Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0E043908.256ON1278127863650.0
Smik_12.1438.256ON1220128220700.0
Suva_10.1688.256ON1220126620450.0
YLR084C (RAX2)8.256ON1220126420340.0
NCAS0B049808.256ON1204129320160.0
ZYRO0C01804g8.256ON1209126520010.0
Skud_12.1528.256ON1220126519790.0
NDAI0B023808.256ON1219127119340.0
Kpol_392.108.256ON1226128019290.0
SAKL0H17204g8.256ON1211127818950.0
TPHA0B032508.256ON1215128418640.0
TDEL0F038308.256ON1195114818530.0
KAFR0B026908.256ON1210129016770.0
KNAG0G020008.256ON1202126716540.0
Kwal_56.235898.256ON1213127715090.0
KLTH0G13838g8.256ON1214116714521e-179
CAGL0L12144g8.256ON1156110313891e-170
AGR095W8.256ON1201131513871e-170
KLLA0F18975g8.256ON1200114013731e-168
Ecym_43158.256ON1212118313501e-164
Ecym_83694.50ON1900104840.47
AGR059C8.280ON284108743.9
Kwal_23.52773.62ON47063736.5
AGR113W8.238ON215461729.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0E04390
         (1278 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0E04390 Chr5 complement(1115294..1119130) [3837 bp, 1278 aa]...  2456   0.0  
Smik_12.143 Chr12 complement(276428..280090) [3663 bp, 1220 aa] ...   801   0.0  
Suva_10.168 Chr10 complement(301631..305293) [3663 bp, 1220 aa] ...   792   0.0  
YLR084C Chr12 complement(296589..300251) [3663 bp, 1220 aa] {ON}...   788   0.0  
NCAS0B04980 Chr2 complement(912114..915728) [3615 bp, 1204 aa] {...   781   0.0  
ZYRO0C01804g Chr3 (140029..143658) [3630 bp, 1209 aa] {ON} simil...   775   0.0  
Skud_12.152 Chr12 complement(279947..283609) [3663 bp, 1220 aa] ...   766   0.0  
NDAI0B02380 Chr2 complement(595444..599103) [3660 bp, 1219 aa] {...   749   0.0  
Kpol_392.10 s392 (27006..30686) [3681 bp, 1226 aa] {ON} (27006.....   747   0.0  
SAKL0H17204g Chr8 (1522944..1526579) [3636 bp, 1211 aa] {ON} sim...   734   0.0  
TPHA0B03250 Chr2 (745716..749363) [3648 bp, 1215 aa] {ON} Anc_8....   722   0.0  
TDEL0F03830 Chr6 complement(701362..704949) [3588 bp, 1195 aa] {...   718   0.0  
KAFR0B02690 Chr2 complement(539470..543102) [3633 bp, 1210 aa] {...   650   0.0  
KNAG0G02000 Chr7 complement(443631..447239) [3609 bp, 1202 aa] {...   641   0.0  
Kwal_56.23589 s56 complement(610601..614242) [3642 bp, 1213 aa] ...   585   0.0  
KLTH0G13838g Chr7 (1197919..1201563) [3645 bp, 1214 aa] {ON} sim...   563   e-179
CAGL0L12144g Chr12 complement(1304574..1308044) [3471 bp, 1156 a...   539   e-170
AGR095W Chr7 (914098..917703) [3606 bp, 1201 aa] {ON} Syntenic h...   538   e-170
KLLA0F18975g Chr6 complement(1739543..1743145) [3603 bp, 1200 aa...   533   e-168
Ecym_4315 Chr4 (679627..683265) [3639 bp, 1212 aa] {ON} similar ...   524   e-164
Ecym_8369 Chr8 complement(739539..745227,745354..745367) [5703 b...    37   0.47 
AGR059C Chr7 complement(827087..827941) [855 bp, 284 aa] {ON} Sy...    33   3.9  
Kwal_23.5277 s23 complement(1088250..1089662) [1413 bp, 470 aa] ...    33   6.5  
AGR113W Chr7 (950399..956863) [6465 bp, 2154 aa] {ON} Syntenic h...    32   9.6  

>TBLA0E04390 Chr5 complement(1115294..1119130) [3837 bp, 1278 aa] {ON}
            Anc_8.256 YLR084C
          Length = 1278

 Score = 2456 bits (6365), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1234/1278 (96%), Positives = 1234/1278 (96%)

Query: 1    MRICIRTILGILLLSVAPSSVVANQLNHLKDILEIENIPAPQFNLQDSTNQSLQLLTSNG 60
            MRICIRTILGILLLSVAPSSVVANQLNHLKDILEIENIPAPQFNLQDSTNQSLQLLTSNG
Sbjct: 1    MRICIRTILGILLLSVAPSSVVANQLNHLKDILEIENIPAPQFNLQDSTNQSLQLLTSNG 60

Query: 61   FDTLNFVHYNGQQNFTQPIISSSQNHLIYYSNDTYIRLLDIPYSTRIQHIIPYGQDAFIL 120
            FDTLNFVHYNGQQNFTQPIISSSQNHLIYYSNDTYIRLLDIPYSTRIQHIIPYGQDAFIL
Sbjct: 61   FDTLNFVHYNGQQNFTQPIISSSQNHLIYYSNDTYIRLLDIPYSTRIQHIIPYGQDAFIL 120

Query: 121  SGTGSLNGFELSNQLVYNLTDLSLTPIFENKLVPEVRTIFKDPDTNLVYFGGNFSYLLPD 180
            SGTGSLNGFELSNQLVYNLTDLSLTPIFENKLVPEVRTIFKDPDTNLVYFGGNFSYLLPD
Sbjct: 121  SGTGSLNGFELSNQLVYNLTDLSLTPIFENKLVPEVRTIFKDPDTNLVYFGGNFSYLLPD 180

Query: 181  SNISNGLIIWDSSSNDTISYEFGGFGSNSVINNILKLNSNDLLFSGQFYTLDDPSILHIP 240
            SNISNGLIIWDSSSNDTISYEFGGFGSNSVINNILKLNSNDLLFSGQFYTLDDPSILHIP
Sbjct: 181  SNISNGLIIWDSSSNDTISYEFGGFGSNSVINNILKLNSNDLLFSGQFYTLDDPSILHIP 240

Query: 241  YNITFPNNTSSLLSQQNVSTFELNQRIPLTFGKFSTADTNDYINKNQLICPTSEIEAWAS 300
            YNITFPNNTSSLLSQQNVSTFELNQRIPLTFGKFSTADTNDYINKNQLICPTSEIEAWAS
Sbjct: 241  YNITFPNNTSSLLSQQNVSTFELNQRIPLTFGKFSTADTNDYINKNQLICPTSEIEAWAS 300

Query: 301  DSKAGSLQITLPFSIRPSKIRIFNSPDPDDEVATFRINPGNQNSIMSLAYLDPLDGQLKY 360
            DSKAGSLQITLPFSIRPSKIRIFNSPDPDDEVATFRINPGNQNSIMSLAYLDPLDGQLKY
Sbjct: 301  DSKAGSLQITLPFSIRPSKIRIFNSPDPDDEVATFRINPGNQNSIMSLAYLDPLDGQLKY 360

Query: 361  CSEFCPLYNRNQLKLFNSNDNLKSHVITLLDNNTTDIKWSTTYQEFAFVNQFDLTTLEFQ 420
            CSEFCPLYNRNQLKLFNSNDNLKSHVITLLDNNTTDIKWSTTYQEFAFVNQFDLTTLEFQ
Sbjct: 361  CSEFCPLYNRNQLKLFNSNDNLKSHVITLLDNNTTDIKWSTTYQEFAFVNQFDLTTLEFQ 420

Query: 421  ALSSYGSRVGLSGLSLFQSDIAVFANESYNKPSCNDQTAYDNEDLIKAALPRVMGSSYSI 480
            ALSSYGSRVGLSGLSLFQSDIAVFANESYNKPSCNDQTAYDNEDLIKAALPRVMGSSYSI
Sbjct: 421  ALSSYGSRVGLSGLSLFQSDIAVFANESYNKPSCNDQTAYDNEDLIKAALPRVMGSSYSI 480

Query: 481  LSDNDWYTPLPNSDYLACTYLSSSKLIPTVTFYPNLLYAGNYTVDMITPGCTADNSCDSR 540
            LSDNDWYTPLPNSDYLACTYLSSSKLIPTVTFYPNLLYAGNYTVDMITPGCTADNSCDSR
Sbjct: 481  LSDNDWYTPLPNSDYLACTYLSSSKLIPTVTFYPNLLYAGNYTVDMITPGCTADNSCDSR 540

Query: 541  GIVNVTMWNQTDSSILQTSLIYQTNENYKFDQIFNGYLDPLVKITMSFYSGVYSNTGNFT 600
            GIVNVTMWNQTDSSILQTSLIYQTNENYKFDQIFNGYLDPLVKITMSFYSGVYSNTGNFT
Sbjct: 541  GIVNVTMWNQTDSSILQTSLIYQTNENYKFDQIFNGYLDPLVKITMSFYSGVYSNTGNFT 600

Query: 601  IVADRINLIINSLDFVTTTSSNEIDIYNVTLNGLFQYPEYNSVNNLNENYTNSTINQYAY 660
            IVADRINLIINSLDFVTTTSSNEIDIYNVTLNGLFQYPEYNSVNNLNENYTNSTINQYAY
Sbjct: 601  IVADRINLIINSLDFVTTTSSNEIDIYNVTLNGLFQYPEYNSVNNLNENYTNSTINQYAY 660

Query: 661  SNYPANVSLIAAAYDKDTLLVGGSINKLQEFQIEKNGQNISLQNTFKDLNSVTGIVPYSD 720
            SNYPANVSLIAAAYDKDTLLVGGSINKLQEFQIEKNGQNISLQNTFKDLNSVTGIVPYSD
Sbjct: 661  SNYPANVSLIAAAYDKDTLLVGGSINKLQEFQIEKNGQNISLQNTFKDLNSVTGIVPYSD 720

Query: 721  GLIAYGDIMDSSGSYKAITFTNNKFGTLGNFTDEIQSFSNISLTTSWEILSFNNKYFYNQ 780
            GLIAYGDIMDSSGSYKAITFTNNKFGTLGNFTDEIQSFSNISLTTSWEILSFNNKYFYNQ
Sbjct: 721  GLIAYGDIMDSSGSYKAITFTNNKFGTLGNFTDEIQSFSNISLTTSWEILSFNNKYFYNQ 780

Query: 781  SNMEDFKNTSTFELSLWSAGKNAQNDLIFSGLVSENENVNLTGVVSINANEQIKELNLGN 840
            SNMEDFKNTSTFELSLWSAGKNAQNDLIFSGLVSENENVNLTGVVSINANEQIKELNLGN
Sbjct: 781  SNMEDFKNTSTFELSLWSAGKNAQNDLIFSGLVSENENVNLTGVVSINANEQIKELNLGN 840

Query: 841  NIYPYSAVFLNDSSTIYAYMEPNTRLNRLIHSNGEQISWSWKNKISSMAFFPNESLLSVG 900
            NIYPYSAVFLNDSSTIYAYMEPNTRLNRLIHSNGEQISWSWKNKISSMAFFPNESLLSVG
Sbjct: 841  NIYPYSAVFLNDSSTIYAYMEPNTRLNRLIHSNGEQISWSWKNKISSMAFFPNESLLSVG 900

Query: 901  TISDKDVFPSFSILNLTSNKVIANETLNKNSQISSLLYFTKNSSVLVGGNFTFSDYQCSG 960
            TISDKDVFPSFSILNLTSNKVIANETLNKNSQISSLLYFTKNSSVLVGGNFTFSDYQCSG
Sbjct: 901  TISDKDVFPSFSILNLTSNKVIANETLNKNSQISSLLYFTKNSSVLVGGNFTFSDYQCSG 960

Query: 961  LCLFNYETKNWSTFMNNTLEGTVSKLELKNNSNILISGTLSTNKSANIDLALLNLNTYNV 1020
            LCLFNYETKNWSTFMNNTLEGTVSKLELKNNSNILISGTLSTNKSANIDLALLNLNTYNV
Sbjct: 961  LCLFNYETKNWSTFMNNTLEGTVSKLELKNNSNILISGTLSTNKSANIDLALLNLNTYNV 1020

Query: 1021 SILLQNTNLTSFEFTGNQIAAWNSSTLFQYNNEAWSQILLPNGTESLKLDSISIFDITNK 1080
            SILLQNTNLTSFEFTGNQIAAWNSSTLFQYNNEAWSQILLPNGTESLKLDSISIFDITNK
Sbjct: 1021 SILLQNTNLTSFEFTGNQIAAWNSSTLFQYNNEAWSQILLPNGTESLKLDSISIFDITNK 1080

Query: 1081 NSSSILEKRALRDTNIMVATGQFYSKGLGTVQALYYTSDTWIPYFYGNLTNNMDTSNSIN 1140
            NSSSILEKRALRDTNIMVATGQFYSKGLGTVQALYYTSDTWIPYFYGNLTNNMDTSNSIN
Sbjct: 1081 NSSSILEKRALRDTNIMVATGQFYSKGLGTVQALYYTSDTWIPYFYGNLTNNMDTSNSIN 1140

Query: 1141 IFPNKDISSKIISDFVLKNWNFNLSDVGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXI 1200
            IFPNKDISSKIISDFVLKNWNFNLSDVG                               I
Sbjct: 1141 IFPNKDISSKIISDFVLKNWNFNLSDVGNSTNTTNSTNTTSTTNLTSPSNTTSPQPSSSI 1200

Query: 1201 IPIIGKQQNKKHKIQRGFVVLIGLALSLATVAXXXXXXXXXXXXXRDSRGDYESLKPRTT 1260
            IPIIGKQQNKKHKIQRGFVVLIGLALSLATVA             RDSRGDYESLKPRTT
Sbjct: 1201 IPIIGKQQNKKHKIQRGFVVLIGLALSLATVALLGIFGILLSFIFRDSRGDYESLKPRTT 1260

Query: 1261 EHEMFDAVPPEKLMPFVL 1278
            EHEMFDAVPPEKLMPFVL
Sbjct: 1261 EHEMFDAVPPEKLMPFVL 1278

>Smik_12.143 Chr12 complement(276428..280090) [3663 bp, 1220 aa] {ON}
            YLR084C (REAL)
          Length = 1220

 Score =  801 bits (2070), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 501/1282 (39%), Positives = 738/1282 (57%), Gaps = 83/1282 (6%)

Query: 9    LGILLLSVAPSSVVANQLNHLKDILEIENIPAPQFNLQDSTNQSLQLLTSNGFDTLNFVH 68
            L  L L+ A     A+QL ++K +L+IE+   P  N+  + + ++Q+L   G D ++F  
Sbjct: 9    LAFLFLAQASK---ASQLQNIKSLLDIEDNVLPNLNISQNNSNAVQIL--GGVDAISFYK 63

Query: 69   YNGQQNFTQPIISSSQNH-LIYYSNDTYIRLLDIPYSTRIQHIIPYGQDAFILSGTGSLN 127
            Y GQQNFT+ I   + +H L+YYSN+TYI+L D    TRI  I P+G D+FILSG+G++N
Sbjct: 64   YTGQQNFTKGISPGTNSHGLVYYSNNTYIQLEDASDDTRIDKITPFGDDSFILSGSGTIN 123

