSGGQC 482
           AD +MR  +IG SMD S+  L   YL ACEFIA QTR IV+ M ++G+ +  +YMSGGQC
Sbjct: 412 ADPSMRATVIGQSMDVSIESLAVEYLAACEFIALQTRQIVETMVRNGHVVECVYMSGGQC 471

Query: 483 RNELLMQLISNCVGLPVVIPKNIDTAVVFGSALMGACASE-LSKSHSDNTKKPDQILWDV 541
           RN LLMQLI++ VG+PVV+PK  D  VVFG+AL+  CAS+      +D + +    LWD+
Sbjct: 472 RNSLLMQLIADSVGVPVVLPKYTDCCVVFGAALLACCASKGCDGIEADQSTR----LWDI 527

Query: 542 MCKMTGQGIVVSPQDPSSQVCKLLTVKYQIYLDMIATQKRYRSMVN 587
           M  MT  G  V P D SS   K +  KY I+LDMI  QK YRS ++
Sbjct: 528 MTAMTPMGTRVLPNDDSSFERKYMDAKYGIFLDMIERQKLYRSQMD 573

>AGR092W Chr7 (908750..910540) [1791 bp, 596 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR109C and
           Non-syntenic homolog of Saccharomyces cerevisiae YNL249C
           (MPA43)
          Length = 596

 Score =  579 bits (1492), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/595 (49%), Positives = 386/595 (64%), Gaps = 23/595 (3%)

Query: 3   YYIGVDVGTGSARACLIDLNGDILSIKELAIDRQELKPGYITQSTXXXXXXXXXXXXXXL 62
           YY+GVDVGT  ARAC+ID +G IL+  +  I R + K  +ITQS+              +
Sbjct: 9   YYVGVDVGTEFARACIIDKSGAILATTQNPISRSQPKHDHITQSSSEIWGAVCKSVRAAV 68

Query: 63  QESNVDDISSKIKGIGFDATCSLVVLNSKTDQEVAVGPNFEDNDQNVILWMDHRALIETV 122
            ES V     ++ GI FDATCSLVVL+  +D EVAVGP+F DN QNVILWMDHRA+ E  
Sbjct: 69  AESQV--AVDEVAGINFDATCSLVVLDEDSDGEVAVGPDFSDNRQNVILWMDHRAVAEAS 126

Query: 123 EINSTDSKCLKYVGGQMSVEMEIPKIKWLKNNMNPAVYKDCKFLDLPDFLTYKATGNSIR 182
           EINST    L+YVGG+MSVEM++PKIKWL+ +M    +  CKF DLPDFLTY+ATG   R
Sbjct: 127 EINSTGHSVLRYVGGKMSVEMQMPKIKWLQRHMPRGEFAKCKFYDLPDFLTYQATGIESR 186

Query: 183 SFCSAVCKQGLLPLGVEGSTKGWTEEFLLNIGLEDLMEDNFVKLGGPVKQDSQGKVSFST 242
           SFCS VCK GL+P GV+ ST GW+ EFL  IGLE+L ED F +LGG +  D  G   F +
Sbjct: 187 SFCSTVCKMGLVPNGVDSSTSGWSREFLEQIGLEELCEDGFRRLGGAL--DEPGS-EFRS 243

Query: 243 AGEFIGYLSDKSSKIMGISSKCAVSSGIIDAYAGWIGTIAASTKEPIEQLNNFQDNLNGM 302
           AGE +G LS+ ++  +G++ +C V SG+IDAYAGW+GT+ AS     E          G+
Sbjct: 244 AGEPVGLLSEAAAASLGLTPRCVVGSGVIDAYAGWVGTVGASPDGARES--------GGV 295

Query: 303 ICSSGRLAVVAGTSTCHISLTNKPIFVPGVWGPYRDVLGHNFWCAEGGQSCTGALLQHVL 362
              +GRLA VAGTSTC I L+  P FV GVWGPYRDVL   +WC EGGQSCTGALL H L
Sbjct: 296 EELAGRLAAVAGTSTCLIMLSQTPHFVEGVWGPYRDVLARGYWCTEGGQSCTGALLAHTL 355

Query: 363 ETHPAYKELCAISKQQDISVFEVLNNKIRELTHQRDLIDEVHLIKNLFFYGDFHGNRSPV 422
            THPAY EL   ++Q+ ++ F+ +N ++ +L  +        L K+ F YGD+HGNRSP+
Sbjct: 356 HTHPAYTELHQAAQQRGLTDFDYINWRLDKLRAETGARSIRALAKHRFLYGDYHGNRSPL 415

Query: 423 ADEAMRGNIIGLSMDSSLNDLCRMYLGACEFIAQQTRHIVDIMTKSGYNLHSLYMSGGQC 482
           AD +MR  ++GLSMD S +DL    L A EFIA Q RHI+D M  +G ++ ++Y+SGGQ 
Sbjct: 416 ADPSMRAAMVGLSMDVSQDDLALAVLTAFEFIALQARHILDHMAAAGLHVDTVYLSGGQA 475

Query: 483 RNELLMQLISNCVGLPVVIPKNIDTAVVFGSALMGACASELSKSHSDNT----------K 532
           RN LL QL+++ V  PVV P+++  AVVFGSAL+ A A E   ++++ T          +
Sbjct: 476 RNPLLTQLLADAVRRPVVTPRHVGAAVVFGSALLAAAAVENYLANTNATASSILPSSASR 535

Query: 533 KPDQILWDVMCKMTGQGIVVSPQDPSSQVCKLLTVKYQIYLDMIATQKRYRSMVN 587
            P   LW +M ++T  G VVSP   +    +LL  KY+++L+M   QK YR +V+
Sbjct: 536 APMHRLWQIMSRLTVPGNVVSPSPDADPDIRLLEAKYKVFLEMAEAQKLYRKLVD 590

>YNL249C Chr14 complement(179394..181022) [1629 bp, 542 aa] {ON}
           MPA43Putative protein of unknown function; the
           authentic, non-tagged protein is detected in highly
           purified mitochondria in high-throughput studies
          Length = 542

 Score =  201 bits (510), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 168/603 (27%), Positives = 274/603 (45%), Gaps = 95/603 (15%)

Query: 5   IGVDVGTGSARACLIDLNGDILSIKELAIDRQELKPGYITQSTXX-----XXXXXXXXXX 59
           IG+DVG+ SAR  + +   D L   E+A   QE  P Y   S                  
Sbjct: 9   IGIDVGSSSARIGVYNYYNDAL--LEMA---QEPVPYYQDSSKKSWKFWQKSTEIIKALQ 63

Query: 60  XXLQESNVDDISSKIKGIGFDATCSLVVL-NSKTDQEVAVGPNFEDNDQNVILWMDHRAL 118
             LQ+ N+ +   ++K  G  ATCSL +    +T   +   PN    + NVI WMD  A+
Sbjct: 64  KCLQKLNIREY--EVKSCGVSATCSLAIFERDRTSNMLIPYPN----EDNVIFWMDSSAV 117

Query: 119 IETVEIN-STDSKCLKYVGGQMSVEMEIPKIKWLKNNMNPAVYKDCKFLDLPDFLTYKAT 177
            E   +N     + L Y+GG+   EM +PK+K+  +  +    K     DL  ++ Y+ +
Sbjct: 118 NECQWLNMQCPQQLLDYLGGKFVPEMGVPKLKYFLDEYSHLRDKHFHIFDLHQYIAYELS 177

Query: 178 GNSIRSFCSAVCKQGLLPLGVEGSTKGWTEEFLLNIGLEDLMEDNFVKLGGPVKQDSQGK 237
                +    + ++ L  +G +G   GW+  F  NI          + L   V       
Sbjct: 178 RLYEWNIEGLLGRENLNGIGNDGEVSGWSSSFYKNI----------INLPSNVS------ 221

Query: 238 VSFSTAGEFIGYLSDKSSKIMGISSKCAVSSGIIDAYAGWIGTIAASTKEPIEQLNNFQD 297
                    IG  S  ++K +  +    V    ID+YA W    +   +           
Sbjct: 222 ---------IGTTSLVANKHISTT----VVRSCIDSYASWFAVASPHLETS--------- 259

Query: 298 NLNGMICSSGRLAVVAGTSTCHI-SLTNKPIFVPGVWGPYRDVLGH--NFWCAEGGQSCT 354
                      L ++AGTS+C++   T     +PGVWGP+  +L +  +F     GQSCT
Sbjct: 260 -----------LFMIAGTSSCYMYGTTISDTRIPGVWGPFDTILDNRGDFSVYAAGQSCT 308

Query: 355 GALLQHVLETHPAYKELCAISKQQDISVFEVLNNKIRELTHQRDLIDEVH-LIKNLFFYG 413
           G L++H+ E+HP  +++     +    +++VL   IR++     L   +H L K++FFYG
Sbjct: 309 GKLIEHLFESHPCARKIL----KDGADIYQVLEQTIRDIEKNNGL--SIHILTKDMFFYG 362

Query: 414 DFHGNRSPVADEAMRGNIIGLSMDSSLNDLCRMYLGACEFIAQQTRHIVDIMTKSGYNLH 473
           D+ GNR+P AD  ++G+ IG S D+S+ +L   Y+   EF++ QT+ I+D       N+H
Sbjct: 363 DYEGNRTPFADPRIKGSFIGESTDTSMLNLTYKYICILEFLSFQTKLIIDTFQNENSNIH 422

Query: 474 --SLYMSGGQCRNELLMQLISNCV-GLPVVIPK-NIDTAVVFGSALMGACASELSK---- 525
              L +SG Q +NE L+ LIS    G+ ++ PK N+D   + G+ ++   A E  +    
Sbjct: 423 IKELRISGSQAKNERLLSLISLVNNGVAIIKPKENVDMMGIKGAYVLAKSAKEKKQLADV 482

Query: 526 -SHSDNTKKPDQILWDVMCKMTGQGIVVSPQDPSSQVCKLLTVKYQIYLDMIATQKRYRS 584
            +  D +   ++       ++    I++          KLL VKY I+LDM   QKRY  
Sbjct: 483 ITERDISNDSEKFESLAEYRLGNDSILLR---------KLLCVKYHIHLDMAKQQKRYHK 533

Query: 585 MVN 587
           +V+
Sbjct: 534 LVD 536

>Skud_14.89 Chr14 complement(168159..169868) [1710 bp, 569 aa] {ON}
           YNL249C (REAL)
          Length = 569

 Score =  199 bits (505), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 173/610 (28%), Positives = 273/610 (44%), Gaps = 109/610 (17%)

Query: 5   IGVDVGTGSARACLIDLNGD-ILSIKELAI----DRQELKPGYITQSTXXXXXXXXXXXX 59
           IG+DVG+ SAR  + +   D +L + +  +    D       +  +ST            
Sbjct: 34  IGIDVGSSSARVGIYNYENDALLGMAQEPVPYYQDSSRTSWKFWQRSTEIIKALQKCLQK 93

Query: 60  XXLQESNVDDISSKIKGIGFDATCSLVVLNSKTDQEVAVGPNFEDNDQNVILWMDHRALI 119
             + E NV       K  G  ATCSL +   K  +  ++ P    N+ NVI WMD  A+ 
Sbjct: 94  LKITEYNV-------KSCGVSATCSLAIF-EKDKRNGSLIP--YPNEDNVIFWMDSSAID 143

Query: 120 ETVEINSTDSK-CLKYVGGQMSVEMEIPKIKWLKNNMNPAVYKDCKFLDLPDFLTYKATG 178
           E  ++N+  S+  L ++GG    EM IPK+K+  N  +    K     DL  ++ Y+ + 
Sbjct: 144 ECKQLNAECSQQLLDFLGGSFVPEMGIPKLKYFLNEYSHNQDKQFHIFDLHQYIAYELSH 203

Query: 179 NSIRSFCSAVCKQGLLPLGVEGSTKGWTEEFLLNIGLEDLMEDNFVKLGGPVKQDSQGKV 238
               +    + ++    +GV+G   GW+  F  NI          + L   V   S G  
Sbjct: 204 LYQWNNEVLLKRENNKMVGVDGEASGWSPSFYENI----------MHLPSNVIIGSNGAT 253

Query: 239 SFSTAGEFIGYLSDKSSKIMGISSKCAVSSGIIDAYAGWIGTIAASTKEPIEQLNNFQDN 298
               A                     A+    ID+YA W    +   +            
Sbjct: 254 CKKIASS-------------------AIVRSCIDSYASWFAVSSPHLETS---------- 284

Query: 299 LNGMICSSGRLAVVAGTSTCHISLTN-KPIFVPGVWGPYRDVLGHN--FWCAEGGQSCTG 355
                     L ++AGTSTC++  T    I +PGVWGP+  +L  N  F     GQSCTG
Sbjct: 285 ----------LFMIAGTSTCYMYGTPITDIKIPGVWGPFDSILDSNSHFSVYAAGQSCTG 334

Query: 356 ALLQHVLETHPAYKELCAISKQQDISVFEVLNNKIRELTHQRDLIDEVHLI-KNLFFYGD 414
            L++H+  THP  KE+     ++   +++VL   I ++  Q      VH+  K++FFYGD
Sbjct: 335 KLIEHLFVTHPCAKEIL----KRGADIYQVLERTIHDIEKQNG--QSVHVFTKDIFFYGD 388

Query: 415 FHGNRSPVADEAMRGNIIGLSMDSSLNDLCRMYLGACEFIAQQTRHIVDIMTKS--GYNL 472
           + GNR+P AD  M+G+ IG + D+S+ +L   Y+   EF++ QTR I+D   +   G  +
Sbjct: 389 YEGNRTPFADPRMKGSFIGETTDTSILNLIHKYICILEFLSFQTRLIIDTFKRQNIGMCI 448

Query: 473 HSLYMSGGQCRNELLMQLISNC-VGLPVVIPK-NIDTAVVFGSALMGACASE-------- 522
             L +SG Q +N+ L+ LIS    G+ +  PK N+D   V G+ L+   A+E        
Sbjct: 449 QELRISGSQAKNKRLLSLISLVNNGITINKPKDNVDLMGVRGAYLLAKSANEGKQIIDVI 508

Query: 523 LSKSHSDNTKK----PD-QILWDVMCKMTGQGIVVSPQDPSSQVCKLLTVKYQIYLDMIA 577
             +  SD+ +K    P+ Q+L D                 SS + +LL  KY+I+LDM  
Sbjct: 509 RERDTSDDNEKFEPLPEYQLLND-----------------SSLLRRLLWAKYRIHLDMAK 551

Query: 578 TQKRYRSMVN 587
            Q+RY  +++
Sbjct: 552 QQQRYHKLID 561

>Suva_14.93 Chr14 complement(174204..175835) [1632 bp, 543 aa] {ON}
           YNL249C (REAL)
          Length = 543

 Score =  194 bits (494), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 167/604 (27%), Positives = 278/604 (46%), Gaps = 97/604 (16%)

Query: 5   IGVDVGTGSARACLIDLNGDILSIKELAIDRQELKPGYITQSTXXXXXXXXXXXXXXLQE 64
           IG+D+G+ SAR  + D   D+L    LA+  QE  P Y   S                 +
Sbjct: 9   IGIDIGSSSARVGIYDYYNDVL----LAM-AQEPVPYYHDSSKKSWKFWQKSTEIIKALQ 63

Query: 65  SNVDDIS---SKIKGIGFDATCSLVVLNSK-TDQEVAVGPNFEDNDQNVILWMDHRALIE 120
           +   ++      ++  G  ATCSL +     T+  +   PN    + NVI WMD  A+ E
Sbjct: 64  NCFQELKITQYNVRSCGVSATCSLAIFQKDLTNGNLIPYPN----EDNVIFWMDSSAVDE 119

Query: 121 TVEINSTDSK-CLKYVGGQMSVEMEIPKIKWLKNNMNPAVYKDCKFLDLPDFLTYKATGN 179
              +N   S+  L Y+GG+   EM IPK+K+  N  +    K     DL  ++ Y+  G 
Sbjct: 120 CEWLNEKCSQQLLDYLGGKFIPEMGIPKLKYFLNEHSHNQEKQFHIFDLHQYIAYE-LGR 178

Query: 180 SIRSFCSAV-CKQGLLPLGVEGSTKGWTEEFLLNIGLEDLMEDNFVKLGGPVKQDSQGKV 238
             R     +  ++ +  +G +G   GW+  F  +I          +KL   V        
Sbjct: 179 LYRWNTDELSARENINGIGNDGEASGWSSSFYNDI----------MKLPSNVT------- 221

Query: 239 SFSTAGEFIGYLSDKSSKIMGISSKCAVSSGIIDAYAGWIGTIAASTKEPIEQLNNFQDN 298
                   IG     S+     ++ C+     ID+YA W    + + +            
Sbjct: 222 --------IGLTGLNSNNSSSTTTVCSC----IDSYASWFAVSSPNLE------------ 257

Query: 299 LNGMICSSGRLAVVAGTSTCHISLTNKPIF---VPGVWGPYRDVL--GHNFWCAEGGQSC 353
                     L ++AGTSTC+  +   P+    +PGVWGP+  +L    N+     GQSC
Sbjct: 258 --------ASLFMIAGTSTCY--MYGSPVTTTKIPGVWGPFDTILETNGNYSVYTAGQSC 307

Query: 354 TGALLQHVLETHPAYKELCAISKQQDISVFEVLNNKIRELTHQRDLIDEVHLI-KNLFFY 412
           TG L++H+ ++HPA +++    ++    ++EVL N I+++  +      +H++ K++FFY
Sbjct: 308 TGKLIEHLFKSHPAARKI----QRSGEDIYEVLENSIQDIEKKNR--KSIHILAKHMFFY 361

Query: 413 GDFHGNRSPVADEAMRGNIIGLSMDSSLNDLCRMYLGACEFIAQQTRHIVDIM--TKSGY 470
           GD+ GNR+P AD  MRG+ IG S D+S+ +L   Y+   EF++ QT+ I+D      SG 
Sbjct: 362 GDYEGNRTPFADSQMRGSFIGESTDTSILNLTYKYVSMLEFLSFQTKLIIDTFQGQNSGA 421

Query: 471 NLHSLYMSGGQCRNELLMQLISNCV-GLPVVIP-KNIDTAVVFGSALMGACASELSK--- 525
            +  L +SG Q +N  L+ LIS    G+ +  P +NID   V G+ ++G  A+E  +   
Sbjct: 422 RIEELRVSGSQAKNGRLLSLISLVNDGIKIKRPNENIDLMGVMGAYMLGKSANEKKQIID 481

Query: 526 --SHSDNTKKPDQILWDVMCKMTGQGIVVSPQDPSSQVCKLLTVKYQIYLDMIATQKRYR 583
                D     ++       ++    I++          +LL+VKY+I+LDM   Q++Y 
Sbjct: 482 IIRERDANADSEEFEPFGTYQLGNDCILLK---------RLLSVKYRIHLDMAKQQQQYH 532