Query: 128  GFELSNQLVYNLTDLSLTPIFENKLVPEVRTIFKDPDTNLVYFGGNFSYLLPDSNISNGL 187
               + NQ++YNL+ LS+ PIF N+ + +V T+  + DT+ VYFGGNFSY    S I +  
Sbjct: 124  NISVGNQILYNLSTLSMAPIF-NQSLGDVETVLVN-DTS-VYFGGNFSYN-NGSMIGHSA 179

Query: 188  IIWDSSSNDTISYEFGGFGSNSVINNILKLNSNDLLFSGQFYTLDDPSILHIPYNITFPN 247
            ++WD+ S+      FGGFG NS +N+ILKLN ++++F+G+FYTLDD S+L     IT  N
Sbjct: 180  LVWDAMSDTAQLLPFGGFGENSNVNSILKLNDDNIVFAGKFYTLDDSSVL-----ITSSN 234

Query: 248  NTSSLLSQQNVSTFELNQRIPLTFGKFSTADTNDYINKNQLICPTSEIEAWASDSKAGSL 307
            N ++     N +  EL QRI L +  + +  +   +  N L+CP     AW   + +GSL
Sbjct: 235  NGTNSTFSLNATKLELGQRISLRYASWDSQGSTT-LASNSLVCPNDNGNAWLYPATSGSL 293

Query: 308  QITLPFSIRPSKIRIFNSPDPDDEVATFRINPGNQNSIMSLAYLDPLDGQLKYCSEFCPL 367
               LP+ + P+KIR++NS D   E+A F+I     +SIM+L YLDPL G+LK C EFCPL
Sbjct: 294  VCNLPYEVSPTKIRLYNSQDAGSEIALFQILTNPSSSIMNLTYLDPLSGELKNCDEFCPL 353

Query: 368  YNRNQLKLFNSNDNLKSHVITLLDNNTTDIKWSTTYQEFAFVNQFDLTTLEFQALSSYGS 427
            Y+R  L   + N +    +IT +D N TD+KWS+ +Q+FAF N+  +T+L+  AL+SYG 
Sbjct: 354  YSRATLLAASQNASSSMDMITFIDGNNTDVKWSSDFQDFAFANELPVTSLKLIALNSYGD 413

Query: 428  RVGLSGLSLFQSDIAVFANESYNKPSCNDQTAYDNEDLIKAALPRVMGSSYSILSDNDWY 487
             +GLSGL L+Q+  + +AN S N+  C             +AL  V  SS SILS+N WY
Sbjct: 414  SIGLSGLELYQNTFSTYANNSLNEYGC-------------SAL--VNDSSSSILSNNSWY 458

Query: 488  TPLPNSDYLACTYL-SSSKLIPTVTFYPNLLYAGNYTVDMITPGCTADNSCDSRGIVNVT 546
              L    Y+A  Y+   ++ IP V FYPN++++G+YT++  TPGC  DN+C SRGIVNVT
Sbjct: 459  NGLTGESYIATNYIPDQNEPIPRVKFYPNIIHSGHYTINTYTPGCVQDNTCSSRGIVNVT 518

Query: 547  MWNQTDSSILQTSLIYQTNENYKFDQIFNGYLDPLVKITMSFYSGVYSNTGNFTIVADRI 606
            +WN  ++++++T  IYQ N+N K+DQIF+GYLD   +I + + SG+YS+     +VADR+
Sbjct: 519  VWNPQNNTMMKTYTIYQNNDNLKYDQIFSGYLDFSPEIVLEYISGIYSSNTATVVVADRV 578

Query: 607  NLIINSLDFVTTTSSNEIDIYNVT----LNGLFQYPEYN--SVNNLNENYTNSTINQYAY 660
            N+I  SLD     S    +I NV     LNG+FQY + N     +      N+T+N +  
Sbjct: 579  NVITVSLDTFNALS----EINNVKRQTPLNGIFQYQKSNFTGTTSNKTKVGNTTLNLFPV 634

Query: 661  SNYPANVSLIAAAYDKDTLLVGGSINKLQEFQIEKNGQNISLQNTFKDLNSVTGIVPYSD 720
            +NYP N SL+   Y+ D L+VGG  N++    + +N +  S +N       V GI     
Sbjct: 635  NNYPKNASLLVEIYN-DKLIVGGVSNRISTIDLNENFEIKSSENRTIQ-GDVYGITKTGQ 692

Query: 721  GLIAYGDIMDSSGSYKAITFTNNKFGTLGNFTDEIQSFSNISLTTSWEILSFNNKYFYNQ 780
            GL+ YGD+  S      + F N  FG + N++  + S +NIS+  + E+  F+N Y  N 
Sbjct: 693  GLLIYGDLRSSDNQSTVLLF-NESFGKVPNYSKRVNSATNISIADN-ELFVFDNNYIINA 750

Query: 781  SNMEDFKNTSTFELSLWSAGKNAQNDLIFSGLVSENENVNLTGVVSINANEQIKELNLGN 840
            S+     N+++F LSLW+AG N   D++FSG VS  E  NL G  S    +Q++ LN+G 
Sbjct: 751  SSNAQISNSTSFSLSLWAAGNNGNGDVLFSGTVSHMEFSNLNGSASFKNEDQVQALNIGR 810

Query: 841  NIYPYSAVFLNDSSTIYAYMEPNTRLNRLIHSNGEQISWSWKNKISSMAFFPNESLLSVG 900
             I PY   +LN+S + YAY      LN++  SN    SW+W N I+ M +  N+++L V 
Sbjct: 811  GIVPYFGAYLNESVSAYAY--ETDALNKIYFSNKVNPSWNWSNTITRMLYANNQTMLVVS 868

Query: 901  TISDKDVFPSFSILNLTSNKVIANETLNKNSQISSLLYFTKNSSVLVGGNFTFSDYQCSG 960
              S+       +I NL +   IANETL  N+++S+L+ F KNSS+LVGG+F  +   CSG
Sbjct: 869  --SESSSTADLTIFNLRNMTTIANETLGSNAKVSALVNFEKNSSILVGGDFQITKPNCSG 926

Query: 961  LCLFNYETKNWSTFMNNTLEGTVSKLELKNNSNILISGTLSTNKSANIDLALLNLNTYNV 1020
            LCL+NYETK+WSTF NNT+ G V++L L N+S ++ISG  +T +  +I L   NLN + +
Sbjct: 927  LCLYNYETKSWSTFFNNTIFGEVTQLSLANSSELIISGLFNTREHQSIRLGSFNLNNFTM 986

Query: 1021 SILLQNT--NLTSFEFTGNQIAAWNSSTLFQYNNEAWSQILLPNGTESLKLDSISIFDIT 1078
              LL  +   L SF  T N + AWN ++LF Y N+ W+   LP+    +     S+  I+
Sbjct: 987  VPLLSGSEGKLNSFVVTDNSLVAWNDTSLFIYGNQKWNITSLPSDDSLIG----SVSTIS 1042

Query: 1079 NKNSSSILEKRA---LRDTNIMVATGQFYSKGLGTVQALYYTSDTWIPYFYGNLTNNMDT 1135
                S  L KRA     D +I++  G F     G +Q+L +    W PYF   ++N+ + 
Sbjct: 1043 TNTKSDTLNKRATNNAHDGSILLLNGNFTMPQYGNLQSLLFDFQAWTPYFISEISNSSNY 1102

Query: 1136 SNSINIFPNKDISSKIISDFVLKNWNFNLSDVGXXXXXXXXXXXXXXXXXXXXXXXXXXX 1195
            + +   F N+D+S++  S   L N N  +++                             
Sbjct: 1103 NPT--FFINRDVSTEFNSQITLPNLNITVTNPQSTSSQSPSTSATSES------------ 1148

Query: 1196 XXXXIIPIIGKQQNKKHKIQRGFVVLIGLALSLATVAXXXXXXXXXXXXXRDSRGDYESL 1255
                      K +++K KI RGFVVLIGLAL+L TV+             +D  GDY+ +
Sbjct: 1149 ----------KSKSEKKKIDRGFVVLIGLALALGTVSVLGIVGVILAYVFKDPEGDYKPI 1198

Query: 1256 KPRTTEHEMFDAVPPEKLMPFV 1277
            KPR  E+EM D VPPEKLM FV
Sbjct: 1199 KPRIDENEMLDTVPPEKLMKFV 1220

>Suva_10.168 Chr10 complement(301631..305293) [3663 bp, 1220 aa] {ON}
            YLR084C (REAL)
          Length = 1220

 Score =  792 bits (2045), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 487/1266 (38%), Positives = 723/1266 (57%), Gaps = 76/1266 (6%)

Query: 23   ANQLNHLKDILEIENIPAPQFNLQDSTNQSLQLLTSNGFDTLNFVHYNGQQNFTQPIISS 82
            A+QL  +K +L+IE+   P  N+    + ++Q+L   G D L+F  Y GQQNFT+ I S 
Sbjct: 20   ASQLQSIKALLDIEDNVLPSLNISQDNDNAIQIL--GGVDALSFYEYTGQQNFTKEIGSE 77

Query: 83   SQNH-LIYYSNDTYIRLLDIPYSTRIQHIIPYGQDAFILSGTGSLNGFELSNQLVYNLTD 141
            + +  L+YYSN+TYI L +    TRI  I P+G D+FILSG+GS+NG  L NQ++YNL+ 
Sbjct: 78   TNSRGLVYYSNNTYILLEEADEDTRIDKITPFGADSFILSGSGSINGVPLGNQVLYNLST 137

Query: 142  LSLTPIFENKLVPEVRTIFKDPDTNLVYFGGNFSYLLPDSNISNGLIIWDSSSNDTISYE 201
            LS+  IF   L      +  D     VYFGGNFSY    S   +G ++WDS+SN T    
Sbjct: 138  LSMARIFTQSLGSVEAVLVNDTS---VYFGGNFSYN-NGSMTGHGALVWDSTSNTTQLLP 193

Query: 202  FGGFGSNSVINNILKLNSNDLLFSGQFYTLDDPSILHIPYNITFPNNTSSLLSQQNVSTF 261
            FGGFG +S +N+I+KLN +++LF+G+FYTLDD SIL      T   NT++  S  N +T 
Sbjct: 194  FGGFGEDSNVNSIVKLNDDNILFAGKFYTLDDSSILT-----TSSTNTTNASSTLNATTL 248

Query: 262  ELNQRIPLTFGKFSTADTNDYINKNQLICPTSEIEAWASDSKAGSLQITLPFSIRPSKIR 321
            EL QRIPL +  + +  +  +   + L+CP +  +AW     +GSL  TLP+ + P+KIR
Sbjct: 249  ELGQRIPLRYASWDSQGSTTF-ESSYLVCPDTSKDAWLYPGTSGSLVCTLPYEVAPTKIR 307

Query: 322  IFNSPDPDDEVATFRINPGNQNSIMSLAYLDPLDGQLKYCSEFCPLYNRNQLKLFNSNDN 381
            ++NSP+ D++++ F+I      SIM+L YLDP+ G+L+ C EFCPLY+R+ L   + N +
Sbjct: 308  LYNSPNSDNDISLFQILTNPSGSIMNLTYLDPISGELQSCDEFCPLYSRDTLLSASQNVS 367

Query: 382  LKSHVITLLDNNTTDIKWSTTYQEFAFVNQFDLTTLEFQALSSYGSRVGLSGLSLFQSDI 441
                +I+ +DNN TD+KWS+ +Q+FAF N+  +T+L+F AL+SYG++VGLSGL L+Q   
Sbjct: 368  SSLDMISFIDNNNTDVKWSSDFQDFAFANELSVTSLKFTALNSYGNKVGLSGLELYQDTF 427

Query: 442  AVFANESYNKPSCNDQTAYDNEDLIKAALPRVMGSSYSILSDNDWYTPLPNSDYLACTYL 501
            + +AN S N+  C   +A  N+            SS SILSDN WY  L    Y+A  Y+
Sbjct: 428  STYANNSLNEYGC---SALAND------------SSSSILSDNKWYDGLTGQSYIAIDYV 472

Query: 502  -SSSKLIPTVTFYPNLLYAGNYTVDMITPGCTADNSCDSRGIVNVTMWNQTDSSILQTSL 560
             + +K  PTVTFYP++++ G+YT++  TPGC  DN+C SRGIVNVTMWN  ++++++T L
Sbjct: 473  PNQTKPTPTVTFYPSIIHPGHYTINTYTPGCVQDNTCSSRGIVNVTMWNPQNNTMMETYL 532

Query: 561  IYQTNENYKFDQIFNGYLDPLVKITMSFYSGVYSNTGNFTIVADRINLIINSLDFVTTTS 620
            IYQ N N K+D+I++GYLD   +I M + SG+Y++     +VAD++N+I +SLD  ++ S
Sbjct: 533  IYQNNNNLKYDKIYSGYLDFSPEIVMKYVSGIYASNTATIMVADQVNIITDSLDSFSSLS 592

Query: 621  SNEIDIYNVTLNGLFQYPEYN--SVNNLNENYTNSTINQYAYSNYPANVSLIAAAYDKDT 678
                   +  LNG+ QY   N  +  +      N+T+N ++  NYP N S+ A  YDK  
Sbjct: 593  ETTSVKRHTPLNGILQYQRSNFTATTSNGTKIANTTLNLFSVDNYPKNSSMFADVYDKK- 651

Query: 679  LLVGGSINKLQEFQIEKNGQNISLQNTFKDLNSVTGIVPYSDGLIAYGDIMDSSGSYKAI 738
            L++GG  N +       N +  S +N       V G+   + GL+ +GD+  S      +
Sbjct: 652  LILGGKDNHISVIDFNDNLEVTSSENKTIQ-GDVYGMTQTNQGLLIFGDVRSSDNKSTVL 710

Query: 739  TFTNNKFGTLGNFTDEIQSFSNISLTTSWEILSFNNKYFYNQSNMEDFKNTSTFELSLWS 798
             F N  F ++ N++  +++  NI+L  + +++ FNN Y +N S+     N+++F LSLWS
Sbjct: 711  MF-NGSFESVSNYSKAVENAINITLANN-DLIVFNNDYIFNASSNSQISNSTSFSLSLWS 768

Query: 799  AGKNAQNDLIFSGLVSENENVNLTGVVSINANEQIKELNLGNNIYPYSAVFLNDSSTIYA 858
            AG N  +D++FSG VS+ +  +L+G         ++ LNL   I PY   +LN+S+  YA
Sbjct: 769  AGNNDNDDVLFSGAVSQMQFSDLSGSARFLNESTVEALNLNKGIVPYLGAYLNESTIAYA 828

Query: 859  YMEPNTRLNRLIHSNGEQISWSWKNKISSMAFFPNESLLSVGTISDKDVFPSFSILNLTS 918
            Y      L+++  SN    SW+W N I+ M +  N++LL +G  S+       SILNL +
Sbjct: 829  Y--KTNSLSKIYFSNNVSPSWNWSNNITKMVYANNQTLLVIG--SESSTTAELSILNLRN 884

Query: 919  NKVIANETLNKNSQISSLLYFTKNSSVLVGGNFTFSDYQCSGLCLFNYETKNWSTFMNNT 978
               IANETL  N++I++ + F KNSS+LVGG+F  S   C+GLC++NYE+K+WSTF NNT
Sbjct: 885  FTTIANETLGSNAKINAFVNFEKNSSLLVGGDFQMSKPNCTGLCVYNYESKSWSTFFNNT 944

Query: 979  LEGTVSKLELKNNSNILISGTLSTNKSANIDLALLNLNTYNVSILLQNTN--LTSFEFTG 1036
            + G +++L   N S ++ISG  +T K  +I L   NL    +  LL  +   L SF  T 
Sbjct: 945  IVGEITQLAFNNESELIISGLFATEKQQSIRLGSFNLTNSTMVPLLTGSGGKLNSFTVTE 1004

Query: 1037 NQIAAWNSSTLFQYNNEAWSQILLPNGTESLKLDSISIFDITNKNSSSILEKRALRDT-- 1094
              I AWN ++L  Y ++ W+   LP    S+     S+  I     S  L KRA  D   
Sbjct: 1005 ESIVAWNDTSLLIYKDQKWNTTSLPGNGSSVS----SVTTIDTNTDSYALRKRATTDAEK 1060

Query: 1095 -NIMVATGQFYSKGLGTVQALYYTSDTWIPYFYGNLTNNMDTSNSIN--IFPNKDISSKI 1151
             +I++  G F     G +Q L + S  W PYF    T+    ++S N  IF N+D+S+  
Sbjct: 1061 GSILLLNGNFSIPQYGNLQGLLFDSQNWTPYF----TSETLEASSYNPTIFINRDVSADF 1116

Query: 1152 ISDFVLKNWNFNLSDVGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIIPIIGKQQNKK 1211
             S   L N N  ++                                         +++KK
Sbjct: 1117 NSQIPLSNSNMTVTSPQSTSPLSPSSSASSEP----------------------NKKSKK 1154

Query: 1212 HKIQRGFVVLIGLALSLATVAXXXXXXXXXXXXXRDSRGDYESLKPRTTEHEMFDAVPPE 1271
              + RGFVVLIGLAL+L TV+             +D  GDY  +KPR  E+EM D VPPE
Sbjct: 1155 KNMDRGFVVLIGLALALGTVSVLGIVGVILAYVFKDPEGDYRPIKPRIDENEMLDTVPPE 1214

Query: 1272 KLMPFV 1277
            KLM FV
Sbjct: 1215 KLMKFV 1220

>YLR084C Chr12 complement(296589..300251) [3663 bp, 1220 aa] {ON}
            RAX2N-glycosylated protein involved in the maintenance of
            bud site selection during bipolar budding; localization
            requires Rax1p; RAX2 mRNA stability is regulated by Mpt5p
          Length = 1220

 Score =  788 bits (2034), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 498/1264 (39%), Positives = 728/1264 (57%), Gaps = 72/1264 (5%)

Query: 23   ANQLNHLKDILEIENIPAPQFNLQDSTNQSLQLLTSNGFDTLNFVHYNGQQNFTQPIISS 82
            A+QL ++K +L+IE+   P  N+  + + ++Q+L   G D L+F  Y GQQNFT+ I   
Sbjct: 20   ASQLENIKSLLDIEDNVLPNLNISQNNSNAVQIL--GGVDALSFYEYTGQQNFTKEIGPE 77

Query: 83   SQNH-LIYYSNDTYIRLLDIPYSTRIQHIIPYGQDAFILSGTGSLNGFELSNQLVYNLTD 141
            + +H L+YYSN+TYI+L D    TRI  I P+G D+FILSG+G++N   + NQ++YNL+ 
Sbjct: 78   TSSHGLVYYSNNTYIQLEDASDDTRIDKITPFGVDSFILSGSGTINNISVGNQILYNLST 137

Query: 142  LSLTPIFENKLVPEVRTIFKDPDTNLVYFGGNFSYLLPDSNISNGLIIWDSSSNDTISYE 201
            LS+TPIF N+ +  V+ +  D  +  +YFGGNFSY    S      +IWDS SN T    
Sbjct: 138  LSMTPIF-NQSLGAVQAVLADNSS--IYFGGNFSYN-NGSMTGYSALIWDSISNTTQLLP 193

Query: 202  FGGFGSNSVINNILKLNSNDLLFSGQFYTLDDPSILHIPYNITFPNNTSSLLSQQNVSTF 261
            FGGFG NS +N+I+KLN++++LF+GQFYTLDDPS L     I+  NN ++  S  N +T 
Sbjct: 194  FGGFGENSSVNSIVKLNNDNILFAGQFYTLDDPSAL-----ISSSNNGTNSTSSLNATTL 248

Query: 262  ELNQRIPLTFGKFSTADTNDYINKNQLICPTSEIEAWASDSKAGSLQITLPFSIRPSKIR 321
            EL QRIPL +  + +  +  +   + L+CP +  +AW     +GSL   LP+ + P+KIR
Sbjct: 249  ELGQRIPLRYASWDSQGSTTFA-SDSLVCPNTNEDAWLYPDTSGSLVCNLPYEVSPTKIR 307

Query: 322  IFNSPDPDDEVATFRINPGNQNSIMSLAYLDPLDGQLKYCSEFCPLYNRNQLKLFNSNDN 381
            ++NS   D E++ F+I     +SIM+L YLDPL G+LK C EFCPLY+R  L   + N +
Sbjct: 308  LYNSQRSDSEISVFQILTDPSSSIMNLTYLDPLSGELKNCGEFCPLYSRATLLSASQNVS 367

Query: 382  LKSHVITLLDNNTTDIKWSTTYQEFAFVNQFDLTTLEFQALSSYGSRVGLSGLSLFQSDI 441
                +IT +DNN TD+KW++ +Q+FAFVN+  +++L+F AL+SYG  VGLSGL L+Q   
Sbjct: 368  SSMDMITFIDNNKTDVKWTSDFQDFAFVNELPVSSLKFVALNSYGGSVGLSGLELYQDTF 427

Query: 442  AVFANESYNKPSCNDQTAYDNEDLIKAALPRVMGSSYSILSDNDWYTPLPNSDYLACTYL 501
            + +AN+S N+  C             +AL     SS    +  DWY  L    Y+A  Y+
Sbjct: 428  STYANDSLNEYGC-------------SALTNDSSSSTLSSN--DWYNGLTGESYIAAKYV 472

Query: 502  -SSSKLIPTVTFYPNLLYAGNYTVDMITPGCTADNSCDSRGIVNVTMWNQTDSSILQTSL 560
               ++ IP V FYPN+++ G+YT++M TPGC  DN+C +RGIVNVTMWNQ +++I++T L
Sbjct: 473  PDQNEPIPRVKFYPNIIHPGHYTINMYTPGCLQDNTCSARGIVNVTMWNQQNNTIMKTYL 532

Query: 561  IYQTNENYKFDQIFNGYLDPLVKITMSFYSGVYSNTGNFTIVADRINLIINSLDFVTTTS 620
            IYQ N+N K+DQI++GYLD   +I + + SG+Y+      +VAD++N+I  SLD   T S
Sbjct: 533  IYQNNDNLKYDQIYSGYLDFSPEIVLEYVSGIYTTNTATVVVADQVNVITVSLDAFNTLS 592

Query: 621  SNEIDIYNVTLNGLFQYPEYN-SVNNLNENYT-NSTINQYAYSNYPANVSLIAAAYDKDT 678
             +        LNG+ QY + N +   LNE    N+T+N +   NYP N SL A  YD + 
Sbjct: 593  DSSNAKKETLLNGILQYQKSNFTSTRLNETKVGNTTLNLFPVKNYPKNSSLYADIYD-NK 651

Query: 679  LLVGGSINKLQEFQIEKNGQNISLQNTFKDLNSVTGIVPYSDGLIAYGDIMDSSGSYKAI 738
            L++GG  N++    +  + +  S +N       V GI   + GL+ +GDI+ SS +  A+
Sbjct: 652  LVIGGVSNRISIVDLNDDFEVTSSKNQTIQ-GDVHGITKTNQGLLIFGDIL-SSNNQSAV 709

Query: 739  TFTNNKFGTLGNFTDEIQSFSNISLTTSWEILSFNNKYFYNQSNMEDFKNTSTFELSLWS 798
               N  F  + N +  + S  NISL  + + +  +N Y  N S+    +N+S+F LSLW+
Sbjct: 710  FLFNGSFENVFNQSRTVNSALNISLANN-DFIVLDNDYVVNASSNALIRNSSSFSLSLWA 768

Query: 799  AGKNAQNDLIFSGLVSENENVNLTGVVSINANEQIKELNLGNNIYPYSAVFLNDSSTIYA 858
            AG N   D++FSG VS  +  NL G V      +I+ LNL   I PY   +LN+S+T YA
Sbjct: 769  AGNNGDGDVLFSGAVSHMQYGNLNGSVRFLNENEIEPLNLEGGIVPYLGAYLNESATAYA 828

Query: 859  YMEPNTRLNRLIHSNGEQISWSWKNKISSMAFFPNESLLSVGTISDKDVFPSFSILNLTS 918
            Y   +  LN++  SN    SW+W + I+ M +  N++LL+V   S        SI +L +
Sbjct: 829  YEVDS--LNKIYFSNEVYPSWNWSSGITQMLYADNQTLLAVSAGSSTTA--ELSIFDLRN 884

Query: 919  NKVIANETLNKNSQISSLLYFTKNSSVLVGGNFTFSDYQCSGLCLFNYETKNWSTFMNNT 978
              +IANETL  N++I++L+ F KN S+LVGG+F  ++  C+GLCL+NYE+K WSTF+NNT
Sbjct: 885  LTMIANETLGSNARINALVNFEKNCSMLVGGDFQMTEPNCTGLCLYNYESKTWSTFLNNT 944

Query: 979  LEGTVSKLELKNNSNILISGTLSTNKSANIDLALLNLNTYNVSILLQNT--NLTSFEFTG 1036
            + G +++L   N+S ++ISG   T +  +I L   NL    +  LL  +   L SF  T 
Sbjct: 945  IFGEITQLSFTNSSELIISGLFETKEYQSIRLGSFNLTNSTMIPLLSGSEGKLNSFTVTE 1004

Query: 1037 NQIAAWNSSTLFQYNNEAWSQILLPNGTESLKLDSISIFDITNKNSSSILEKRALRDTN- 1095
            + I AWN ++LF Y N+ W+   LP    S+   S    DI     S+ L KR + + N 
Sbjct: 1005 DSIVAWNDTSLFIYRNQEWNITSLPGNASSISSVSAIYTDI----ESNTLNKRGINNVNN 1060

Query: 1096 --IMVATGQFYSKGLGTVQALYYTSDTWIPYFYGNLTNNMDTSNSINIFPNKDISSKIIS 1153
              I++  G F     G +Q+L +    W PYF    TN  +  N I IF N+D+S++  S
Sbjct: 1061 GSILLLNGNFNISQYGYLQSLLFDFQKWTPYFISETTNTSNY-NPI-IFINRDVSTEFNS 1118

Query: 1154 DFVLKNWNFNLSDVGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIIPIIGKQQNKKHK 1213
               L N N  ++                                        K ++KK K
Sbjct: 1119 QSPLANVNITVTSPQSTSSQPPSSSASSES----------------------KSKSKKKK 1156

Query: 1214 IQRGFVVLIGLALSLATVAXXXXXXXXXXXXXRDSRGDYESLKPRTTEHEMFDAVPPEKL 1273
            I RGFVVLIGLAL+L TV+             +D  GDY+ +KPR  E+EM D VPPEKL
Sbjct: 1157 IGRGFVVLIGLALALGTVSVLGIAGVILAYVFKDPEGDYKPIKPRIDENEMLDTVPPEKL 1216

Query: 1274 MPFV 1277
            M FV
Sbjct: 1217 MKFV 1220

>NCAS0B04980 Chr2 complement(912114..915728) [3615 bp, 1204 aa] {ON}
            Anc_8.256 YLR084C
          Length = 1204

 Score =  781 bits (2016), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 509/1293 (39%), Positives = 769/1293 (59%), Gaps = 107/1293 (8%)

Query: 3    ICIRTILGILLLSVAPSSVVANQLNHLKDILEIENIPAPQFNLQDSTNQSLQLLTSNGFD 62
            + I+ +LG LLL   P  + A+QL+ L++ L I +I  P  NL    N S +LL   G D
Sbjct: 1    MLIKILLGALLL--IPQ-IYASQLSSLQENLNITHINIPNLNLTTDDN-SFELL--GGID 54

Query: 63   TLNFVHYNGQQNFTQPII-SSSQNHLIYYSNDTYIRLLDIPYSTRIQHIIPYGQDAFILS 121
            +L+F  Y GQQNFT  I+ +S+ N L YYSN+T+I+L +    +RI+ IIP+G D+FILS
Sbjct: 55   SLSFYRYTGQQNFTSGILPNSNSNGLTYYSNNTFIQLYEPSLDSRIERIIPFGSDSFILS 114

Query: 122  GTGSLNGFELSNQLVYNLTDLSLTPIFENKLVPEVRTIFKDPDTNLVYFGGNFSYLLPDS 181
            G GSL G+ LSNQL++NL+  SL  IF N+ +  V +I  D    +V FGGNF+ L  +S
Sbjct: 115  GKGSLGGYSLSNQLLFNLSSFSLKQIF-NQTLDSVNSILVDG--TVVCFGGNFT-LSTNS 170

Query: 182  NISNGLIIWDSSSNDTISYEFGGFGSNSVINNILKLNSNDLLFSGQFYTLDDPSILHIPY 241
               + + +W+ ++N T    F GFG NS+IN+I KLN +++LF+G+FYTLD+ ++L++  
Sbjct: 171  LNGHSVALWNYTANSTSLLPFVGFGENSLINSITKLNDDNILFAGKFYTLDNSTLLNVV- 229

Query: 242  NITFPNNTSSLLSQQNVSTFELNQRIPLTFGKFSTADTNDYINKNQLICPTSEIEAWASD 301
                 N+T      +N+S   L Q IPL+   +S+  T  + ++   +CP   IEAW  +
Sbjct: 230  -----NDT-----MRNISDINLGQLIPLSAATWSS--TGSFFDEETFVCPDPTIEAWFQN 277

Query: 302  SKAGSLQITLPFSIRPSKIRIFNSPDPDDEVATFRINPGNQNSIMSLAYLDPLDGQLKYC 361
              +G+L   LPF + P+KIRI+NSPDPD+E++ FRI      SIM+L Y+DP+ GQLK+C
Sbjct: 278  GTSGTLNCNLPFDVAPTKIRIYNSPDPDNEISLFRIFSDPSESIMNLTYIDPVLGQLKHC 337

Query: 362  SEFCPLYNRNQLKLFNSNDNLKSHVITLLDNNTTDIKWSTTYQEFAFVNQFDLTTLEFQA 421
              FCPLY +  LK  + N  L S +I LL++NT+DI+WS  +QEFAFVNQ   ++L F A
Sbjct: 338  DAFCPLYTKQVLKSASENVTLSSEMIELLNDNTSDIRWSQDFQEFAFVNQLSASSLRFLA 397

Query: 422  LSSYGSRVGLSGLSLFQSDIAVFANESYNKPSCNDQTAYDNEDLIKAALPRVMGSSYSIL 481
            L+SYG+ VGLS   ++Q   A+FAN S N+PSCN   ++ + D                L
Sbjct: 398  LNSYGTNVGLSSFQIYQDAYAIFANNSLNEPSCNSLESFSSSD----------------L 441

Query: 482  SDNDWYTPLPNSDYLACTYLSSSKLIPTVTFYPNLLYAGNYTVDMITPGCTADNSCDSRG 541
            S+N W   + + +Y+  TY+    ++P VTF+P+L Y+G Y++++ TPGC  DN+C SRG
Sbjct: 442  SNNTWTRGMDDQNYVKTTYIPHQGVLPEVTFHPDLKYSGQYSIELYTPGCQQDNTCSSRG 501