Query: 584 SMVN 587
            +V+
Sbjct: 533 RLVD 536

>TDEL0C05900 Chr3 (1062033..1063664) [1632 bp, 543 aa] {ON}
           Anc_1.111 YNL249C
          Length = 543

 Score =  194 bits (492), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 174/616 (28%), Positives = 276/616 (44%), Gaps = 115/616 (18%)

Query: 5   IGVDVGTGSARACLIDLNGDILSIKELAIDRQELKPGY--------ITQSTXXXXXXXXX 56
           IG+D+G+ S R  L  L  D++    +   +Q++   Y         TQST         
Sbjct: 6   IGIDLGSSSVRVGLFTLEDDLM----VQCVKQKISYYYHGDSALWEYTQSTDEIMKVIER 61

Query: 57  XXXXXLQESNVDDISSKIKGIGFDATCSLVVLNSKTDQEVAVGPNFEDNDQNVILWMDHR 116
                L +  +D+ +  IK  G  ATCS+ +   + +           + QNVI WMD+ 
Sbjct: 62  C----LHDLKIDEYN--IKSCGVSATCSMALFIKEHNHLEPFNTISGSHRQNVIFWMDNS 115

Query: 117 ALIETVEINSTDSKCLK-YVGGQMSVEMEIPKIKWLKNNMNPAVYKDCKFL-----DLPD 170
           +  E   +N+   K L+ ++GG+   EM IPKI  L N +  +   D + L     DL  
Sbjct: 116 SKTECKLLNNLCEKRLRDFMGGKFIPEMGIPKINRLINYLKSS--DDLQNLSVVAMDLHR 173

Query: 171 FLTYKATGNSIRSFCSAVCKQGLLPLGVEGSTKGWTEEFLLN---------IGLEDLMED 221
           +L Y+       +F   +       +G +G   GW+ +F ++         IG E  +ED
Sbjct: 174 YLAYEIAKRFKWNFDRLLNTTNFNEIGHDGELSGWSSKFYIDTLKIPSNITIGPEPPLED 233

Query: 222 NFVKLGGPVKQDSQGKVSFSTAGEFIGYLSDKSSKIMGISSKCAVSSGIIDAYAGWIGTI 281
           +F                                   GI + C      ID Y+ W+   
Sbjct: 234 DF-------------------------------EYCKGIVASC------IDCYSSWLSLC 256

Query: 282 AASTKEPIEQLNNFQDNLNGMICSSGRLAVVAGTSTCHISLTNKPIFVPGVWGPYRDVL- 340
           + + +E                     L +V GTSTC++  T +   +PGVWGP+ D+L 
Sbjct: 257 SPTPEE--------------------SLFIVGGTSTCYLYATTRMKTIPGVWGPFTDILD 296

Query: 341 -GHNFWCAEGGQSCTGALLQHVLETHPAYKELCAISKQQDISVFEVLNNKIRELTHQRDL 399
             + +   EGGQSCTG L++H+L+THPA     +I+K     + E +  +I  +  Q   
Sbjct: 297 NSNTYAVYEGGQSCTGKLIEHLLQTHPASS---SIAKDDWPLLLEKIEQEISAIEEQTG- 352

Query: 400 IDEVHL-IKNLFFYGDFHGNRSPVADEAMRGNIIGLSMDSSLNDLCRMYLGACEFIAQQT 458
              +H   K++FFYGDF GNR+P AD  M G  IG + D S N+L   Y+   EF+A Q 
Sbjct: 353 -RSIHFKTKHMFFYGDFQGNRTPYADPEMSGMTIGETTDVSFNNLILRYICILEFLAFQI 411

Query: 459 RHIVDIMTKS--GYNLHSLYMSGGQCRNELLMQLISNC-VGLPVVIPK-NIDTAVVFGSA 514
           ++++ I  K+     +  + + G Q +N+ L+ LIS    G  + +PK +++ + V G+ 
Sbjct: 412 KYMISIFNKAQGQDKITEIRICGSQAKNKRLLSLISLLHEGGTIKLPKTDVELSGVSGAF 471

Query: 515 LMGACASELSKSHSDNTK-KPDQILWDVMCKMTGQGIVVSPQDPSSQVCKLLTVKYQIYL 573
           L+G  A  L+KS  D  + K DQ   D         I  +P   +  +  LL  KY+I+L
Sbjct: 472 LLGKSAL-LNKSPLDLIQEKDDQKQVD---------IFETPSSINQPLSMLLEAKYEIHL 521

Query: 574 DMIATQKRYRSMVNGL 589
           DM   Q  YR M+N +
Sbjct: 522 DMAKQQLIYREMINKI 537

>ZYRO0F16016g Chr6 (1313995..1315623) [1629 bp, 542 aa] {ON} similar
           to uniprot|P53583 Saccharomyces cerevisiae YNL249C MPA43
           Mitochondrial protein
          Length = 542

 Score =  192 bits (489), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 164/599 (27%), Positives = 272/599 (45%), Gaps = 90/599 (15%)

Query: 5   IGVDVGTGSARACLIDLNGDILSIKELAIDRQELKPGYITQSTXXXXXXXXXXXXXXLQE 64
           IG+D+G+ S R  L +   D +   ++        P                      QE
Sbjct: 10  IGIDLGSSSVRVSLFNFQNDQIIAYKIKTVPYYFTPESTNWKYTQSSREILTAIDQCFQE 69

Query: 65  SNVDDISSKIKGIGFDATCSLVVLNSKTDQEVAVGP-NFEDNDQNVILWMDHRALIETVE 123
            N+D    +IK  G  ATCSL +  +K +   A+ P N +D D+NV+ WMD  A+ ET E
Sbjct: 70  LNID--KHEIKSCGVGATCSLAIFQTKDN---ALIPWNLDDPDKNVVFWMDSIAIKETQE 124

Query: 124 INSTDSKCLK-YVGGQMSVEMEIPKIKW----LKNNMNPAVYKDCKFLDLPDFLTYKATG 178
           +N   +  ++ ++GG    EM +PK++     LKN  N + ++    +DL  ++      
Sbjct: 125 VNKLATPEVQAHMGGSFVPEMAVPKLRHFIDILKNTDNNSTFE---IIDLHRYIAMSLAQ 181

Query: 179 NSIRSFCSAVCKQGLLPLGVEGSTKGWTEEFLLNIGLEDLMEDNFVKLGGPVKQDSQGKV 238
            +   + +      L  +G +G   GW+  F  N+ L+  +  N V   GP K       
Sbjct: 182 QNGWDYTNVCNFPNLNEIGHDGELAGWSSAFYENV-LQ--LPPNIVI--GPTKH------ 230

Query: 239 SFSTAGEFIGYLSDKSSKIMGISSKCAVSSGIIDAYAGWIGTIAASTKEPIEQLNNFQDN 298
                       S  SSK     S C      ID Y+ W   + +          N Q++
Sbjct: 231 ------------SQHSSKQGLKVSSC------IDCYSNWFALLPS----------NLQNS 262

Query: 299 LNGMICSSGRLAVVAGTSTCHISLTNK-PIFVPGVWGPYRDVLGHN--FWCAEGGQSCTG 355
           L           +V GTSTC++  +++    +PGVWGP+ ++   +  F   E GQSCTG
Sbjct: 263 L----------FIVGGTSTCYLYASSEFSHHIPGVWGPFSNIFDRSDQFSIYEAGQSCTG 312

Query: 356 ALLQHVLETHPAYKELCAISKQQDISVFEVLNNKIRELTHQRDLIDEVHL-IKNLFFYGD 414
            L++H+ +THPA      I  +    +F  +N+ I ++  +++  D +H+  K++FFYGD
Sbjct: 313 KLIEHLFKTHPASSH---IDTRDWPHLFSQINDFIEKV--EQNTQDSIHMQTKHMFFYGD 367

Query: 415 FHGNRSPVADEAMRGNIIGLSMDSSLNDLCRMYLGACEFIAQQTRHIVDIMT--KSGYNL 472
             GNR+P AD +M G  IG + D+S  +L   Y+   EFIA Q +H++ I        ++
Sbjct: 368 LDGNRTPYADPSMSGMFIGETTDTSFRNLVYKYVSILEFIAFQIKHMLAIFNTLNGDEDI 427

Query: 473 HSLYMSGGQCRNELLMQLISNCVGLPVVIPKNIDTAVV--FGSALMGACASELSKSHSDN 530
            +L   G   +N+ L+ L++       +    +D A++  +GS LMG  ++         
Sbjct: 428 SNLQFCGSLAKNKRLLNLLALLNPRLRIAMPEMDVALMGAYGSYLMGKASTS-------- 479

Query: 531 TKKPDQILWDVMCKMTGQGIVVSPQDPSSQVCKLLTVKYQIYLDMIATQKRYRSMVNGL 589
               D+ + +V    T       P+     + +LL VKYQIY +M   Q++YR  VN +
Sbjct: 480 ----DKSIVEVAHNQTYS--YRPPEKTDGLLVELLEVKYQIYFNMAEQQRKYRKQVNNV 532

>Smik_14.86 Chr14 complement(158487..160118) [1632 bp, 543 aa] {ON}
           YNL249C (REAL)
          Length = 543

 Score =  189 bits (479), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 169/603 (28%), Positives = 275/603 (45%), Gaps = 95/603 (15%)

Query: 5   IGVDVGTGSARACLIDLNGD-ILSIKELAI----DRQELKPGYITQSTXXXXXXXXXXXX 59
           IG+D+G+ SAR  +     D +L + +  +    D  +    +  +ST            
Sbjct: 9   IGIDLGSSSARVGIYSYYNDALLGMAQEPVPYYQDFTKKSWKFWQKSTEIIEALQKCFQK 68