Query: 542  IVNVTMWNQTDSSILQTSLIYQTNENYKFDQIFNGYLDPLVKITMSFYSGVYSNTGNFTI 601
            IVNVT+WN  ++SIL T+LIYQ N+  K+D++++GYL+   KIT++++SG+YS T   T+
Sbjct: 502  IVNVTVWNTNNNSILSTTLIYQNNDQLKYDELYSGYLNYSPKITVTYHSGIYSGTTAGTV 561

Query: 602  VADRINLIINSLDFVTTTSSNEIDIYNVT----LNGLFQYPEYN----SVNNLNENYTNS 653
            V DR+N++INSLD +        +I+N T    LNGLFQY   N    S ++      N+
Sbjct: 562  VVDRLNIMINSLDILN-------EIHNSTNSLELNGLFQYQLSNFSTSSKDSSIARVANT 614

Query: 654  TINQYAYSNYPANVSLIAAAYDKDTLLVGGSINKLQEFQIEKNGQNISLQNTFKD--LNS 711
            +INQ   + + +NVSL A+ Y+ DTLLVG   + L  +++ K   ++++Q++ +      
Sbjct: 615  SINQLTLTGFSSNVSLSASLYN-DTLLVGAGDDGLSIYELNK---DLAIQSSSQQGIEGK 670

Query: 712  VTGIVPYSDGLIAYGDIMDSSGSYKAITFTNNKFGTLGNFTDEIQSFSNISLTTSWEILS 771
            +TG+  YS+G++ YGD   S  S   ++F N  F ++GN T  I +F+NI++  S E+L 
Sbjct: 671  ITGLKSYSNGVLVYGDFNSSKESSNVLSF-NGSFDSIGNITSPITNFANITIDDS-ELLV 728

Query: 772  FNNKYFYNQSNMEDFKNTSTFELSLWSAGKNAQNDLIFSGLVSENENVNLTGVVSINANE 831
            F+N   +N S+     NTS+F LSLWS+G N+  D +FSG +S+ +  NL+G VSI  N 
Sbjct: 729  FDNNLIFNVSSSSQISNTSSFSLSLWSSGSNSNGDTLFSGALSQVQFTNLSGSVSIANNL 788

Query: 832  QIKEL-NLGNNIYPYSAVFLNDSSTIYAYMEPNTRLNRLIHSNGEQISWSWKNKISSMAF 890
                L ++G+   PY+A+FLNDS T Y  ++ ++  + +I S+G +  W W   + SM +
Sbjct: 789  SATSLRSIGS---PYAAIFLNDSVTGYV-LKNDSSTSEMIFSDGSKAPWRWTGYVDSMLY 844

Query: 891  FPNESLLSVGTISDKDVFPSFSILNLTSNKVIANETLNKNSQISSLLYFTKNSSVLVGGN 950
              N+S+L+VG  S   V    SILNL S KV+ANETLN+NS + ++++F +NSS+LVGGN
Sbjct: 845  LTNQSMLAVG--SSSSVNGELSILNLDSFKVLANETLNQNSSVKTMVHFERNSSILVGGN 902

Query: 951  FTFSDYQCSGLCLFNYETKNWSTFMNNTLEGTVSKLELKNNSNILISGTLSTNKSANIDL 1010
            F+ S+ +C GLCL+NY    W TF+N T+ GT++KL++ N+S ++I+G   T   ++++L
Sbjct: 903  FSISNTECFGLCLYNYTGNQWYTFLNGTINGTITKLQIFNDSQLIIAGVFDTKSQSSVNL 962

Query: 1011 ALLNLNTYNVSILLQ---NTNLTSFEFTGNQIAAWNSSTLFQYNNEAWSQILLPNGTESL 1067
            AL+NL T N  +L++      +  F    + I AWN ++LF+Y + +W  I + N   S 
Sbjct: 963  ALMNL-TDNKLVLIRWGFKEPVKDFITIDDNIFAWNETSLFEYTSNSWVDIPISNSNSST 1021

Query: 1068 KLDSISIFDITNKNSSSILEKRALRDT--NIMVATGQFYSKGLGTVQALYYTSDTWIPYF 1125
             +DSI     T+ N    L+KR   +T  N+++  GQ Y    G +QA+ Y  + WIPY 
Sbjct: 1022 TIDSIGWTTTTDNN----LKKRDNSETSNNVLIVKGQIYDNVYGHIQAMIYNFEEWIPYL 1077

Query: 1126 YGNLTNNMDTSNS-INIFPNKDISSKIISDFVLKNWNFNLSDVGXXXXXXXXXXXXXXXX 1184
              ++ + + ++N    +F ++D+S    S   L+  N   S                   
Sbjct: 1078 --SINSLVSSANQPAELFIDRDVSKLFDSQLALQVSNTTASITASSSTPTPTSSPKK--- 1132

Query: 1185 XXXXXXXXXXXXXXXIIPIIGKQQNKKHKIQRGFVVLIGLALSLATVAXXXXXXXXXXXX 1244
                                 K    K KI RGFVVLIGLAL+L T+             
Sbjct: 1133 ---------------------KLHQSKKKIDRGFVVLIGLALALGTMTVLGIVGVILAYA 1171

Query: 1245 XRDSRGDYESLKPRTTEHEMFDAVPPEKLMPFV 1277
             RD  GDY+ + PR  E EM   VPPEKLM F+
Sbjct: 1172 FRDDDGDYDVITPRVNEDEMLKTVPPEKLMEFI 1204

>ZYRO0C01804g Chr3 (140029..143658) [3630 bp, 1209 aa] {ON} similar to
            uniprot|Q12465 Saccharomyces cerevisiae YLR084C RAX2
            N-glycosylated protein involved in the maintenance of bud
            site selection during bipolar budding localization
            requires Rax1p
          Length = 1209

 Score =  775 bits (2001), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 467/1265 (36%), Positives = 719/1265 (56%), Gaps = 83/1265 (6%)

Query: 23   ANQLNHLKDILEIENIPAPQFNLQDSTNQSLQLLTSNGFDTLNFVHYNGQQNFTQPIISS 82
             +QL+HL+ +L   NI  P+ +L  S NQ+L+LL    F  L F  Y GQ+NFT P+ SS
Sbjct: 18   GSQLSHLQQLLNASNIQVPKLDLTSSRNQALELLGD--FQDLTFYKYTGQENFTSPLNSS 75

Query: 83   SQNH-LIYYSNDTYIRLLDIPYSTRIQHIIPYGQDAFILSGTGSLNGFELSNQLVYNLTD 141
            + +H LIYYSNDT+++L +    T I+ I+P G+D+FILSG+G ++G+ L  QL YNLTD
Sbjct: 76   TDSHGLIYYSNDTFLQLANGSNDTDIKQIVPLGEDSFILSGSGHIDGYNLQRQLHYNLTD 135

Query: 142  LSLTPIFENKLVPEVRTIFKDPDTNLVYFGGNFSYLLPDSNISNGLIIWDSSSNDTISYE 201
            LS  PIF+  L  EV +I  D    LVYFGGNF++    S   + +++W+S  N T    
Sbjct: 136  LSFKPIFQEGLT-EVNSILVDQP--LVYFGGNFTFS-NGSQTGHSVVLWNSEKNSTSLLP 191

Query: 202  FGGFGSNSVINNILKLNSNDLLFSGQFYTLDDPSIL--HIPYNITFPNNTSSLLSQQNVS 259
            F GFG NS +N+I++L+ +++LF+G FY LDD  +L  HI         +++  S+ N +
Sbjct: 192  FIGFGQNSTVNSIIRLDRDNILFAGNFYELDDVKLLENHIL-------GSNNSSSKSNWT 244

Query: 260  TFELNQRIPLTFGKFSTADTNDYINKNQLICPTSEIEAWASDSKAGSLQITLPFSIRPSK 319
              EL   IPL    ++++ +    + +  ICP  E E+W     +GSL  +LP    P K
Sbjct: 245  DVELGLAIPLQNANWTSSSSQ--FDADDFICPDPERESWLQSGTSGSLACSLPQETTPYK 302

Query: 320  IRIFNSPDPDDEVATFRINPGNQNSIMSLAYLDPLDGQLKYCSEFCPLYNRNQLKLFNSN 379
            IRI+NSP  D+EV+ FRI       I++L+Y+DP +G+L+YC  FCPLYNR +L+  +SN
Sbjct: 303  IRIYNSPVEDNEVSLFRILAEPTKGILNLSYVDPEEGELRYCDAFCPLYNRQRLEEASSN 362

Query: 380  DNLKSHVITLLDNNTTDIKWSTTYQEFAFVNQFDLTTLEFQALSSYGSRVGLSGLSLFQS 439
             +   ++ T  DNNTTDIKW   +QEFAFVN   ++++EF ALSSYGS VGLS    FQS
Sbjct: 363  SSSVENMTTFSDNNTTDIKWGRDFQEFAFVNNVPISSVEFVALSSYGSNVGLSSWQFFQS 422

Query: 440  DIAVFANESYNKPSCNDQTAYDNEDLIKAALPRVMGSSYSILSDNDWYTPLPNSDYLACT 499
              +++AN S N+P+C    +Y N                + +S+NDW   L    YL+ +
Sbjct: 423  RASIYANNSLNQPACGKMQSYSN----------------ATISNNDWRQGLNGQTYLSTS 466

Query: 500  YLSSSKLIPTVTFYPNLLYAGNYTVDMITPGCTADNSCDSRGIVNVTMWNQTDSSILQTS 559
            Y+     IP VTF+P + Y GNY++ + TPGC  D +C+ R IVNVT+W+   +  L + 
Sbjct: 467  YVEDQGNIPRVTFHPQIQYPGNYSIKLYTPGCLGDGTCNQRAIVNVTLWDGDSNEPLSSE 526

Query: 560  LIYQTNENYKFDQIFNGYLDPLVKITMSFYSGVYSNTGNFTIVADRINLIINSLDFVTTT 619
            +IY+ N   K+D++++G+L    K+T+ ++S +Y N     +VAD I+L   S D     
Sbjct: 527  VIYENNNELKYDELWDGHLKSSPKVTLEYHSPIYPNNPTSVVVADYISLEAKSFDHF--- 583

Query: 620  SSNEIDIYNVTLNGLFQYPEYNSVNNL-NENYTNSTINQYAYSNYPANVSLIAAAYDKDT 678
               E    ++TLNG+FQY   N   N+  E+  N++++ +  S +  N SL A+ Y+ DT
Sbjct: 584  ---EKHKKDITLNGIFQYQISNFTKNITKESIGNTSLDVFPLSYFSNNSSLFASLYENDT 640

Query: 679  LLVGGSINKLQEFQIEKNGQNISLQNTFKDLNSVTGIVPYSDGLIAYGDIMDSSGSYKAI 738
            LL+  S +K  E +++KN  ++    +F   + V GI  YSDGLI +GD   S     A+
Sbjct: 641  LLLADSKSKAAEIKLDKN-WSVDSSKSFNLASQVRGIGSYSDGLILFGDYNSSQRQPLAL 699

Query: 739  TFTNNKFGTLGNFTDEIQSFSNISLTTSWEILSFNNKYFYNQSNMEDFKNTSTFELSLWS 798
            +F N  F +       ++ F+NI L  + E+L F+N++FYN S+     NT+ F LS+WS
Sbjct: 700  SF-NGSFNSYDKINRSVERFTNIDLKGT-ELLVFDNEFFYNVSSQSYVSNTTRFSLSVWS 757

Query: 799  AGKNAQNDLIFSGLVSENENVNLTGVVSINANEQIKELNLGNNIYPYSAVFLNDSSTIYA 858
            AG+N   DLIFSG VS+N+  NL G VS+  N      N+ +NI PY   +LND+ T YA
Sbjct: 758  AGQNTNGDLIFSGAVSDNDYENLQGPVSLFQNGSAVSSNIKDNINPYMGAYLNDTLTAYA 817

Query: 859  YMEPNTRLNRLIHSNGEQISWSWKNKISSMAFFPNESLLSVGTISDKDVFPSFSILNLTS 918
            Y + +   +R++ SNG++  W W N I +M +   ++LL++GT S   +    S+LNLT+
Sbjct: 818  YKDGSD--SRIVFSNGDEGPWRWTNSIETMIYRNRDALLALGTSSSPSLP-QLSVLNLTT 874

Query: 919  NKVIANETLNKNSQISSLLYFTKNSSVLVGGNFTFSDYQCSGLCLFNYETKNWSTFMNNT 978
            ++V+ANETL+K ++++S++ F KNS++L+GGNF+FSD  C+GLCL+NY+ K WSTF N++
Sbjct: 875  SEVLANETLDKGAEVNSMILFGKNSTLLIGGNFSFSDAHCNGLCLYNYKNKRWSTFANDS 934

Query: 979  LEGTVSKLELKNNSNILISGTLSTNKSANIDLALLNLNTYNVSILLQNTN--LTSFEFTG 1036
            + G V++++L+N+S +LI+G+L  N +++++L  +N+    +  LL+     L SF  + 
Sbjct: 935  ITGQVTQVQLRNSSELLIAGSLRVNGTSDVNLVSVNITGQGMKTLLRGWEGPLRSFVVSE 994

Query: 1037 NQIAAWNSSTLFQYNNEAWSQILLPNGTESLKLDSISIFDITNKNSSSILEKRALRDTNI 1096
            +++  WN ++L  Y+N +W  I   N T   KL  I    + +      LEKRA   +N 
Sbjct: 995  DRLVVWNDTSLMAYDNTSWRHISTSNSTSFTKLQDIHQVSLEHS-----LEKRANSSSNS 1049

Query: 1097 ----MVATGQFYSKGLGTVQALYYTSDTWIPYFYGNLTNNMDTSNSINIFPNKDISSKII 1152
                ++  G   ++G  + QA  Y   +W P F  N + + ++++  NIF N+D+S   I
Sbjct: 1050 NLDGLLVYGNDKTQG-DSYQASIYDYYSWTPLFIAN-SKSENSNSGPNIFMNQDVSDFFI 1107

Query: 1153 SDFVLKNWNFNLSDVGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIIPIIGKQQNKKH 1212
            S+ +L N                                              K+    H
Sbjct: 1108 SEQMLPN-----------------------PTNHTSSRSSSSSSSAVTSNSGDKKHRASH 1144

Query: 1213 KIQRGFVVLIGLALSLATVAXXXXXXXXXXXXXRDSRGDYESLKPRTTEHEMFDAVPPEK 1272
            K+ RG+VVLIGLAL++ TV               +  G YE L P     +  +  PP K
Sbjct: 1145 KVDRGYVVLIGLALAIGTVVVIGVFGILIAYMFGEDIGGYEFLSPPAEGTKAAETAPPAK 1204

Query: 1273 LMPFV 1277
               F+
Sbjct: 1205 SSKFL 1209

>Skud_12.152 Chr12 complement(279947..283609) [3663 bp, 1220 aa] {ON}
            YLR084C (REAL)
          Length = 1220

 Score =  766 bits (1979), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 479/1265 (37%), Positives = 714/1265 (56%), Gaps = 74/1265 (5%)

Query: 23   ANQLNHLKDILEIENIPAPQFNLQDSTNQSLQLLTSNGFDTLNFVHYNGQQNFTQPIISS 82
            A+QL ++K +L+IE+   P  N+    + ++Q+L   G D L+   Y GQQNFT+ I   
Sbjct: 20   ASQLQNIKSLLDIEDNVLPNLNISQDNSNAVQIL--GGVDALSLYEYTGQQNFTKEISPG 77