Query: 60  XXLQESNVDDISSKIKGIGFDATCSLVVLNSKTDQEVAVGPNFEDNDQNVILWMDHRALI 119
             + E NV       K  G  ATCSL +       E  +      N+ NVI WMD  A  
Sbjct: 69  LKITEYNV-------KSCGVSATCSLAIFERVHTSEALIP---YPNENNVIFWMDSSATD 118

Query: 120 ETVEINSTDSK-CLKYVGGQMSVEMEIPKIKWLKNNMNPAVYKDCKFLDLPDFLTYKATG 178
           E   +N+  SK  L Y+GG+   EM IPK+K+  N  +    K     DL  ++ Y+   
Sbjct: 119 ECEWLNAECSKQLLDYLGGRFVPEMGIPKLKYFLNEYSHRQDKRFHIFDLHQYIAYELGR 178

Query: 179 NSIRSFCSAVCKQGLLPLGVEGSTKGWTEEFLLNIGLEDLMEDNFVKLGGPVKQDSQGKV 238
               +    +  + +  +G +G   GW+  F  NI     M      + GPV        
Sbjct: 179 LYQWNIDGLLRGENINGIGNDGEASGWSSSFYKNI-----MNIPSNVIIGPV-------- 225

Query: 239 SFSTAGEFIGYLSDKSSKIMGISSKCAVSSGI----IDAYAGWIGTIAASTKEPIEQLNN 294
                               G+ SK  +S+ +    ID+YA W     A +   +E+   
Sbjct: 226 --------------------GLVSKKVISTTVVRSCIDSYASWF----AVSPPFLER--- 258

Query: 295 FQDNLNGMICSSGRLAVVAGTSTCHISLTNKPIF---VPGVWGPYRDVLGH--NFWCAEG 349
                         L ++AGTS+C++  T  P+    +PGVWGP+ ++L    +F     
Sbjct: 259 -------------SLFMIAGTSSCYMYGT--PVSNTKIPGVWGPFNNILDDKGDFSVYAA 303

Query: 350 GQSCTGALLQHVLETHPAYKELCAISKQQDISVFEVLNNKIRELTHQRDLIDEVHLI-KN 408
           GQSCTG L++H+ E+HP  +++     +    +++VL   I  +  ++ L   +H++ K+
Sbjct: 304 GQSCTGKLIEHLFESHPCARKIL----KSGADIYQVLEQTIHGIEKKKGL--SIHILAKD 357

Query: 409 LFFYGDFHGNRSPVADEAMRGNIIGLSMDSSLNDLCRMYLGACEFIAQQTRHIVDIM--T 466
           +FFYGD+ GNR+P AD  M+G+ IG + D+S+ +L   Y+   EF++ QT+ I+D     
Sbjct: 358 MFFYGDYEGNRTPFADPRMKGSFIGETTDTSILNLTYKYISILEFLSFQTKLIIDTFQSQ 417

Query: 467 KSGYNLHSLYMSGGQCRNELLMQLISNC-VGLPVVIPK-NIDTAVVFGSALMGACASELS 524
           K+   +  L +SG Q RNE L+ LIS    G+ +  P+ N+D   + G+ ++   A+E  
Sbjct: 418 KACIRIQELRISGSQARNERLLSLISLVNNGMSINRPRDNVDMMGIKGAYILAKSANE-K 476

Query: 525 KSHSDNTKKPDQILWDVMCKMTGQGIVVSPQDPSSQVCKLLTVKYQIYLDMIATQKRYRS 584
           K   D  ++ D  + D   K           D S+ +  LL VKY+I+LDM   QK Y  
Sbjct: 477 KQLVDVIRERD--VGDDNEKFQPLSEYCLGND-STLLKNLLCVKYRIHLDMAKQQKYYYK 533

Query: 585 MVN 587
           +V+
Sbjct: 534 LVD 536

>Kwal_33.13530 s33 complement(268296..269900) [1605 bp, 534 aa] {ON}
           YNL249C (MPA43) - Overexpression leads to increased
           levels of the lyase PDC1 [contig 116] FULL
          Length = 534

 Score =  176 bits (447), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 170/612 (27%), Positives = 261/612 (42%), Gaps = 116/612 (18%)

Query: 5   IGVDVGTGSARACLIDLNGD-ILSIKELAIDRQELKPGYITQSTXXXXXXXXXXXXXXLQ 63
           +G+D+G+   R    +L  D  +++    ++  E + G  TQS+               +
Sbjct: 8   LGIDLGSTGVRVGAYNLETDEPIAVVSRTVNYYEQEKGRYTQSSAEIMRAIVEC----FE 63

Query: 64  ESNVDDISSKIKGIGFDATCSLVVLNSKTDQEVAVGPNFED----NDQNVILWMDHRALI 119
             N+D  +  ++  G  ATCSL V    + + +     +ED    NDQNV+ WMD  A+ 
Sbjct: 64  SLNIDIWA--VQSCGVAATCSLAVFIRNSTKGLQPFGVYEDLRPLNDQNVVFWMDSNAIE 121

Query: 120 ETVEINSTDSKCLKYVGGQMSVEMEIPKIKWL-----KNNMNPAVYKDCKFLDLPDFLTY 174
           E   IN        Y GG    EM +PK+        KNN       D +  DL  ++ Y
Sbjct: 122 ECSNINDLAINEKAYFGGSFIPEMGVPKLASFLKSCSKNN------SDFEVFDLHTYVAY 175

Query: 175 KATGNSIRSFCSAVCKQGLLPLGVEGSTKGWTEEFLLNIGLEDLMEDNFVKLGGPVKQDS 234
                        + +     +G +G  KGW +EF           +  +KL   V+   
Sbjct: 176 DLANRYGWDASFLINRPNHNGIGHDGEIKGWKDEFY----------EKTLKLPPNVR--- 222

Query: 235 QGKVSFSTAGEFIGYLSDKSSKIMGISSKCAVSSGIIDAYAGWIGTIAASTKEPIEQLNN 294
                       IG L      I    S   V+S  ID Y+ W    +++ +        
Sbjct: 223 ------------IGPLC-----INRRFSPVKVAS-CIDCYSSWFSMFSSTPER------- 257

Query: 295 FQDNLNGMICSSGRLAVVAGTSTCHISLTNKPI-FVPGVWGPYRDVLGHN---FWCA-EG 349
                         L + AGTSTC++   NKP   +PG+WGP+ D+L       W   E 
Sbjct: 258 -------------SLFMAAGTSTCYLYANNKPSECLPGIWGPFTDILDSKDPPSWSVYEA 304

Query: 350 GQSCTGALLQHVLETHPAYKELCAISKQQDISV-FEVLNNKIRELTHQRDLIDEVHL-IK 407
           GQS TG L++H+ E+HPA K        +D +V F  L  +I  +  Q    + VH   K
Sbjct: 305 GQSTTGKLIEHLFESHPAAKPYL-----EDRNVLFNRLETEINLIEQQS--AESVHFKTK 357

Query: 408 NLFFYGDFHGNRSPVADEAMRGNIIGLSMDSSLNDLCRMYLGACEFIAQQTRHIVDIMTK 467
           ++F YG+  GNR+P  D  M G  IG S D+S  DL   Y+   EF+A Q RHI + +  
Sbjct: 358 HMFNYGELQGNRTPYCDPEMSGMFIGESADTSFRDLTLKYVTVLEFLAFQVRHIKECL-- 415

Query: 468 SGYNLHSLYMSGGQCRNELLMQLISNC-VGLPVVIPK-NIDTAVVFGSALMGACASELSK 525
            G  ++ + ++G Q +N  L+ LIS    G  V IP    D   V G+ L+G        
Sbjct: 416 -GAPINDIRVAGSQAKNNRLLSLISFVNHGSRVRIPATRADYVGVQGAYLLG-------- 466

Query: 526 SHSDNTKKPDQILWDVMCKMTGQGIVVSP---------QDPSSQVCKLLTVKYQIYLDMI 576
                  K   +  +V+  +T +    SP         ++  +++  L  +KY+IYL+M 
Sbjct: 467 -------KAKHLGLNVVELITQENGGESPMKDIEVRIEKNEENKLRALFEIKYKIYLNMA 519

Query: 577 ATQKRYRSMVNG 588
            TQ++YR MVN 
Sbjct: 520 QTQRQYREMVNA 531

>SAKL0C03432g Chr3 complement(325502..327145) [1644 bp, 547 aa] {ON}
           similar to uniprot|P53583 Saccharomyces cerevisiae
           YNL249C MPA43 Mitochondrial protein of unknown function
          Length = 547

 Score =  166 bits (421), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 161/603 (26%), Positives = 259/603 (42%), Gaps = 89/603 (14%)

Query: 5   IGVDVGTGSARACLIDLNGD-ILSIKELAIDRQEL-KPGYITQSTXXXXXXXXXXXXXXL 62
           +GVD+G+ S R  +  L  D +L + E  +        G  TQST              L
Sbjct: 13  VGVDLGSSSVRVGIYSLENDSLLHVVERPVRYYSCGSSGRFTQSTGEIMAALQEC----L 68

Query: 63  QESNVDDISSKIKGIGFDATCSLVVLNSKTDQEVAVGPNFE----DNDQNVILWMDHRAL 118
            E  +      I   G  ATCS+ V   +         +       +D+NV+ WMD    
Sbjct: 69  DELGLRPGGRSIVSCGVAATCSMAVFTVEAGDGSLAPLDMSGLDGSSDKNVVFWMDS--- 125