Query: 83   SQNH-LIYYSNDTYIRLLDIPYSTRIQHIIPYGQDAFILSGTGSLNGFELSNQLVYNLTD 141
            + +  L+YYSN+TYI++ D    TRI  I P+G D+FILSG+G++N   + NQ++YNL+ 
Sbjct: 78   TNSRGLVYYSNNTYIQVEDASDDTRIDKITPFGADSFILSGSGTINNMPIGNQILYNLST 137

Query: 142  LSLTPIFENKLVPEVRTIFKDPDTNLVYFGGNFSYLLPDSNISNGLIIWDSSSNDTISYE 201
            LS+ PIF+  L   V ++  +  +  VYFGGNFSY    S   +  +IWDS SN T    
Sbjct: 138  LSMAPIFDQPL-GSVESVLINGTS--VYFGGNFSYN-NGSMTGHSALIWDSISNKTQLLP 193

Query: 202  FGGFGSNSVINNILKLNSNDLLFSGQFYTLDDPSILHIPYNITFPNNTSSLLSQQNVSTF 261
            FGGFG NS +N+I+KLN +++LF+G+FYTLDD S L    +    NNT++  S  N +  
Sbjct: 194  FGGFGENSNVNSIIKLNDDNILFAGKFYTLDDSSALITAGS----NNTTNSTSLLNATKL 249

Query: 262  ELNQRIPLTFGKFSTADTNDYINKNQLICPTSEIEAWASDSKAGSLQITLPFSIRPSKIR 321
            EL QRIPL +  +    +  +   N L+CP +  +AW   + +G+L   LP+ + P+K+R
Sbjct: 250  ELGQRIPLRYATWDFQGSTTF-ESNSLVCPNANEDAWVYPATSGTLVCKLPYEVSPTKVR 308

Query: 322  IFNSPDPDDEVATFRINPGNQNSIMSLAYLDPLDGQLKYCSEFCPLYNRNQLKLFNSNDN 381
            ++NS D D E++ F+I     NSIM+L YLDPL G+LK C EFCPLY+R  L   + N +
Sbjct: 309  LYNSQDSDGEISVFQILTNPSNSIMNLTYLDPLSGKLKNCDEFCPLYSRATLLSASQNVS 368

Query: 382  LKSHVITLLDNNTTDIKWSTTYQEFAFVNQFDLTTLEFQALSSYGSRVGLSGLSLFQSDI 441
                +I+ LDNN TD+KWS+ +Q+FAF N+  +T L+F A++SYG  VGLSGL L+Q   
Sbjct: 369  SPMDMISFLDNNNTDVKWSSDFQDFAFANELPVTLLKFTAINSYGKSVGLSGLELYQDTF 428

Query: 442  AVFANESYNKPSCNDQTAYDNEDLIKAALPRVMGSSYSILSDNDWYTPLPNSDYLACTYL 501
            + +AN S N+  C   +A  N+                  S N WY  L    Y+A  Y+
Sbjct: 429  STYANNSLNEYGC---SALANDSSSSTL------------SSNSWYNGLGGESYIATEYV 473

Query: 502  -SSSKLIPTVTFYPNLLYAGNYTVDMITPGCTADNSCDSRGIVNVTMWNQTDSSILQTSL 560
             +  +  P V FYPN+++ G+Y ++  TPGC  D++C SRGIVNVTMWN  + ++++T  
Sbjct: 474  PNQDEPTPRVNFYPNIVHPGHYIINTYTPGCVQDHTCSSRGIVNVTMWNPQNKTMMKTYT 533

Query: 561  IYQTNENYKFDQIFNGYLDPLVKITMSFYSGVYSNTGNFTIVADRINLIINSLDFVTTTS 620
            IYQ N+N K+DQI++GYLD   +I + + SG++++     +VAD++N+I   LD  +T S
Sbjct: 534  IYQNNDNLKYDQIYSGYLDFSPEIILEYVSGIHTSNTATVVVADQVNVITVLLDAFSTLS 593

Query: 621  SNEIDIYNVTLNGLFQYPEYN--SVNNLNENYTNSTINQYAYSNYPANVSLIAAAYDKDT 678
             +      + LNG+ QY + N  S  +      N+T+N +A  NYP N SL A   + D 
Sbjct: 594  ESANTKEYIPLNGVLQYQKSNFTSTTSNETKIGNTTLNVFAVDNYPNNSSLFADT-NGDR 652

Query: 679  LLVGGSINKLQEFQIEKNGQNISLQNTFKDLNSVTGIVPYSDGLIAYGDIMDSSGSYKAI 738
            L++GG+ N +    +  N + + L         V G+   S GL+ +GD++ S+     +
Sbjct: 653  LILGGTNNHISIIGLNDNLE-VVLSEKQIIQGDVHGMTQTSQGLLIFGDLLSSNNQSSVL 711

Query: 739  TFTNNKFGTLGNFTDEIQSFSNISLTTSWEILSFNNKYFYNQSNMEDFKNTSTFELSLWS 798
             F N  F  + N++  + S  NISL  + +++ F+N Y  N S+     N+++F LSLWS
Sbjct: 712  LF-NGSFENVFNYSRTVNSAINISLANN-DLIVFDNDYIVNTSSSAQILNSTSFSLSLWS 769

Query: 799  AGKNAQNDLIFSGLVSENENVNLTGVVSINANEQIKELNLGNNIYPYSAVFLNDSSTIYA 858
            AG N  +D++FSG VS  +   L G     + ++++ LNL N + PY A +LN+S+T YA
Sbjct: 770  AGSNGNDDVLFSGAVSRMQFGGLNGSARFLSEDKVQALNLDNAVVPYLAAYLNESTTAYA 829

Query: 859  YMEPNTRLNRLIHSNGEQISWSWKNKISSMAFFPNESLLSVGTISDKDVFPSFSILNLTS 918
            Y E N  LN++  SN    SW+W   I+ M +  N+SLL+VG  S+       SI NL +
Sbjct: 830  Y-ETNL-LNKIYFSNNVDPSWNWSTSITRMLYANNQSLLTVG--SESSTTAELSIFNLKN 885

Query: 919  NKVIANETLNKNSQISSLLYFTKNSSVLVGGNFTFSDYQCSGLCLFNYETKNWSTFMNNT 978
              +IANET+  N++I++L+ F KNSS+LVGGNF  S   CSGLCL+NYE+K+WSTF NNT
Sbjct: 886  FTMIANETMGSNAKINALVNFEKNSSLLVGGNFQMSKPNCSGLCLYNYESKSWSTFFNNT 945

Query: 979  LEGTVSKLELKNNSNILISGTLSTNKSANIDLALLNLNTYNVSILLQNT--NLTSFEFTG 1036
              G +++L     S ++ISG   T +  ++ LA  NL    +  LL      + SF  T 
Sbjct: 946  FFGEITQLSFSAASQLVISGLFDTEEYQSVRLASFNLTNSTMIPLLTGAEGKINSFVVTE 1005

Query: 1037 NQIAAWNSSTLFQYNNEAWSQILLPNGTESLKLDSISIFDITNKNSSSILEKRA---LRD 1093
              I AWN ++L  Y ++ W+   +P    S+     S+  I        L +RA     +
Sbjct: 1006 ESIVAWNDTSLLIYRDQEWNITSVPGNDSSIG----SVSTINTNAGPGTLNRRATNNAEN 1061

Query: 1094 TNIMVATGQFYSKGLGTVQALYYTSDTWIPYFYGNLTNNMDTSN-SINIFPNKDISSKII 1152
              I++ +G F     G +Q L +  +TW PYF    +N   TSN +  IF N+D+S++  
Sbjct: 1062 GTILLLSGNFSIPDYGNLQGLLFDFETWSPYFVSESSN---TSNRNPTIFINRDVSTEFN 1118

Query: 1153 SDFVLKNWNFNLSDVGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIIPIIGKQQNKKH 1212
            S   L   N N+++ G                                     K ++KK 
Sbjct: 1119 SQIPLS--NLNVTETGPQSASSQFPSSSASSEL--------------------KPKSKK- 1155

Query: 1213 KIQRGFVVLIGLALSLATVAXXXXXXXXXXXXXRDSRGDYESLKPRTTEHEMFDAVPPEK 1272
            +I RGFVVLIGLAL+L TV+             +D  GDY+ +KPR  E+EM D VPPEK
Sbjct: 1156 RIDRGFVVLIGLALALGTVSVLGIAGVILAYVFKDPEGDYKPIKPRIDENEMLDTVPPEK 1215

Query: 1273 LMPFV 1277
            LM FV
Sbjct: 1216 LMKFV 1220

>NDAI0B02380 Chr2 complement(595444..599103) [3660 bp, 1219 aa] {ON}
            Anc_8.256 YLR084C
          Length = 1219

 Score =  749 bits (1934), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 488/1271 (38%), Positives = 725/1271 (57%), Gaps = 85/1271 (6%)

Query: 23   ANQLNHLKDILEIENIPAPQFNLQDSTNQSLQLLTSNGFDTLNFVHYNGQQNFTQPII-S 81
            A+QL+++K+IL + N+  P  NL  S + + QLL     D L+F  Y GQQNFT  II  
Sbjct: 18   ASQLSNIKNILNVTNVNIPTLNLTASNDDTFQLL--GDIDGLSFYRYKGQQNFTTGIIPG 75

Query: 82   SSQNHLIYYSNDTYIRLLDIPYSTRIQHIIPYGQDAFILSGTGSLNGFELSNQLVYNLTD 141
            S+ N LIYYSN+T I+L +    T I  I P+G D+FILSGTGSL+G+ L+NQL+YNLT 
Sbjct: 76   SNSNGLIYYSNNTLIQLEEPSNDTYIAKITPFGSDSFILSGTGSLSGYSLTNQLLYNLTT 135

Query: 142  LSLTPIFENKLVPEVRTIFKDPDTNLVYFGGNFSYLLPDSNISNGLIIWDSSSNDTISYE 201
            LS+ PIF N  + EV+TI  D   +LVYFGGNF+ L   SNI + LI+WDS+S+ T    
Sbjct: 136  LSIEPIF-NTSIEEVKTILIDD--SLVYFGGNFTVLNGTSNI-HSLIMWDSTSSSTEFLN 191

Query: 202  FGGFGSNSVINNILKLNSNDLLFSGQFYTLDDPSILHIPYNITFPNNTSSLLSQQNVSTF 261
            FGGFG NS+IN+I+KLN +++LF+G+FYTLD+P  L         N TSS  +  N +T 
Sbjct: 192  FGGFGENSIINSIVKLNDDNILFAGEFYTLDEPDFL-------IQNTTSSQNNIFNSTTV 244

Query: 262  ELNQRIPLTFGKFSTADTNDYINKNQLICPTSEIEAWASDSKAGSLQITLPFSIRPSKIR 321
            ++ Q +PL+   + T ++    + +  +CP +  E+W      GSL   LPF + P+KIR
Sbjct: 245  DIGQLVPLSASTWDTGEST--FDSDTFVCPDTTEESWIQSGTTGSLTCKLPFEVAPTKIR 302

Query: 322  IFNSPDPDDEVATFRINPGNQNSIMSLAYLDPLDGQLKYCSEFCPLYNRNQLKLFNSNDN 381
            I+NSP+ D++V+ FRI       IM+L Y+DP+  +LK+C  FCPLY++  L    +N  
Sbjct: 303  IYNSPNEDNQVSLFRILTNEAQGIMNLTYIDPISHELKHCDAFCPLYSKAILSQAYANTT 362

Query: 382  LKSHVITLLDNNTTDIKWSTTYQEFAFVNQFDLTTLEFQALSSYGSRVGLSGLSLFQSDI 441
              S  I LL +NTTDIKW+  +QEFAF+NQ  +++++F AL SYG+ V LS   L+Q+  
Sbjct: 363  SPSDTIHLLADNTTDIKWTQEFQEFAFINQISVSSVQFVALDSYGNNVALSSFQLYQNAY 422

Query: 442  AVFANESYNKPSCNDQTAYDNEDLIKAALPRVMGSSYSILSDNDWYTPLPNSDYLACTYL 501
            AVFAN++ N+P+CN   +                SS S LS NDW   L    Y++ TY 
Sbjct: 423  AVFANDTLNEPNCNSIES----------------SSSSSLSANDWEMGLTGQTYISTTYT 466

Query: 502  SSSKLIPTVTFYPNLLYAGNYTVDMITPGCTADNSCDSRGIVNVTMWNQTDSSILQTSLI 561
             +   +P V+F P + Y G Y++++ TPGCT D++C SR IVNVT+W+   +SIL T LI
Sbjct: 467  PNQDPVPYVSFSPQIKYPGQYSINIYTPGCTQDDTCSSRAIVNVTVWDSDGTSILATELI 526

Query: 562  YQTNENYKFDQIFNGYLDPLVKITMSFYSGVYSNTGNFTIVADRINLIINSLDF--VTTT 619
            YQ N+  K+D++++GYL    ++T+ + SG+Y++    T+VADR+N++I+SL+   +T+ 
Sbjct: 527  YQNNKELKYDELYSGYLSSSPRVTIEYVSGLYASNTVATVVADRLNVLIDSLEVPGLTSN 586

Query: 620  SSNEIDIYNVTLNGLFQYPEYN----SVNNLNENYTNSTINQYAYSNYPANVSLIAAAYD 675
             +N  +I N  LNGL QY   N    S    +   TN+++NQ +   +  N S+ A  YD
Sbjct: 587  GTNNTEIMN--LNGLLQYQISNFSTSSSETTDVKITNTSLNQLSLEQFSKNTSMYADLYD 644

Query: 676  KDTLLVGGSINKLQEFQIEKNGQNISLQNTFKDLNSVTGIVPYSDGLIAYGDIMDSSGSY 735
             +TLL+G S   ++  ++ +N  +I   N      +  G   YS G++AYG+   SS   
Sbjct: 645  DNTLLLGNSNGGIKVVKLNEN-MDIESSNEASLTGNTAGFSSYSGGILAYGEYNLSSKIT 703

Query: 736  KAITFTNNKFGTLGNFTD--EIQSFSNISLTTSWEILSFNNKYFYNQSNMEDFKNTSTFE 793
              + + N  F  + NF     I +  N+++  + E+L  +N+  YN S+     N+S  +
Sbjct: 704  YLVNY-NGTFNEIPNFNKNSSITNVVNLTIHDT-ELLVIDNQAIYNVSSSSTITNSSALQ 761

Query: 794  LSLWSAGKNAQNDLIFSGLVSENENVNLTGVVSINANEQIKELNLGNNIYP----YSAVF 849
            LSLWS+G N   D +FSG ++  +  +L G ++I  N  +   N+ NN+      Y+ +F
Sbjct: 762  LSLWSSGSNLNRDTVFSGAIALLDYTDLNGSIAIGNNFTVT--NITNNVSSTNSLYTGLF 819

Query: 850  LNDSSTIYAYMEPNTRLNRLIHSNGEQISWSWKNKISSMAFFPNESLLSVGTISDKDVFP 909
            LNDS +IYA        + L+ SNG    WS+   I+ M +  ++++L+V + SD +   
Sbjct: 820  LNDSLSIYA--SKTDSYSELLFSNGYSAPWSFFEGINYMVYSSHQTMLAVAS-SDFNKNS 876