Query: 119 IETVEINSTDSKCLKYVG----GQMSVEMEIPKIKWLKNNMNPAVYKDCKFLDLPDFLTY 174
           + +   ++ D +   +V     G    EM +PK+  L     P   +  +  DL  ++ Y
Sbjct: 126 VASEACDALDKRVSTHVKAALCGGFIPEMGVPKLLHLVGQF-PG--RSLEVFDLHKYIAY 182

Query: 175 KATGNSIRSFCSAVCKQGLLPLGVEGSTKGWTEEFLLNIGLEDLMEDNFVKLGGPVKQDS 234
                      +   +     +G +G   GW +EF  N+          +KL   V    
Sbjct: 183 DLARRYGWDMAALANRPNSNGIGHDGEVGGWPQEFYRNV----------LKLPATVA--- 229

Query: 235 QGKVSFSTAGEFIGYLSDKSSKIMGISSKCAVSSGIIDAYAGWIGTIAASTKEPIEQLNN 294
                       +G  S    + +G++S        ID YA W G  +   ++       
Sbjct: 230 ------------VGPASTFKGQRVGVAS-------CIDCYASWFGVCSTQPEQ------- 263

Query: 295 FQDNLNGMICSSGRLAVVAGTSTCHI--SLTNKPIFVPGVWGPYRDVLG--HNFWCA-EG 349
                         L +VAGTSTC++  S  +K + +PG+WGP+ ++L      W   E 
Sbjct: 264 -------------SLFLVAGTSTCYLYASAASKTV-LPGMWGPFTNLLDGEEARWSVYEA 309

Query: 350 GQSCTGALLQHVLETHPAYKELCAISKQQDISVFEVLNNKIRELTHQRDLIDEVHLIKNL 409
           GQS TG LL+H+ ETHPA ++    + +    +F+ L ++I ++          HL +++
Sbjct: 310 GQSTTGRLLEHLFETHPAARDYAGDTGR----LFKDLEDRIADMEADSGCSIH-HLARHM 364

Query: 410 FFYGDFHGNRSPVADEAMRGNIIGLSMDSSLNDLCRMYLGACEFIAQQTRHIVD-IMTKS 468
           F YG+  GNR+P AD  M G  +G + D+S  +L   Y+   EF+A QTR IV+   T +
Sbjct: 365 FLYGELQGNRTPYADPRMCGMFVGETTDTSFANLALKYVVVLEFLAFQTRQIVEGFRTGA 424

Query: 469 GYNLHSLYMSGGQCRNELLMQLISNCVG-LPVVIP-KNIDTAVVFGSALMGACASELSKS 526
              +  L ++G Q RN  L+ L+S   G +PV +P +    A V G+ L+G  A  L  S
Sbjct: 425 AAAIGELRVAGSQARNRRLLSLMSLVNGNMPVRVPARAAPLAGVRGAYLLGK-ARYLDVS 483

Query: 527 HSDNTKKPDQILWDVMCKMTGQGIVVSPQDPSSQVCKLLTVKYQIYLDMIATQKRYRSMV 586
             D  +KP   +  V  ++T      +       + +LL  KY I+LDM   Q+RYRS +
Sbjct: 484 LLDVVRKPGATIPTV--EVTESSNYPACGATKENLRRLLEAKYAIHLDMAQVQQRYRSEI 541

Query: 587 NGL 589
           + +
Sbjct: 542 DAV 544

>KLTH0F03080g Chr6 complement(268621..270222) [1602 bp, 533 aa] {ON}
           similar to uniprot|P53583 Saccharomyces cerevisiae
           YNL249C MPA43
          Length = 533

 Score =  165 bits (418), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 158/602 (26%), Positives = 265/602 (44%), Gaps = 96/602 (15%)

Query: 5   IGVDVGTGSARACLIDLNGD-ILSIKELAIDRQELKPGYITQSTXXXXXXXXXXXXXXLQ 63
           +G+D+G+ + R  + DL  D ++ I    +         +TQS+                
Sbjct: 11  LGIDLGSTAVRVGIYDLKTDKLIDIVAKPVPYTNHGGNRVTQSSTDIMSAI--------- 61

Query: 64  ESNVDDISSKIKGI---GFDATCSLVVLNSKTD--QEVAVGPNFEDNDQNVILWMDHRAL 118
              + D++  +K +   G  ATCSL V     +  + + +    ++   NV+ WMD  A 
Sbjct: 62  HGCIQDLNPDLKSVLSCGVAATCSLAVFTQDIEDLKPLDIHGVKQEPCHNVVFWMDSSAT 121

Query: 119 IETVEINSTDSKCLKYVGGQMSVEMEIPKIKWLKNNMNPAVYKDCKFLDLPDFLTYKATG 178
           +E   +N T  +  +++GG    EM IPK+  +        +K  +  DL  ++ Y+   
Sbjct: 122 LECEIVNKTAGRLKEFMGGSFVPEMGIPKLASIFKKPEAEGHK-LEVFDLHSYIAYELAI 180

Query: 179 NSIRSFCSAVCKQGLLPLGVEGSTKGWTEEFLLNIGLEDLMEDNFVKLGGPVKQDSQGKV 238
                    + K     +G +G  KGW   F           ++ +KL   VK       
Sbjct: 181 KYGWDTSRIINKPNENRIGHDGELKGWDAGFY----------NDVLKLPANVK------- 223

Query: 239 SFSTAGEFIGYLSDKSSKIMGISSKCAVSSGIIDAYAGWIGTIAASTKEPIEQLNNFQDN 298
                   IG +       +   S   V+S  ID Y+ W    ++S        NN    
Sbjct: 224 --------IGPI-----HALNTESPVRVAS-CIDCYSNWFSMCSSSP-------NN---- 258

Query: 299 LNGMICSSGRLAVVAGTSTCHI-SLTNKPIFVPGVWGPYRDVL----GHNFWCAEGGQSC 353
                     L + AGTSTC++ + T     +PGVWGP+ ++L       +   E GQS 
Sbjct: 259 ---------SLFMAAGTSTCYLYANTENKGCIPGVWGPFTNILDGSEAKEWSVYEAGQST 309

Query: 354 TGALLQHVLETHPAYKELCAISKQQDISVFEVLNNKIRELTHQRDLIDEVHL-IKNLFFY 412
           TG L++H+ ETHPA +   ++ K +   +F  + + I +L  ++D  + VH   K++F Y
Sbjct: 310 TGKLIEHLFETHPAARAY-SMDKSK---LFSAIESAIEKL--EQDFGESVHFRSKHMFTY 363

Query: 413 GDFHGNRSPVADEAMRGNIIGLSMDSSLNDLCRMYLGACEFIAQQTRHIVDIMTKSGYNL 472
           G+  GNR+P  D +M G  IG + D+S  DL   Y+   EF+A Q +HI +        +
Sbjct: 364 GELQGNRTPYCDSSMSGMFIGETTDTSFQDLVLKYVTILEFLAFQVKHIKECFKA---EI 420

Query: 473 HSLYMSGGQCRNELLMQLISNCVG-LPVVIP-KNIDTAVVFGSALMGACASELSKSHSDN 530
             + ++G Q +N  L+ L S     + V IP +  D   V G+ L+G  A +       N
Sbjct: 421 KDIRIAGSQAKNTRLLTLFSLVNDQITVKIPAQRTDYMGVEGAYLLGKAAHK-------N 473

Query: 531 TKKPDQILWDVMCKMTGQGIVVSPQ---DPSSQVCKLLTVKYQIYLDMIATQKRYRSMVN 587
               D I  D   ++    + + P    + ++++ +LL  KY+IYLDM  TQ RYR+MV+
Sbjct: 474 INIIDLI--DKRDRLQSHILELGPMKLGNHNTKLKQLLEAKYKIYLDMAQTQMRYRAMVD 531

Query: 588 GL 589
            +
Sbjct: 532 SV 533

>KNAG0F00660 Chr6 complement(114441..116048) [1608 bp, 535 aa] {ON}
           Anc_1.111 YNL249C
          Length = 535

 Score =  157 bits (398), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 169/601 (28%), Positives = 257/601 (42%), Gaps = 95/601 (15%)

Query: 5   IGVDVGTGSARACLIDLNGDILSIKELAIDRQELKPGYITQSTXXXXXXXXXXXXXXLQE 64
           IG+D+G+ S R  +  L+ D L    L +  + +   Y +  T                +
Sbjct: 8   IGIDLGSSSVRVGIYSLHDDSL----LGVFSKPVPYYYESNRTSLWEYTQDSAEILTAIK 63

Query: 65  SNVD--DISS-KIKGIGFDATCSLVVLNSKTDQEVAVGPNFEDNDQNVILWMDHRALIET 121
              D  D+    +K  G  ATCSLV+     D       + E + +NV+ WMD  A  ET
Sbjct: 64  ECFDMADLQKYDVKSCGVAATCSLVLCERSGDDTFQ---HCEGDSRNVVFWMDSMAKEET 120

Query: 122 VEINSTDSKC----LKYVGGQMSVEMEIPKI-KWLKN-NMNPAVYKDCKFLDLPDFLTYK 175
              NS +++C    L ++GG    EM IPK+ ++LK+ +  P      +  DL  ++ YK
Sbjct: 121 ---NSLNARCPQDILGHMGGGFIPEMGIPKLSRFLKSISDEPKGNIQWEVFDLHKYVAYK 177

Query: 176 ATGNSIRSFCSAVCKQGLLP----LGVEGSTKGWTEEFLLNIGLEDLMEDNFVKLGGPVK 231
                 + +C    +    P    +G +G   GW++ F           D  V+L   V 
Sbjct: 178 LA----QEYCWNTERLSNHPNSNGIGHDGELAGWSKSFY----------DKIVRLPPNVT 223

Query: 232 QDSQGKVSFSTAGEFIGYLSDKSSKIMGISSKCAVSSGIIDAYAGWIGTIAASTKEPIEQ 291
                          IG       K +       +    ID Y+ W          P++ 
Sbjct: 224 ---------------IG-----CPKTIENEDSLVIVDSCIDCYSSWFS--------PLQS 255

Query: 292 LNNFQDNLNGMICSSGRLAVVAGTSTCHI---SLTNKPIFVPGVWGPYRDVLGHNFWCAE 348
           LN               L +VAGTSTC+I           V G+WGP+ D+LG N    E
Sbjct: 256 LNK------------NTLFLVAGTSTCYIYSPGTMKTETSVKGIWGPFTDILGANKVVYE 303

Query: 349 GGQSCTGALLQHVLETHPAYKELCAISKQQDISVFEVLNNKIRELTHQRDLIDEVHLIKN 408
            G SC+G L++H+  +HP+   L  +S  Q IS  E   N I E  +   +  E     N
Sbjct: 304 SGSSCSGKLIEHLFTSHPSAISL-NLSTGQLISKLEEEIN-IWETQNATSIHFEAC---N 358

Query: 409 LFFYGDFHGNRSPVADEAMRGNIIGLSMDSSLNDLCRMYLGACEFIAQQTRHIVDIMTKS 468
            F YGD  GNR+P  D  MRG  IG S D+S  DL   Y+   E +A QT+ +VD   K 
Sbjct: 359 NFLYGDLDGNRTPFGDPYMRGMFIGESPDTSFRDLLVKYVCILECLAFQTKLMVDNFEKL 418

Query: 469 GYNLHSLYMSGGQCRNELLMQLIS--NCVGLPVVIPKNIDTAVVFGSALMGACASELSKS 526
             +++ L++ G Q +N  L++LIS  N   L +V  +  D   V G+ L+G      +  
Sbjct: 419 N-SINELFICGSQAKNTRLLKLISLINDNALILVPKEKEDLMGVEGAYLLGKAGYLGTSV 477

Query: 527 HSDNTKKPDQILWDVMCKMTGQGIVVSPQDPSSQVCKLLTVKYQIYLDMIATQKRYRSMV 586
                 +P +    +  K T      S +   +++ KLL  KY I+L+M   Q+R+R MV
Sbjct: 478 DLVPVSEPREY---ISVKYTND----SDKIQQTKLYKLLLTKYIIHLEMAEQQQRFRKMV 530

Query: 587 N 587
           +
Sbjct: 531 S 531

>KLLA0C02937g Chr3 complement(265205..266755) [1551 bp, 516 aa] {ON}
           similar to uniprot|P53583 Saccharomyces cerevisiae
           YNL249C MPA43 Mitochondrial protein of unknown function
           and similar to uniprot|Q04585 Saccharomyces cerevisiae
           YDR109C Hypothetical ORF
          Length = 516

 Score =  134 bits (338), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 151/547 (27%), Positives = 231/547 (42%), Gaps = 102/547 (18%)

Query: 5   IGVDVGTGSARACLIDLNGDILSIKELAIDRQELKPG--YITQSTX-XXXXXXXXXXXXX 61
           IGVD+G+   R  + D   D L +KE        + G   ITQ T               
Sbjct: 6   IGVDLGSTEFRIGIFDYYTDSL-VKETKEKVPYFRHGNGIITQCTSDILTAVEKAFNTLY 64

Query: 62  LQESNVDDISSKIKGIGFDATCSLVVLNSKTDQEVAVGPNFEDNDQ--NVILWMDHRALI 119
           +QE N       I  +G  ATCS+VV   K +  +      + N +  ++I WM H A I
Sbjct: 65  IQEYN-------ICSLGVGATCSMVVGKQKDENLIPFNLIHDKNGRYHDIIFWM-HSAAI 116

Query: 120 ETVEI--NSTDSKCLKYVGGQMSVEMEIPKIKWLKNNMNPAVYKD--CKFLDLPDFLTYK 175
           E  E   N TD   L + GG+   EM IPK+  L       +YKD     LDL  +L +K
Sbjct: 117 EETEYLNNITDESILCHFGGKFFPEMAIPKLLHLNK-----LYKDDGLTVLDLHIWLLWK 171

Query: 176 ATGNSIRSFCSAVCKQGLLPLGVEGSTKGWTEEFLLNIGLEDLMEDNFVKLGGPVKQDSQ 235
            +          V +     +G +G   GW++EF  ++ L  +    F+     +K++ Q
Sbjct: 172 ISLKLGHKELMPVQEPNSNGIGHDGELFGWSKEFYEHLQLNKI----FIGNNAVIKKNEQ 227

Query: 236 GKVSFSTAGEFIGYLSDKSSKIMGISSKCAVSSGIIDAYAGWIGTIAASTKEPIEQLNNF 295
                                       C      ID YA W                 F
Sbjct: 228 ------------------------FGDSC------IDCYASW-----------------F 240

Query: 296 QDNLNGMICSSGRLAVVAGTSTCHISLTN-KPIFVPGVWGPYRDVLGH--------NFWC 346
           Q     M+  +  L VVAGTSTC +  ++    F+PG+WGP++D+L +        N+  
Sbjct: 241 QCWSTAMLNRT--LFVVAGTSTCFLYASDCFESFIPGIWGPFKDILVNRKHISKHDNYSV 298

Query: 347 AEGGQSCTGALLQHVLETHPAYKELCAISKQQDISVFEVLNNKIRELTHQRDLIDEVHL- 405
            E G S TG LL+ +L THPA K+        D++  E + +KI +L  Q D    +HL 
Sbjct: 299 YEAGISRTGVLLEKLLSTHPAVKD-------SDVNFLETVEHKI-DLIEQSD-TQSIHLM 349

Query: 406 IKNLFFYGDFHGNRSPVADEAMRGNIIGLSMDSSLNDLCRMYLGACEFIAQQTRHIVDIM 465
           IKN FF+ D+    S    +   G+I+    + +L DL   Y+   E +A Q   +++  
Sbjct: 350 IKNTFFHEDYEEFESSFVQKDTSGSILKEGYNPTLKDLALKYVVIIETLAFQIVDVINAF 409

Query: 466 TKSGYNLHSLYMSGGQCRNELLMQLISNCVGLPVVIPK-NIDTAVVFGSALMGACASELS 524
            +    +  L ++G Q +N  L+Q+      L V++ + +IDT     S      A +L 
Sbjct: 410 EEGHITISKLLITGSQAKNSRLLQI------LQVLLEEISIDTPCSESSTAGVKGAYQLG 463

Query: 525 KSHSDNT 531
           K+H +NT
Sbjct: 464 KAHRNNT 470

>NCAS0A00780 Chr1 complement(152317..153966) [1650 bp, 549 aa] {ON}
           Anc_1.111 YNL249C
          Length = 549

 Score = 69.7 bits (169), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 120/527 (22%), Positives = 207/527 (39%), Gaps = 108/527 (20%)

Query: 5   IGVDVGTGSARACLIDL-NGDILS--IKELAIDRQ-ELKPGYITQSTXXXXXXXXXXXXX 60
           IG+DVG+ S R  + +  +G  +   +KE+    + + K  + TQ+              
Sbjct: 5   IGIDVGSTSVRIGIFNYEDGTTIKTIVKEMLYKHEPDSKLWHYTQNAFVMRDSIFTA--- 61

Query: 61  XLQESNVDDISSKIKGIGFDATCSLVVL--NSKTD--QEVAVGPNFEDNDQNVILWMDHR 116
            L+E +V+    KI G+   ATCS+V L  +S  D  + + +     +N  ++I W DH 
Sbjct: 62  -LEELHVNSYIVKICGVS--ATCSMVFLQRDSPADHLRPLTIIHEETNNTDSIIFWKDHT 118

Query: 117 ALIETVEINS-----------TDSKCLKYVGGQMSV--EMEIPKIKWLKNNMNPAVYKDC 163
           A  E   +N+            ++K L  +G +     EM IPK+  L N +    Y+  
Sbjct: 119 AQPEAQRLNNKLRTANEGLSGKENKILSTLGSRSGFIGEMAIPKLSRLINLIKEGFYETP 178

Query: 164 KFLDLPDFLTYKATGNSIRSFCSAVC---KQGLLPLGVEGSTKGWTEEFLLNIGLEDLME 220
             L++ D   Y A   + +   + V    K  +  +G++G  +GW     L+  +  L E
Sbjct: 179 HILEVYDLHVYIAQTLAQKYDWNTVHLQNKPNVNGIGIDGELQGWD----LSFYVWALPE 234

Query: 221 DNFVKLGGPVKQDSQGKVSFSTAGEFIGYLSDKSSKIMGISSKCAVSSGIIDAYAGWIGT 280
            +F    GP                         SK++  +S     S  ID YA W  T
Sbjct: 235 TSFPICIGP-------------------------SKVINETSIVRPKS-CIDCYASWFST 268

Query: 281 IAASTKEPIEQLNNFQDNLNGMICSSGRLAVVAGTSTC-----------HISLTNKPIFV 329
            A +  +                     L + AGTSTC           +     +P+ +
Sbjct: 269 DACTKDD--------------------TLFMAAGTSTCCLYAMPRSALEYFGEQQQPLSL 308

Query: 330 PGVWGPYRDVLGHNFWCA-EGGQSCTGALLQHVLETHPAYKELCAISK----QQDISVFE 384
              WGP+ +VL  +   + E G S TG LL+ +   H               +  I+++E
Sbjct: 309 --FWGPFTNVLDKDKKSSFEIGFSETGILLEKLFNKHQITASWSVAESINYVENQIAIYE 366