Query: 910  SFSILNLTSNKVIANETLNKNSQISSLLYFTKNSSVLVGGNFTFSDYQCSGLCLFNYETK 969
              SILNLT+ + IANETLN NS+I+ L+ F  NS+++VGGNFT     CSGLCL+NY++ 
Sbjct: 877  ELSILNLTTFETIANETLNVNSKINGLINFEHNSTLIVGGNFTILQSNCSGLCLYNYDSN 936

Query: 970  NWSTFMNNTLEGTVSKLELKNNSNILISGTLSTNKSANIDLALLNLNTYNV-SILLQNTN 1028
             W TF N+++ GT++++EL N + +L+SG  +    ++++LA+++L+TY V SI + + N
Sbjct: 937  EWLTFANHSINGTIAQMELINGTQLLLSGLFNAQNISSVNLAIMDLSTYAVSSIKMGDAN 996

Query: 1029 -LTSFEFTGNQIAAWNSSTLFQYNNEAWSQILLPNGTESLKLDSISIFDITNKNSSSILE 1087
             L SF   G++I  WN   L  Y N AWS I      +S    S +I  I        L+
Sbjct: 997  ILQSFATIGDKIITWNGIMLESYENGAWSTI------QSNFNSSTTIRSIEPIGFGPTLQ 1050

Query: 1088 KR-ALRDTNIMVATGQFYSKGLGTVQALYYTSDTWIPYFYGNLTNNMDTSNSINIFPNKD 1146
            KR      +  +  G  Y    GT+QA+ Y    W PY+  + TN+        IF N+D
Sbjct: 1051 KRDGTGSADGFIINGNIYDTEYGTIQAMIYNFKEWRPYYIISSTNSQIAG---QIFMNRD 1107

Query: 1147 ISSKIISDFVLKNWNFNLSDVGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIIPIIGK 1206
             S+   S  VL+N N                                        P   K
Sbjct: 1108 DSALYNSQSVLQNPNNATVTTPSSTSSGTPSATHSSQ------------------PHHQK 1149

Query: 1207 QQNKKHKIQRGFVVLIGLALSLATVAXXXXXXXXXXXXXRDSRGDYESLKPRTTEHEMFD 1266
            Q  +K KI RGFVVLIGLAL+L TV+             +D  G +++L PRT E EM +
Sbjct: 1150 QVGRK-KIDRGFVVLIGLALALGTVSLLGIIGLVLAYIFKDGDGSHDALNPRTNEDEMLE 1208

Query: 1267 AVPPEKLMPFV 1277
             VPPEKLM F+
Sbjct: 1209 TVPPEKLMKFL 1219

>Kpol_392.10 s392 (27006..30686) [3681 bp, 1226 aa] {ON}
            (27006..30686) [3681 nt, 1227 aa]
          Length = 1226

 Score =  747 bits (1929), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 491/1280 (38%), Positives = 715/1280 (55%), Gaps = 62/1280 (4%)

Query: 5    IRTILGILLLSVAPSSVVANQLNHLKDILEIENIPAPQFNLQDSTNQSLQLLTSNGFDTL 64
            + TI+ ++ L +   S  A+QL ++KD L I  +  PQ N  + TN  +Q+L++   + L
Sbjct: 2    LATIVRLISLGIIGVSQ-ASQLTNVKDSLGINTVNIPQINFGN-TNNEIQILSN--IEGL 57

Query: 65   NFVHYNGQQNFTQPIISSSQNH-LIYYSNDTYIRLLDIPYSTRIQHIIPYGQDAFILSGT 123
             F  Y GQQNFT  I ++S  H LIYYSNDT I+LL+   +T+I  I+P  +DAFILSG+
Sbjct: 58   TFYQYQGQQNFTGSIDTNSNTHGLIYYSNDTLIKLLEGSDNTKIDQIVPLDEDAFILSGS 117

Query: 124  GSLNGFELSNQLVYNLTDLSLTPIFENKLVPEVRTIFKDPDTNLVYFGGNFSYLLPDSNI 183
            G+L GF+L NQL+YNL+DLS+ P+F N+L   +++I  D D  +VYFGGNFSY   ++  
Sbjct: 118  GTLGGFQLENQLLYNLSDLSIIPLFNNQL-QNIKSILVDKD--IVYFGGNFSYT-SNNKT 173

Query: 184  SNGLIIWDSSSNDTISYEFGGFGSNSVINNILKLNSNDLLFSGQFYTLDDPSILHIPYNI 243
            +N +I W+  + +     F GFG NS +N+ILKL+ ++LLF G F TLDD S+L    NI
Sbjct: 174  ANSIISWNKVTKNVDMLPFIGFGKNSTVNSILKLDEDNLLFFGDFSTLDDKSLL--VSNI 231

Query: 244  TFPNNTSSLLSQQNVSTFELNQRIPLTFGKFSTADTNDYINKNQLICPTSEIEAWASDSK 303
            T     +S  S    +  EL Q+I L +  +  A   D  +  Q ICP  + EAW+S   
Sbjct: 232  TTYTQQNSTSSSSTETNLELEQQISLKYASW--ASLGDLKSSTQFICPNGQNEAWSSAGT 289

Query: 304  AGSLQITLPFSIRPSKIRIFNSPDPDDEVATFRINPGNQNSIMSLAYLDPLDGQLKYCSE 363
             G +   L F    SKIRIFNSP   D++A+FRI     N IM+L YLDPL  ++KYC  
Sbjct: 290  TGEITCNLAFEASLSKIRIFNSPYEQDQIASFRIVTAPSNGIMNLTYLDPLTSEVKYCDA 349

Query: 364  FCPLYNRNQLKLFNSNDNLKSHVITLLDNNTTDIKWSTTYQEFAFVNQFDLTTLEFQALS 423
            FCPLY+ N L+  + N    +     ++ N T+I WST YQEFAFVNQ  +T L+  AL+
Sbjct: 350  FCPLYSSNALQASSENATTSASTSAFINGNKTNIGWSTDYQEFAFVNQVPVTALQVIALT 409

Query: 424  SYGSRVGLSGLSLFQSDIAVFANESYNKPSCNDQTAYDNEDLIKAALPRVMGSSYSILSD 483
            SYG  VGLSG  L+Q+  ++FAN S N+P+C+                 V+ SSY  LS+
Sbjct: 410  SYGDNVGLSGFQLYQNSYSIFANNSLNEPACDSPNT-------------VIPSSY--LSN 454

Query: 484  NDWYTPLPNSDYLACTYLSSSKLIPTVTFYPNLLYAGNYTVDMITPGCTADNSCDSRGIV 543
            N WY  L +  Y+A  Y       P V FYP++   GNYTV++ TPGCT D +C  RGIV
Sbjct: 455  NIWYQGLNSQSYIATKYTPGDDPSPLVNFYPSINRIGNYTVNIYTPGCTGDGTCSFRGIV 514

Query: 544  NVTMWNQTDSSILQTSLIYQTNENYKFDQIFNGYLDPLVKITMSFYSGVYSNTGNFTIVA 603
            NVT+W+   + ++ T+LIYQ N   K+DQ+F G+LD   K+T+ +YSG+        +VA
Sbjct: 515  NVTLWDTATNDLISTTLIYQNNNEMKYDQLFEGFLDYAPKVTLEYYSGINDENSPVVVVA 574

Query: 604  DRINLI-IN-SLDFVTTTSSNEIDIYNVTLNGLFQYP---EYNSVNNLNENYTNSTINQY 658
            D ++L+ IN  LD      ++  +   V LNG+FQY      +S NN      N+++N +
Sbjct: 575  DNVDLVPINIELDETIGNVTSSTEELKVPLNGMFQYQLSNFTSSNNNSTLKVDNTSLNLF 634

Query: 659  AYSNYPANVSLIAAAYDKDTLLVGGSINKLQEFQIEKNGQNISLQNTFKDLNSVTGIVPY 718
              S + ++VSL    Y+ +TLL+GGSI  +    +  N  NI      +    VTG   Y
Sbjct: 635  PVSRFSSSVSLYGVEYN-ETLLLGGSIAGVYALSL-SNYTNIRSTRIVETGGEVTGTGAY 692

Query: 719  SDGLIAYGDIMDSSGSYKAITFTNNKFGTLGNFTDEIQSFSNISLTTSWEILSFNNKYFY 778
            + G++ +G+   S+    ++++ N  F + GN    I +FSN++   S EIL+FNN+YF+
Sbjct: 693  AGGVVLFGNFNISNRIVSSLSY-NGTFDSFGNVNSNIATFSNLTFGES-EILAFNNEYFF 750

Query: 779  NQSNMEDFKNTSTFELSLWSAGKNAQNDLIFSGLVSENENVNLTGVVSINANEQIKELNL 838
            N S      NTS   LS+WSAG N   D +FSGL++ NE  NL     +  N   + L L
Sbjct: 751  NTSTSSYIFNTSALSLSIWSAGSNDFGDTLFSGLITRNEFPNLNNSAVLTGNGTAQSLQL 810

Query: 839  GNNIYPYSAVFLNDSSTIYAYMEPNTRLNRLIHSNGEQISWSWKNKISSMAFFPNESLLS 898
             N I PY  V+LNDS T  AY+  ++  + ++ SNG Q +W+    +SS  +  NE++  
Sbjct: 811  RNGIQPYLGVYLNDSLT--AYLYDSSSNSNILFSNGLQGNWNLPRSVSSAYYSDNETMFV 868

Query: 899  VGTISDKDVFPSFSILNLTSNKVIANETLNKNSQISSLLYFTKNSSVLVGGNFTFSDYQC 958
              ++S+ D      +LN T+  ++ NET + NS I+S++ F +NSS+LVGG+FT  +  C
Sbjct: 869  GSSLSNGDSGAELFVLNFTTMDLLYNETFDVNSSINSIVSFGRNSSLLVGGDFTAPNTNC 928

Query: 959  SGLCLFNYETKNWSTFMNNTLEGTVSKLELKNNSNILISGTLSTNKSANIDLALLNLNTY 1018
            S LCL N     WS+F +N  +GT++ LE  N+S +LISG+      + I L  ++LN  
Sbjct: 929  SNLCLLNLGNNQWSSF-SNKFDGTITGLEFANDSRLLISGSYRFENQSGISLGYIDLNNQ 987

Query: 1019 NVSILLQNT-NLTSFEFTGNQIAAWNSSTLFQYNNEAWSQILLPNGTESLKLDSISIFDI 1077
                LL ++  + SF +    I AW+SST++ Y  ++WS   +PN   S  + ++ I   
Sbjct: 988  EFKSLLSDSQKVNSFNYNNGTIVAWDSSTIYSYRGDSWSNHQIPNTNSSTSIKNVQIVSK 1047

Query: 1078 TNKNSSSILEKRALRDTNIMVATGQFYSKGLGTVQALYYTSDTWIPYFYGNLTNNMDTSN 1137
             N + S+      L D  I+V  G+ YS+  G VQA++Y    WIPY+     ++++TS 
Sbjct: 1048 LNNSLSTNNTSNNLNDELILVF-GELYSEDYGFVQAMFYDFQNWIPYYITQPYSSLNTSK 1106

Query: 1138 SINIFPNKDISSKIISDFVLKNWNFNLSDVGXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 1197
            + ++F NKDIS    S  VL+N N  +S                                
Sbjct: 1107 N-SLFMNKDISLLYESQVVLQNPNSTISISSTSSSSATTRSSSTSSTSL----------- 1154

Query: 1198 XXIIPIIGKQQNKKHKIQRGFVVLIGLALSLATVAXXXXXXXXXXXXXRDSRGDYESLKP 1257
                    K  N + KI RG+VVLIGLAL++ TVA              D +G+Y  +KP
Sbjct: 1155 --------KNGNIESKIHRGYVVLIGLALAIGTVAILGIFGVTMAYIFSDDKGEYVRIKP 1206

Query: 1258 RTTEHEMFDAVPPEKLMPFV 1277
            R  EHEM D VPPEKLM F+
Sbjct: 1207 RIDEHEMLDTVPPEKLMKFI 1226

>SAKL0H17204g Chr8 (1522944..1526579) [3636 bp, 1211 aa] {ON} similar
            to uniprot|Q12465 Saccharomyces cerevisiae YLR084C RAX2
            N-glycosylated protein involved in the maintenance of bud
            site selection during bipolar budding localization
            requires Rax1p
          Length = 1211

 Score =  734 bits (1895), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 463/1278 (36%), Positives = 710/1278 (55%), Gaps = 105/1278 (8%)

Query: 21   VVANQLNHLKDILEIENIPAPQFNLQDSTNQSLQLLTSNGFDTLNFVHYNGQQNFTQPII 80
            V  +QL+ LK+ L I+++  PQ +L  S N  + LL    F+ L F  Y GQ+NFT  I 
Sbjct: 18   VTGSQLSSLKEKLNIQDLSIPQIDLSSSVNDEMALLGD--FEDLTFYRYTGQENFTGSI- 74

Query: 81   SSSQNHLIYYSNDTYIRL---LDIPYSTRIQHIIPYGQDAFILSGTGSL-NGFELSNQLV 136
            + ++  LIYYSN T+I+L    D   +  I HIIP+G D+FILSGTG+L  G  L  QL+
Sbjct: 75   TETEKDLIYYSNGTFIKLDSLSDENATADINHIIPFGDDSFILSGTGTLPGGHNLEQQLL 134

Query: 137  YNLTDLSLTPIFENKLVPEVRTIFKDPDTNLVYFGGNFSYLLPDSNISNGLIIWDSSSND 196
            YNL+ L  T IF N+ +  V  I  D +  +VYFGG F Y L +S   + +++W+S++N+
Sbjct: 135  YNLSSLEYTAIF-NQSISTVNDILADDE--IVYFGGEFQYTLGNS-TGHSVVLWNSTTNE 190

Query: 197  TISYEFGGFGSNSVINNILKLNSNDLLFSGQFYTLDDPSILHIPYNITFPNNTSSLLSQQ 256
                 F GFG +SV+N+IL+L++++++F+G+F TLDD ++L     I   N      S +
Sbjct: 191  IQLLPFKGFGLDSVVNSILRLDNDNIVFAGKFNTLDDNTLLK---QIRGSN------SSK 241

Query: 257  NVSTFELNQRIPLTFGKFSTADTNDYINKNQLICPTSEIEAWASDSKA-GSLQITLPFSI 315
            N +  E +Q IPL    +S+  +   +  + LICP+ + + W  +  A G   ++L   +
Sbjct: 242  NATDIEFDQLIPLKHAGWSSQGS---LEHSSLICPSDDSDGWFQEGTATGDFTVSLLTDL 298

Query: 316  RPSKIRIFNSPDPDDEVATFRINPGNQNSIMSLAYLDPLDGQLKYCSEFCPLYNRNQLKL 375
            RPSK+RI+N+ D D +V+ FRI     N IM+L YLDP  G+L YC  +CPL +   L+ 
Sbjct: 299  RPSKLRIYNAFDSDYQVSLFRIITSPANGIMNLTYLDPQTGELSYCDAWCPLLSTELLEQ 358

Query: 376  FNSNDNLKSHVITLLDNNTTDIKWSTTYQEFAFVNQFDLTTLEFQALSSYGSRVGLSGLS 435
              +N  + S  +  + NN T+IKW++ YQEFAFVN+  + +L F AL SYGS VGL G  
Sbjct: 359  AEANVTISSDSVAYIGNNNTNIKWTSAYQEFAFVNEVSVESLTFLALDSYGSSVGLDGFE 418