Query: 385 VLNNKIRELTHQRDLIDEVHLIKNLFFYGDFHGNRSPVADEAMRGNIIGLSMDSSLNDLC 444
                 R+ +H   L  E++L           G  +P   +    + +    DS+L  L 
Sbjct: 367 ------RKKSHSIYLEPEIYLFLKYLTLNKPSGRDTPDTPDLFGNDGV---TDSTLG-LI 416

Query: 445 RMYLGACEFIAQQTRHIVDIMTKSGYNLHSLYMSGGQCRNELLMQLI 491
             Y+   E++A Q  +++    K    ++ L +SG Q +N+ L+ LI
Sbjct: 417 FKYIAILEYLAYQVSNLILQFQKEKIIINHLVLSGSQAQNKRLLDLI 463

>TPHA0K02280 Chr11 (490104..492107) [2004 bp, 667 aa] {ON} Anc_4.9
           YHL032C
          Length = 667

 Score = 40.4 bits (93), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 52/224 (23%), Positives = 92/224 (41%), Gaps = 48/224 (21%)

Query: 331 GVWGPYRDVLGHN--FWCAEGGQSCTGALLQHVLETHPAYKELCAISKQQDISVFEVLNN 388
           G W PY +   H+   +  EG  +  GA++Q + +       L    + +D+        
Sbjct: 408 GYWFPYLENEEHSKPHFALEGSVAVAGAVVQWLRDN------LRLFPRAEDVG------- 454

Query: 389 KIRELTHQRDLIDEVHLIKNLFFYGDFHGNRSPVADEAMRGNIIGLSMDSSLNDLCRMYL 448
                     L  +V     + F   F G  +P  D   R +I+G+S  ++   + R   
Sbjct: 455 ---------PLASQVKDSGGVVFVPAFSGLFAPYWDPNARASIMGMSQYTTAAHIAR--- 502

Query: 449 GACEFIAQQTRHIV-----DIMTKSG--------YNLHSLYMSGGQCRNELLMQLISNCV 495
            A E +  Q R I+     D++ +SG          L +L + GG  R++ +MQ+ +N +
Sbjct: 503 AAVEGVCFQARAILKAMSSDVLQESGDFEDTYEKSALSTLAVDGGMSRSDEVMQIQANIL 562

Query: 496 GLPVVIPKNIDTAVVFGSALMGACASELSKSHSDNTKKPDQILW 539
           G P V  +   T+    +AL  A A+ +   + D     D+ LW
Sbjct: 563 G-PCVKVRRSPTSEC--TALGAAIAANMGFKNPD-----DRTLW 598

>NCAS0C05900 Chr3 (1214812..1216923) [2112 bp, 703 aa] {ON} Anc_4.9
           YHL032C
          Length = 703

 Score = 40.4 bits (93), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 42/171 (24%), Positives = 78/171 (45%), Gaps = 23/171 (13%)

Query: 381 SVFEVLNNKIRELT---HQRDLIDEVHLIKNLFFYGDFHGNRSPVADEAMRGNIIGLSMD 437
           SV + L + +R +    H   L   V     + F   F+G  +P  D   R  I+G+S  
Sbjct: 472 SVVQWLRDNLRLIPKSEHIGPLASRVRDSGGVVFVPAFNGLFAPYWDPDTRATIMGISQS 531

Query: 438 SSLNDLCRMYLGACEFIAQQTRHIVDIMTK------SGY---NLHSLYMSGGQCRNELLM 488
           ++ + + R    A E +  Q R I+  M        S Y   NL +L + GG  ++  +M
Sbjct: 532 TTASHIAR---AAIEGVCFQVRAILKAMGSDEVYGDSAYEKKNLATLAVDGGMSKSNEVM 588

Query: 489 QLISNCVGLPVVIPKNIDTAVVFGSALMGACASELSKSHSDNTKKPDQILW 539
           Q+ ++ +G  + + +   + +V  +AL  A A+ ++       K+ ++ILW
Sbjct: 589 QIQADILGPCIKLRR---SPIVECTALGAAIAANMAYK-----KEAERILW 631

>KNAG0J02920 Chr10 (561449..563476) [2028 bp, 675 aa] {ON} Anc_4.9
           YHL032C
          Length = 675

 Score = 40.0 bits (92), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 43/189 (22%), Positives = 82/189 (43%), Gaps = 42/189 (22%)

Query: 381 SVFEVLNNKIRELTHQRD---LIDEVHLIKNLFFYGDFHGNRSPVADEAMRGNIIGLSMD 437
           SV + L + +R +   +D   L +EV     + F   F G  +P  D + R  I+G+S  
Sbjct: 427 SVVQWLRDNLRLINRAQDVGPLANEVPDSGGVVFVPAFSGLFAPYWDGSARATIMGISQF 486

Query: 438 SSLNDLCRMYLGACEFIAQQTRHIVDIMTKSGYN-------------------------- 471
           ++ + + R    A E +  Q R I+  M+   Y+                          
Sbjct: 487 TTASHIAR---AAVEGVCFQARAILKAMSSDAYDGDISDDIDLLESGIGHDHTCAYEKSL 543

Query: 472 LHSLYMSGGQCRNELLMQLISNCVGLPVVIPKNIDTAVVFGSALMGACASELSKSHSDNT 531
           L +L + GG  R++ +MQ+ ++ +G  + I +   + V+  +AL  A A+ ++       
Sbjct: 544 LSTLSVDGGMSRSDEVMQIQADILGPCIKIRR---SPVLESTALGAAIAANMA------Y 594

Query: 532 KKPDQ-ILW 539
           K P++ +LW
Sbjct: 595 KTPEERVLW 603

>NDAI0H00220 Chr8 complement(30959..33391) [2433 bp, 810 aa] {ON}
           Anc_4.9 YHL032C
          Length = 810

 Score = 38.9 bits (89), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 35/152 (23%), Positives = 72/152 (47%), Gaps = 18/152 (11%)

Query: 395 HQRDLIDEVHLIKNLFFYGDFHGNRSPVADEAMRGNIIGLSMDSSLNDLCRMYLGACEFI 454
           H   L   V     + F   F+G  +P  D   R  I+G+S  ++ + + R    A E +
Sbjct: 596 HVGPLASRVRDSGGVVFVPAFNGLFAPYWDPDTRATIMGISQSTTASHIAR---AAIEGV 652

Query: 455 AQQTRHIVDIMT----KSGY---NLHSLYMSGGQCRNELLMQLISNCVGLPVVIPKNIDT 507
             Q R I+  M+    + GY    + +L + GG  +++ +MQ+ ++ +G  + + +   +
Sbjct: 653 CFQVRAILKAMSGDKIEDGYEKGTVVTLSVDGGMSKSDEVMQIQADILGPCIKLRR---S 709

Query: 508 AVVFGSALMGACASELSKSHSDNTKKPDQILW 539
            +V  +AL  A A+ ++  + +     D++LW
Sbjct: 710 PIVECTALGAAIAANMAYKNVE-----DRVLW 736

>ACL069C Chr3 complement(232439..234373) [1935 bp, 644 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YHL032C
           (GUT1)
          Length = 644

 Score = 38.5 bits (88), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 39/184 (21%), Positives = 71/184 (38%), Gaps = 37/184 (20%)

Query: 381 SVFEVLNNKIRELTHQRD---LIDEVHLIKNLFFYGDFHGNRSPVADEAMRGNIIGLSMD 437
           SV + L + +R      D   L   V     + F   F G  +P  D A RG I+G+S  
Sbjct: 406 SVVQWLRDNLRLFPRAEDVGPLASRVPDCGGVVFVPAFSGLFAPYWDAAARGTILGMSQF 465

Query: 438 SSLNDLCRMYLGACEFIAQQTRHIVDIMTKSGYN----------------------LHSL 475
           ++ + + R    A E +  Q R I+  M+   +                       L  L
Sbjct: 466 TTASHIAR---AAIEGVCFQARAILKAMSSDAFGEGAKDHDFLEEIVDTGTYEHSPLSVL 522

Query: 476 YMSGGQCRNELLMQLISNCVGLPVVIPKNIDTAVVFGSALMGACASELSKSHSDNTKKPD 535
            + GG  +++ +MQ+ ++ +G  V + ++         A + AC +          K P+
Sbjct: 523 AVDGGMSKSDEVMQIQADILGPCVKVRRSPTAESTALGAAIAACMA---------YKDPN 573

Query: 536 QILW 539
           + +W
Sbjct: 574 ERVW 577

>CAGL0E03916g Chr5 (371422..373440) [2019 bp, 672 aa] {ON} similar
           to uniprot|P32190 Saccharomyces cerevisiae YHL032c GUT1
           glycerol kinase
          Length = 672

 Score = 35.8 bits (81), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 42/184 (22%), Positives = 78/184 (42%), Gaps = 36/184 (19%)

Query: 381 SVFEVLNNKIRELTHQRD---LIDEVHLIKNLFFYGDFHGNRSPVADEAMRGNIIGLSMD 437
           +V + L + +R +    D   + + V     + F   F G  +P  D   RG I+G+S  
Sbjct: 430 AVVQWLRDNLRLIPKAEDVGPIANSVPDSGGVVFVPAFSGLFAPYWDPEARGTIMGMSQY 489

Query: 438 SSLNDLCRMYLGACEFIAQQTRHIV-------------------DIMTKSGYN---LHSL 475
           ++ + + R    A E +  Q R I+                   +I  +  Y    L +L
Sbjct: 490 TTASHIAR---AAVEAVCFQARAILLAMSNDAMGEAEKDSTFKTEISEEGSYQKSLLSTL 546