Query: 436  LFQSDIAVFANESYNKPSCNDQTAYDNEDLIKAALPRVMGSSYSIL-SDNDWYTPLPNSD 494
            ++Q+    FAN++ N+P+C++  +Y                S+++  S   W     +S 
Sbjct: 419  MYQNGYPTFANDTLNQPNCDNINSY----------------SHAVTSSKQQWTQGSMDSS 462

Query: 495  YLACTYLSSSKLIPTVTFYPNLLYAGNYTVDMITPGCTADNSCDSRGIVNVTMWNQTDSS 554
            Y+  TY  +  L P+V FYPN+ YAG+YT++M+TPGCT D SC SRGIVNVT+W+Q + +
Sbjct: 463  YILSTYDGTGDL-PSVNFYPNITYAGDYTLNMVTPGCTGDGSCSSRGIVNVTVWDQINDT 521

Query: 555  ILQTSLIYQTNENYKFDQIFNGYLDPLVKITMSFYSGVYSNTGNFTIVADRINLIINSLD 614
            +L T LIYQ N + K+D +++GYL+   KIT+ FY  + +++    +VADR+++II+S+D
Sbjct: 522  VLSTKLIYQNNNDEKYDLLYSGYLESAPKITLKFYESINTDSSTSIMVADRVDVIIDSID 581

Query: 615  FVTTTSSNEIDIYNVTLNGLFQY--PEYNSVNNLNENYTNSTINQYAYSNYPANVSLIAA 672
                 S   +   N TLNGLFQY    + +++N +    N+TIN+Y+  N P+N  L A 
Sbjct: 582  ----QSKIGLKTINETLNGLFQYQISNFTTISNDSLKIGNTTINRYSIENVPSNSELFAG 637

Query: 673  AYDKDTLLVGGSINKLQEFQIEKNGQNISLQNTFKDLNSVTGIVPYSDGLIAYGDIMDSS 732
             Y+ +TLLV G+ N +   Q+  +  NI  +          GI  YS+GL+  GD   SS
Sbjct: 638  YYN-NTLLVDGAFNGIAVLQLNDD-LNIISEQRMGTGGPTEGINTYSNGLLFLGDFNLSS 695

Query: 733  GSYKAITFTNNKFGTLGNFTDEIQSFSNISLTTSWEILSFNNKYFYNQSNMEDFKNTSTF 792
                 +++ N  F + GN    I  F+NI++  S E+L FNN+Y +N S+ E  +NTS+F
Sbjct: 696  QQISTLSY-NGTFSSFGNLRTNITRFNNITIDDS-ELLVFNNRYIFNVSSNEYIRNTSSF 753

Query: 793  ELSLWSAGKNAQNDLIFSGLVSENENVNLTGVVSINANEQIKELNL----GNNIYPYSAV 848
             LSLWSAG N++ D I  G VS+ +   L G V IN    I  + L    G  +  Y+A 
Sbjct: 754  ALSLWSAGSNSKEDGILVGAVSQRQYTELNGAVYINDANSISTIGLPSFDGKRV--YTAT 811

Query: 849  FLNDSSTIYAYMEPNTRLNRLIHSNG---EQISWSWKNKISSMAFFPNESLLSVGTISDK 905
            ++NDSST YAY   N   + ++ + G   E +  SW + +++M +  ++SLL+VGT +  
Sbjct: 812  YINDSSTAYAYSSKNDSTHHVLIARGNRSEDLPVSWSHAVNTMIYNKDDSLLAVGTNAGD 871

Query: 906  DVFPSFSILNLTSNKVIANETLNKNSQISSLLYFTKNSSVLVGGNFTF--SDYQCSGLCL 963
                S S+ N++++K+I  E L   S +++++ F KNSS+LVGG+FT    D  CSGLCL
Sbjct: 872  TNGTSLSLFNISNSKMIGEENLGAKSSVNAIVAFNKNSSLLVGGDFTIDKDDTSCSGLCL 931

Query: 964  FNYETKNWSTFMNNTLEGTVSKLELKNNSNILISGTLSTNKSANIDLALLNLNTYNVSIL 1023
            +NY    WS F NN++ G ++ L+  N + +LISG L T     I+LA LN+ +  V+IL
Sbjct: 932  YNYNASKWSNFYNNSISGNITDLQFFNGTQLLISGNLYTENETGINLAKLNMASNEVTIL 991

Query: 1024 LQNTNL----TSFEFTGNQIAAWNSSTLFQYNNEAWSQILLPNGTESLKLDSISIFDITN 1079
               + +     +F+ T +++   + + +  Y N  W  +   +  +SL + +  +  +  
Sbjct: 992  RHGSTMVQSFVTFDHTTDELITQSDNEISYYTNGEWKNLTSEDFNDSLYMGA-QLIPLKQ 1050

Query: 1080 KNSSSILEKRALRDTNIMVATGQFYSKGLGTVQALYYTSDTWIPYFYGNLTNNMDTSNSI 1139
             +S   +  RAL      +  G       G+V A+ Y  + W+PYF   + +  +   + 
Sbjct: 1051 TSSKRDVSNRAL------LVNGDLKHSTYGSVSAMLYDFEDWMPYF---IVDGENAGRAS 1101

Query: 1140 NIFPNKDISSKIISDFVLKNWNFNLSDVGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 1199
            NIF NKD+SS   +  +L+  N + S                                  
Sbjct: 1102 NIFMNKDLSSLYTTQTILQGSNTSTSTTSSNMPSETSD---------------------- 1139

Query: 1200 IIPIIGKQQNKKHKIQRGFVVLIGLALSLATVAXXXXXXXXXXXXXRDSRGDYESLKPRT 1259
                  K ++   KI RGFVVLIGLAL++ TVA               ++G YE LKPR 
Sbjct: 1140 ------KNESSSDKIDRGFVVLIGLALAIGTVAVLGGAGAIIAYFFAGNKGQYEPLKPRV 1193

Query: 1260 TEHEMFDAVPPEKLMPFV 1277
             E +M D VPPEKLM FV
Sbjct: 1194 DEGDMIDTVPPEKLMKFV 1211

>TPHA0B03250 Chr2 (745716..749363) [3648 bp, 1215 aa] {ON} Anc_8.256
            YLR084C
          Length = 1215

 Score =  722 bits (1864), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 467/1284 (36%), Positives = 707/1284 (55%), Gaps = 83/1284 (6%)

Query: 5    IRTILGILLLSVAPSSVVANQLNHLKDILEIENIPAPQFNLQDSTNQSLQLLTSNGFDTL 64
            I TI+ +++L    ++  A+ L+++  +L I+    P  N  +++N S+QLL     + L
Sbjct: 4    ISTIVRLVVLFSLANNATASSLSNILKLLNIQEFELPNLNFNNTSN-SIQLL--GDVENL 60

Query: 65   NFVHYNGQQNFTQPIIS--SSQNHLIYYSNDTYIRLLDIPYSTRIQHIIPYGQDAFILSG 122
             F HY GQQNFT    S  SS N+LIYYS+D  I+L      T IQ IIP G D+F+LSG
Sbjct: 61   QFYHYEGQQNFTDDGNSGISSTNNLIYYSDDVLIQLEVGSNDTDIQKIIPVGDDSFVLSG 120

Query: 123  TGSLNGFELSNQLVYNLTDLSLTPIFENKLVPEVRTIFKDPDTNLVYFGGNFSYLLPDSN 182
            +G LNG+ L  QL+YNLT LS+ PIF+  L   + +I  D +  +VYFGG F+Y     N
Sbjct: 121  SGHLNGYALGRQLLYNLTTLSIKPIFDQDL-GNITSILVDEE--IVYFGGEFTYQTRSQN 177

Query: 183  ISNGLIIWDSSSNDTISYEFGGFGSNSVINNILKLNSNDLLFSGQFYTLDDPSILHIPYN 242
             S+ +I W+ +S++ I   F GFGS+S +N+ILKLN +++LF G F TL + S+L   YN
Sbjct: 178  -SSSVISWNMTSDEVIELPFQGFGSDSKVNSILKLNDDNILFVGMFDTLGNSSLL--TYN 234

Query: 243  IT--FPNNTSSLLSQQNVSTFELNQRIPLTFGKFSTADTND-YINKNQLICPTSEIEAWA 299
             T  F N T+S    +N ST +L Q+I L   K++T D    Y ++N  +C     EAW 
Sbjct: 235  TTSNFSNFTNS---TENSSTIQLEQQISL---KYATWDAGTAYFDQNNFVCEAGSSEAWI 288

Query: 300  SDSKAGSLQITLPFSIRPSKIRIFNSPDPDDEVATFRINPGNQNSIMSLAYLDPLDGQLK 359
             + ++G+LQ+  P ++ PSKIRI+N+   +D V+ FRI     N IM+L Y+DPL GQLK
Sbjct: 289  VEGRSGNLQLNFPNTVSPSKIRIYNANTAEDGVSLFRIVTSPSNGIMNLTYVDPLTGQLK 348

Query: 360  YCSEFCPLYNRNQLKLFNSNDNLKSHVITLLDNNTTDIKWSTTYQEFAFVNQFDLTTLEF 419
            YC  FCPL N + L+  +SN   ++     ++NNTT + WS +YQEFAF+N  D++ L  
Sbjct: 349  YCDAFCPLLNSSGLETASSNSTSETRQRVFINNNTTSVTWSESYQEFAFINNIDVSALTL 408

Query: 420  QALSSYGSRVGLSGLSLFQSDIAVFANESYNKPSCNDQTAYDNEDLIKAALPRVMGSSYS 479
             A  SYGS+  LSG+ LFQ     +AN + N+P C+ ++      L           S S
Sbjct: 409  IAQDSYGSKTALSGIELFQDSHTAYANNTLNQPGCDTEST----SLF----------SSS 454

Query: 480  ILSDNDWYTPLPNSDYLACTYLSSSKLIPTVTFYPNLLYAGNYTVDMITPGCTADNSCDS 539
            +LSDN WY  L +  Y+A  Y S S  +PTV FYPN+   G++++ M TPGC AD +C+S
Sbjct: 455  VLSDNGWYKGLDSDSYIAANYQSDSSPLPTVQFYPNIQAVGDFSIKMYTPGCLADGTCES 514

Query: 540  RGIVNVTMWNQTDSSILQTSLIYQTNENYKFDQIFNGYLDPLVKITMSFYSGVYSNTGNF 599
            R IVNVT+ + TD ++L T LIYQ N   K+D+IFNG L    +IT++FYS +  +  + 
Sbjct: 515  RSIVNVTVLDPTDGTVLSTQLIYQNNNEMKYDEIFNGKLTVSPEITLTFYSTILPDLDSA 574

Query: 600  TIVADRINLIINSLDFVTTTSSNEIDIYNVTLNGLFQYPEYNSVNNLNENYTNSTINQYA 659
             IVADR++L    ++       + +   ++ LNGLFQY   N  ++      N++I+Q A
Sbjct: 575  IIVADRVDLTPTYINVDDILLDSNLKSTSLKLNGLFQYQLSNFTSDTKTKVGNNSIHQLA 634

Query: 660  YSNYPANVSLIAAAYDKDTLLVGGSINKLQEFQIEKNGQNISLQNT--FKDLNSVTGIVP 717
             S +P++VSLI   ++    L G + N +Q  Q+     ++ L+NT    +    T I  
Sbjct: 635  LSQFPSSVSLIGNTFNNSIFLAGSTSNIVQ-LQLNS---DLELRNTVVVDNGGETTRIEN 690

Query: 718  YSDGLIAYGDI-MDSSGSYKAITFTNNKFGTLGNFTDEIQSFSNISLTTSWEILSFNNKY 776
            YS GL+ +G   + S+     ++F N  F +     D + +F+N +   S E+L FNN Y
Sbjct: 691  YSQGLLFFGQYNISSTNVVDNLSF-NGTFSSFSQLGDNVTTFANFTYEGS-ELLFFNNDY 748

Query: 777  FYNQSNMEDFKNTSTFELSLWSAGKNAQNDLIFSGLVSENENVNLTGVVSINANEQIKEL 836
             YN S+     N + F  S+ + G N+ ND +  G +  +E  N    + +  N  ++ L
Sbjct: 749  LYNVSSESYIYNNTMFTASVLATGANSNNDTLLLGNIVRSEYSNFNEPLKLYGNSSLESL 808

Query: 837  NLGNNIYPYSAVFLNDSSTIYAYMEPNTRLNRLIHSNGEQISWSWKNKISSMAFFPNESL 896
               ++I PY+AVFLND++ +YAY +     +++I+ N    S  +   ++ ++F  N SL
Sbjct: 809  TFSSSIVPYAAVFLNDTANLYAYKDGEN--SKIIYGNNMTTSLDFSGTLNKLSFSNNSSL 866

Query: 897  LSVGTISDKDVFPSFSILNLTSNKVIANETLNKNSQISSLLYFTKNSSVLVGGNFTFSDY 956
            L    I++     S  I N++    +A+E LN    I+S++ F  N+++LV GNFT  D 
Sbjct: 867  LFANAITNNGS-SSLVISNISDGMSLASENLNNYGYITSMIDFNSNNTILVSGNFTLDDV 925

Query: 957  QCSGLCLFNYETKNWSTFMNNTLEGTVSKLELKNNSNILISGTLSTNKSANIDLALLNLN 1016
             C G+CL+NY TK WS F N+T++G++ +++L N+  ILISG  S    ++I LA L++ 
Sbjct: 926  DCHGICLYNYFTKKWSAFANSTIKGSIVEMQLWNSDQILISGLFSAQNYSSITLASLDIK 985

Query: 1017 TYNVSILLQNTN--LTSFEFTGNQIAAWNSSTLFQYNNEAWSQILLPNGTESLKLDSISI 1074
             YN+S+L  ++   ++SF   G  I  W++ T+ +Y +E W++I  PN T S  ++S+  
Sbjct: 986  GYNISVLSDDSKIEISSFIHDGQSITVWSNDTIMEYKSEKWNEISFPN-TTSKYIESVEA 1044

Query: 1075 FDITNKNSSSILEKRALRDTNIMVATGQFYSKGLGTVQALYYTSDTWIPYF-YGNLTNNM 1133
              I  +NS+S + K       I+ A G+F S   G + A+ + +  W PYF   N   N 
Sbjct: 1045 VSIDLQNSTSNVSK-------ILFAYGEFNSTLYGRLNAMLFRAGDWKPYFSINNFQVNE 1097

Query: 1134 DTSNSINIFPNKDISSKIISDFVLKNWNFNLSDVGXXXXXXXXXXXXXXXXXXXXXXXXX 1193
            D   +I +F N+D+SS   S   L                                    
Sbjct: 1098 DP--AITLFENRDLSSLFNSKNSLP-----------------------ANITSAETSSRS 1132

Query: 1194 XXXXXXIIPIIGKQQNKKHKIQRGFVVLIGLALSLATVAXXXXXXXXXXXXXRDSRGDYE 1253
                     ++ K + K  KI RGFVVLI LAL++ TVA             RD +  YE
Sbjct: 1133 TVSSATATTVVNKIEGKHSKIDRGFVVLIALALAVGTVALLGLFGVTIAYIFRDEQ-KYE 1191