Query: 476 YMSGGQCRNELLMQLISNCVGLPVVIPKNIDTAVVFGSALMGACASELSKSHSDNTKKPD 535
            + GG  R++ +MQ+ ++ +G P V  +   TA    +AL  A A+ ++       +  D
Sbjct: 547 AVDGGMSRSDEVMQIQADILG-PCVKVRRSPTAEC--TALGAAVAANMAYE-----RPQD 598

Query: 536 QILW 539
           ++LW
Sbjct: 599 RVLW 602

>KLLA0E00595g Chr5 complement(49243..51228) [1986 bp, 661 aa] {ON}
           similar to uniprot|P32190 Saccharomyces cerevisiae
           YHL032C GUT1 Glycerol kinase converts glycerol to
           glycerol- 3-phosphate glucose repression of expression
           is mediated by Adr1p and Ino2p-Ino4p derepression of
           expression on non- fermentable carbon sources is
           mediated by Opi1p and Rsf1p
          Length = 661

 Score = 34.7 bits (78), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 29/138 (21%), Positives = 57/138 (41%), Gaps = 25/138 (18%)

Query: 381 SVFEVLNNKIRELTHQRDLIDEVHLIKN---LFFYGDFHGNRSPVADEAMRGNIIGLSMD 437
           +V + L + +R +    D+      + N   + F   F G  +P  D   R  I+G+S  
Sbjct: 425 AVVQWLRDNLRLIPRAEDVGPLASAVPNSGGVVFVPAFSGLFAPYWDPDARATIMGMSQY 484

Query: 438 SSLNDLCRMYLGACEFIAQQTRHIVDIMTKSGYN-------------------LHSLYMS 478
           ++ + + R    A E +  Q R I+  M+   +                    L +L + 
Sbjct: 485 TTASHIAR---AAVEGVCFQARAILKAMSSDAFGSEDKDFLEEVVDETYEKTLLSTLAVD 541

Query: 479 GGQCRNELLMQLISNCVG 496
           GG  R++ +MQ+ ++ +G
Sbjct: 542 GGMSRSDEVMQIQADILG 559

>KNAG0C04350 Chr3 complement(853661..856675) [3015 bp, 1004 aa] {ON}
           Anc_7.436 YPR030W
          Length = 1004

 Score = 34.7 bits (78), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 30/111 (27%), Positives = 49/111 (44%), Gaps = 6/111 (5%)

Query: 309 LAVVAGTSTCHISLTNKPIFVPGVWGPYRDVLGHNFWCAEGGQSCTGALLQHVLETHPAY 368
           + VV       IS  NKPI++  VW    D L +    A+   S  G+ +   ++  P  
Sbjct: 512 IRVVRTPPQISISTANKPIYINRVWA---DSLSYEISFAQKYVSL-GSEVPIKIKLAPLE 567

Query: 369 KELCAISKQQDISVFEVLNNKIRELTHQRDLIDEVHLIKNLFFYGDFHGNR 419
           K LC   K+  +S+ E +    ++L ++ D +D V       +Y DF   R
Sbjct: 568 KNLCI--KRVRVSINEKITFVSKDLKYEYDQVDPVAKDPYNPYYLDFQSKR 616

>KLTH0E05654g Chr5 complement(499361..501421) [2061 bp, 686 aa] {ON}
           similar to uniprot|P32190 Saccharomyces cerevisiae
           YHL032C GUT1 Glycerol kinase converts glycerol to
           glycerol- 3-phosphate glucose repression of expression
           is mediated by Adr1p and Ino2p-Ino4p derepression of
           expression on non- fermentable carbon sources is
           mediated by Opi1p and Rsf1p
          Length = 686

 Score = 33.5 bits (75), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 31/140 (22%), Positives = 55/140 (39%), Gaps = 27/140 (19%)

Query: 381 SVFEVLNNKIRELTHQRD---LIDEVHLIKNLFFYGDFHGNRSPVADEAMRGNIIGLSMD 437
           +V + L + +R +    D   L   V     + F   F G  +P  D + R  I+G+S  
Sbjct: 439 AVVQWLRDNLRLIPKAEDIGPLASRVSDTGGVVFVPAFSGLFAPYWDASARATIMGMSQH 498

Query: 438 SSLNDLCRMYLGACEFIAQQTRHIVDIMTKSGYN---------------------LHSLY 476
           ++ + L R    A E +  Q R I+  M+                          L  L 
Sbjct: 499 TTASHLAR---AAVEGVCFQARAILKAMSSDAAGEGRKDRDFLEEVADGTYEKAPLSMLA 555

Query: 477 MSGGQCRNELLMQLISNCVG 496
           + GG  R++ +MQ+ ++ +G
Sbjct: 556 VDGGMSRSKEVMQIQADILG 575

>NCAS0A14690 Chr1 (2893776..2897702) [3927 bp, 1308 aa] {ON}
           Anc_7.436 YBL101C
          Length = 1308

 Score = 33.5 bits (75), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 28/128 (21%), Positives = 56/128 (43%), Gaps = 6/128 (4%)

Query: 290 EQLNNFQDNLNGMICSSGRLAVVAGTSTCHISLTNKPIFVPGVWGPYRDVLGHNFWCAEG 349
           ++ N F ++   +I +   L +V    +   S  NKPI++  VW    + L +     + 
Sbjct: 772 DKTNKFDNDHGEIISTELPLNIVRAPPSASFSTKNKPIYINKVWA---NSLSYEISFTQK 828

Query: 350 GQSCTGALLQHVLETHPAYKELCAISKQQDISVFEVLNNKIRELTHQRDLIDEVHLIKNL 409
                G L   + +  P  K +    K+  +S+ E +N   ++L H  + +D +    + 
Sbjct: 829 YVPLNGELPIKI-KLVPLVKNVSV--KRIRVSIVEDVNFYSKDLNHSFNQLDPLSSDPSN 885

Query: 410 FFYGDFHG 417
            FY +F+G
Sbjct: 886 PFYNEFNG 893

>NCAS0A05290 Chr1 complement(1047369..1050149) [2781 bp, 926 aa]
           {ON} 
          Length = 926

 Score = 33.1 bits (74), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 35/77 (45%), Gaps = 5/77 (6%)

Query: 382 VFEVLNNKIRELTHQRDLIDEVHLIKNLFFYG--DFHGNRSPVADEAMRGNIIGLSMDSS 439
           ++EVL+ KI      R +I    +   L +YG      N+  + D  +RG I+ L+ DS 
Sbjct: 394 IYEVLSKKIETPPEFRTIIKRYEIKDGLLYYGFTSRTKNKLCIPDNEIRGQILKLAHDSP 453

Query: 440 LNDLC---RMYLGACEF 453
            +  C   R +L    F
Sbjct: 454 ASAHCDALRTFLNISPF 470

>Suva_2.167 Chr2 complement(289751..292915) [3165 bp, 1054 aa] {ON}
           YDR017C (REAL)
          Length = 1054

 Score = 32.3 bits (72), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 25/46 (54%)

Query: 85  LVVLNSKTDQEVAVGPNFEDNDQNVILWMDHRALIETVEINSTDSK 130
           L   NS+ D E +  PN  +N +  +  MD  A  ET++I+S D +
Sbjct: 677 LTASNSRDDSEFSSSPNHANNAEEGVFDMDEDAGNETIKIDSHDQR 722

>Ecym_4673 Chr4 complement(1306433..1310044) [3612 bp, 1203 aa] {ON}
           similar to Ashbya gossypii AER398W
          Length = 1203

 Score = 32.0 bits (71), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 26/90 (28%), Positives = 40/90 (44%), Gaps = 7/90 (7%)

Query: 111 LWMDHRALIETVEIN-----STDSKCLKYVGGQMSVEMEIPKIKWLKNNMNPAVYKDCKF 165
           L  D+R++I+ +  +      TDS+ L +VG      + +   K +       V K CKF
Sbjct: 486 LVFDYRSMIKRLNFSFVGDYMTDSQLLHFVGCPNLERLTLVFCKQVTTKSIAQVLKGCKF 545

Query: 166 LDLPDFLTYKATGNSIRSFCSAVCK--QGL 193
           L   D    +  GN + +  S  CK  QGL
Sbjct: 546 LQSVDITGIREVGNELFTVLSTDCKRIQGL 575

>TPHA0B04850 Chr2 complement(1136421..1137923) [1503 bp, 500 aa]
           {ON} Anc_1.33 YDR516C
          Length = 500

 Score = 31.6 bits (70), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 25/110 (22%), Positives = 45/110 (40%), Gaps = 8/110 (7%)

Query: 436 MDSSLNDLCRMYLGACEFIAQQTRHIVDIMTKSGYNLHSLYMSGGQCRNELLMQLISNCV 495
           +   ++++C  ++   + +AQ T H +D M K    L  L     +  +  L  + S   
Sbjct: 14  LSKEVDEICEQFVVDSDKLAQMTEHFIDQMEK---GLQPLPADVSEATDRGLPMIPSFVT 70

Query: 496 GLPVVIPKNIDTAVVFGSALMGACASELSKSHSD-----NTKKPDQILWD 540
           GLP    + +  A   G      C+  L   H+       +K PD++L D
Sbjct: 71  GLPNGSERGVLLAADLGGTNFRICSVSLFGDHTFKLEQLKSKIPDELLED 120

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.135    0.405 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 61,562,437
Number of extensions: 2671289
Number of successful extensions: 6411
Number of sequences better than 10.0: 49
Number of HSP's gapped: 6439
Number of HSP's successfully gapped: 69
Length of query: 589
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 474
Effective length of database: 40,294,809
Effective search space: 19099739466
Effective search space used: 19099739466
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 69 (31.2 bits)