Query: 1254 SLKPRTTEHEMFDAVPPEKLMPFV 1277
            S+KPR    EM D VPPEKLM F+
Sbjct: 1192 SIKPRIDGQEMLDTVPPEKLMKFI 1215

>TDEL0F03830 Chr6 complement(701362..704949) [3588 bp, 1195 aa] {ON}
            Anc_8.256 YLR084C
          Length = 1195

 Score =  718 bits (1853), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 438/1148 (38%), Positives = 689/1148 (60%), Gaps = 68/1148 (5%)

Query: 8    ILGILLLSVAPSSVVANQLNHLKDILEIENIPAPQFNLQDSTNQSLQLLTSNGFDTLNFV 67
            +L +L  SV  S  +A+QL +LK+   I NI  P+    D   ++LQL    GF+ L F 
Sbjct: 4    LLFLLFQSVCLS--LASQLENLKNKHGIVNIGTPRL---DFPGEALQLF--GGFNALTFP 56

Query: 68   HYNGQQNFTQPIISSSQNH-LIYYSNDTYIRLLDIPYSTRIQHIIPYGQDAFILSGTGSL 126
             Y GQ+NFT  I +++ +  ++YYSNDT+I+L++    + ++ I+P+G ++FIL G+GSL
Sbjct: 57   QYEGQENFTGTINNNTDSRGIVYYSNDTFIKLINGSSDSYVEKIVPFGSESFILGGSGSL 116

Query: 127  NGFELSNQLVYNLTDLSLTPIFENKLVPEVRTIFKDPDTNLVYFGGNFSYLLPDSNISNG 186
             G+EL  QL+YNL+DLSL PIFEN L  +VR I +D    + YFGGNFS+    S + + 
Sbjct: 117  LGYELGRQLLYNLSDLSLRPIFENSLT-DVRVILED--YPVAYFGGNFSFD-NGSTVGHS 172

Query: 187  LIIWDSSSNDTISYEFGGFGSNSVINNILKLNSNDLLFSGQFYTLDDPSILHIPYNITFP 246
            +  W+SSSN T    FGGFG  S++N+I+KL+S+++LF+G+FYTLDD ++L    N +  
Sbjct: 173  VATWNSSSNTTSLLPFGGFGEESIVNSIIKLDSDNILFTGEFYTLDDQTLLITNENTSKT 232

Query: 247  NNTSSLLSQQNVSTFELNQRIPLTFGKFSTADTNDYINKNQLICPTSEIEAWASDSKAGS 306
            N++ S+         E+N+ +PL    ++T   +   + +  ICP S+ EAW+  S +GS
Sbjct: 233  NHSQSI---------EINELLPLRAATWNTDSDSS-FDSSAFICPNSQKEAWSVPSTSGS 282

Query: 307  LQITLPFSIRPSKIRIFNSPDPDDEVATFRINPGNQNSIMSLAYLDPLDGQLKYCSEFCP 366
            L+ +LP+   P K+RI+NSP+  + V+ FRI     N IM+L Y+DPL G+L  C  FCP
Sbjct: 283  LEASLPYESYPKKVRIYNSPEEHNAVSLFRIITKPSNGIMNLTYVDPLSGELLNCDAFCP 342

Query: 367  LYNRNQLKLFNSNDNLKSHVITLLDNNTTDIKWSTTYQEFAFVNQFDLTTLEFQALSSYG 426
            L  ++ LK   +N N  S V+ L DNN TDI+WS  YQ+FAFVN+  +T L+F ALSSYG
Sbjct: 343  LMLQDSLKAAVANGN-TSQVVRL-DNNLTDIQWSYDYQDFAFVNKIAVTDLQFLALSSYG 400

Query: 427  SRVGLSGLSLFQSDIAVFANESYNKPSCNDQTAYDNEDLIKAALPRVMGSSYSILSDNDW 486
              VGLS   L+Q  +  +AN S N+  C      ++ D+          +S S LSD++W
Sbjct: 401  DAVGLSSFQLYQDTLTTYANNSLNEVGC------ESNDI----------ASTSALSDSEW 444

Query: 487  YTPLPNSDYLACTYLSSSKLIPTVTFYPNLLYAGNYTVDMITPGCTADNSCDSRGIVNVT 546
               L    YL   + +  + +P VTFYP + YAG YT+++ TPGC++D +C SR IVNVT
Sbjct: 445  QQGLFGQSYLVADFRTGQETLPKVTFYPAINYAGQYTMNLYTPGCSSDQTCTSRSIVNVT 504

Query: 547  MWNQTDSSILQTSLIYQTNENYKFDQIFNGYLDPLVKITMSFYSGVYSNTGNFTIVADRI 606
            MW++   SIL + L++Q NE  K+DQ+++G+L+    +T+ +YS +  N  +  +VADR+
Sbjct: 505  MWSEVGGSILSSILLHQNNEAMKYDQVYSGHLETAPVLTLEYYSPISPNNPSNVVVADRL 564

Query: 607  NLIINSLDFVTTTSSNEIDIYNVTLNGLFQYPEYNSVNNLNE--NYTNSTINQYAYSNYP 664
             +I+ S+D +     N+ D   + LNG+FQY   N  N+ +   +  N+T+N Y   N+P
Sbjct: 565  EVIVESVDIL----KNQTD-ETIPLNGMFQYQLSNFTNSTDSKPSIANTTLNSYTVQNFP 619

Query: 665  ANVSLIAAAYDKDTLLVGGSINKLQEFQIEKNGQNISLQNTFKDLNSVTGIVPYSDGLIA 724
             N SL ++ Y+ +TL VGGS++ +   +++++  ++S    +    +V GI  YSDG+I 
Sbjct: 620  KNASLFSSMYN-NTLWVGGSVSGVAAVELDED-LHVSSTAKYATGGTVEGISSYSDGIIL 677

Query: 725  YGDIMDSSGSYKAITFTNNKFGTLGNFTDEIQSFSNISLTTSWEILSFNNKYFYNQSNME 784
            +G    SS     +TF N  FG+ GN    +++++N+S     E+L FNN+Y +N S+  
Sbjct: 678  FGTFNLSSQPVSTLTF-NGVFGSFGNLETTLRTYTNVSFQQD-ELLVFNNEYVFNLSSNS 735

Query: 785  DFKNTSTFELSLWSAGKNAQNDLIFSGLVSENENVNLTGVVSINANEQIKELNLGNNIYP 844
               N+STF LSLWSAG+N  +D +FSG V++N+   L G  SI +N  +   +L N   P
Sbjct: 736  YISNSSTFGLSLWSAGRNQFDDTLFSGAVTKNQFPGLYGSASIYSNSSVAHFSLQNGAQP 795

Query: 845  YSAVFLNDSSTIYAYMEPNTRLNRLIHSNGEQISWSWKNKISSMAFFPNESLLSVGTISD 904
            Y+A  LNDS T YAY   +  +++L   NG++  W+W   I+SM +  N ++L++GT   
Sbjct: 796  YAACHLNDSVTAYAYRYGS--VSQLYFDNGKEGPWTWFGTINSMRYSKNSTILAIGTDGS 853

Query: 905  KDVFPSFSILNLTSNKVIANETLNKNSQISSLLYFTKNSSVLVGGNFTFSDYQCSGLCLF 964
             D  P  S+ NLTS  V+AN T+++N  ISS+++F +NSS+LVGG++  SD  CSGLCL+
Sbjct: 854  TDE-PILSLFNLTSFDVLANTTISENGTISSMVFFDRNSSLLVGGDYHISDADCSGLCLY 912

Query: 965  NYETKNWSTFMNNTLEGTVSKLELKNNSNILISGTLSTNKSANIDLALLNLNTYNVSILL 1024
            NY+ K W+ F NN++ G +++++L  + ++LISG ++     +++L   N++ Y V+ L+
Sbjct: 913  NYDQKQWTKFANNSITGNITEMQLSESYDLLISGAMNVANKTSVNLLSFNMSNYEVNPLV 972

Query: 1025 QNTN--LTSFEFTGNQIAAWNSSTLFQYNNEAWSQILLPNGTESLKLDSISIFDITNKNS 1082
             ++N  + SF    N I  WN ++L  Y++  W  +   N +       ISI D+    +
Sbjct: 973  WDSNGPIKSFIAEDNDIITWNETSLSGYSDGDWQNLEFDNSSL------ISIVDVIAVKT 1026

Query: 1083 SSILEKRALRDT--NIMVATGQFYSKGLGTVQALYYTSDTWIPYFYGNLTNNMDTSNSIN 1140
               L+KR    +  + ++  GQ Y++     QA  Y    W+PY+  N  ++ D S +  
Sbjct: 1027 EPALDKRQTFSSTFDAILVAGQNYAE---YPQASIYNFQRWLPYYVANKADDEDPSRT-T 1082

Query: 1141 IFPNKDIS 1148
             F N+D S
Sbjct: 1083 FFTNQDDS 1090

 Score = 64.7 bits (156), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 34/73 (46%), Positives = 38/73 (52%), Gaps = 1/73 (1%)

Query: 1205 GKQQNKKHKIQRGFVVLIGLALSLATVAXXXXXXXXXXXXXRDSRGDYESLKPRTTEHEM 1264
            G    K  KI RGFVVLIGLAL+L TV                  G YE + PR  E EM
Sbjct: 1124 GSLVRKSGKINRGFVVLIGLALALGTVVIIGITGVLLALVFNGHSG-YEQVDPRADESEM 1182

Query: 1265 FDAVPPEKLMPFV 1277
             D VPPEKL+ F+
Sbjct: 1183 IDTVPPEKLLKFL 1195

>KAFR0B02690 Chr2 complement(539470..543102) [3633 bp, 1210 aa] {ON}
            Anc_8.256 YLR084C
          Length = 1210

 Score =  650 bits (1677), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 469/1290 (36%), Positives = 698/1290 (54%), Gaps = 116/1290 (8%)

Query: 14   LSVAPSSVVANQLNHLKDILEIENIPAPQFNLQDSTNQSLQLLTSNGFDTLNFVHYNGQQ 73
            LS+  +  +A+QL+ L++ L I+    P      + + SLQLL S  +D L+   Y GQQ
Sbjct: 11   LSLFTTLSLASQLSQLENSLGIQTFAPPALIFSSNNDSSLQLLGS--YDALSLYTYTGQQ 68

Query: 74   NFTQPII-SSSQNHLIYYSNDTYIRLLDIPYSTRIQHIIPYGQDAFILSGTGSLNGFELS 132
            NF+  I   ++ N L+YYSN+T I+L      TRI +I+P G D+FILSG+GSLN + L 
Sbjct: 69   NFSYQITPDTNSNGLVYYSNNTLIQLNQGLDDTRINNIVPIGSDSFILSGSGSLNEYSLE 128

Query: 133  NQLVYNLTDLSLTPIFENKLVPEVRTIFKDPDTNLVYFGGNFSYLLPDSNISNG------ 186
            NQL YNL+ LS+ PIF N  + +V +I  D D  LVYFGGNF++       SNG      
Sbjct: 129  NQLFYNLSSLSVYPIF-NTTLEQVESILVDED--LVYFGGNFTF-------SNGTDDGHS 178

Query: 187  LIIWDSSSNDTISYEFGGFGSNSVINNILKLNSNDLLFSGQFYTLDDPSILHIPYNITFP 246
            + +W+ +SN T    F GFG NS INNIL+LN +++LF+G+FYTLDD S+L         
Sbjct: 179  VAVWNITSNSTGLLPFLGFGENSSINNILRLNDDNILFAGEFYTLDDASLL--------T 230

Query: 247  NNTSSLLSQQNVSTFELNQRIPLTFGKFSTADTNDYINKNQLICPTSEIEAWASDSKAGS 306
            +NTS+  +  N+   EL+  +PL    +S +D +D+ + +  IC   + +AW      G+
Sbjct: 231  SNTSN--ATTNIYDLELSPLLPLNEATWS-SDVSDF-DASSFICVNPDSDAWFVSGTTGT 286

Query: 307  LQITLPFSIRPSKIRIFNSPDPDDEVATFRINPGNQNSIMSLAYLDPLDGQLKYCSEFCP 366
            L  +LP+    +KIRI+NSPD  ++++ FR+      SIM++ Y+DP  G L++C  +CP
Sbjct: 287  LACSLPYDSALTKIRIYNSPDSQNQISEFRLISDPSGSIMNMTYIDPRTGNLEHCDSYCP 346

Query: 367  LYNRNQLKLFNSNDNLKSHVITLLDNNTTDIKWSTTYQEFAFVNQFDLTTLEFQALSSYG 426
            L +R+ L    S+    S +  LL +N T IKWS  YQEF FVN    T L+F AL+SYG
Sbjct: 347  LLSRDTLSS-ASDAASVSEMARLLSDNATVIKWSAEYQEFGFVNVVSTTLLQFLALNSYG 405

Query: 427  SRVGLSGLSLFQSDIAVFANESYNKPSCNDQTAYDNEDLIKAALPRVMGSSYSILSDNDW 486
            S V L+G SL+Q + AVFAN S N  SC      +N D              S LSDNDW
Sbjct: 406  SNVALAGYSLYQDEYAVFANNSLNGASCTS----NNSDYTS-----------STLSDNDW 450

Query: 487  YTPLPNSDYLACTYLSSSKLIPTVTFYPNLLYAGNYTVDMITPGCTADNSCDSRGIVNVT 546
                    Y+   Y      IP VTF  NL Y+G+Y +++ TPGC+ D +C +RG+VNVT
Sbjct: 451  VFGASGQTYVTTFYTEGDDPIPQVTFNANLPYSGDYVINLYTPGCSDDGTCSTRGLVNVT 510

Query: 547  MWNQTDSSILQTSLIYQTNENYKFDQIFNGYLDPLVKITMSFYSGVYSNTGNFTIVADRI 606
            +++++D SIL T  IYQ NE  K+D++F+GYL   V+I + + SG+ S++   T+VADR 
Sbjct: 511  VYDESDDSILSTVEIYQNNEALKYDELFSGYLKNSVRIVLEYVSGISSDSTGTTVVADRS 570

Query: 607  NLIINSLDFVTTTSSNEIDIYNVTLNGLFQYP---EYNSVNNLNENYTNSTINQYAYSNY 663
            N+ + SLD +   SS++ +   V LNGLFQY      ++ N+ +     + +NQY    +
Sbjct: 571  NIYVTSLDILGQISSSK-NGSTVALNGLFQYQLSNFSSTFNSSSAKVGKTFLNQYPLDIF 629

Query: 664  PANVSLIAAAYDKDTLLVGGSINKLQEFQIEKN-----GQNISLQNTFKDLNSVTGIVPY 718
              N SL A+ YD + LLVGG+   +   +   +       N  ++  FK++       P+
Sbjct: 630  NTNSSLFASTYD-NYLLVGGAEQSVYALESSNDLNFSTSDNSGVEGQFKNMQ------PF 682

Query: 719  SDGLIAYGDIMDSSGSYKAITFTN--NKFGTLGNFTDEIQSFSNISLTTSWEILSFNNKY 776
            S+G+  YG+   S  +  A+T+    N F   GN    I +F N++   S EIL FNN Y
Sbjct: 683  SEGIFLYGNFNLSGVTEGAVTYNGSFNPFTQYGN--SSIDTFKNVTFGNS-EILVFNNAY 739

Query: 777  FYNQSNMEDFKNTSTFELSLWSAGKNAQNDLIFSGLVSE------NENVNLTGVVSINAN 830
             YN S+     N+S+  LSLWSAG NA  DL+F+G  S+      NE++N      I AN
Sbjct: 740  LYNVSSSTLMSNSSSLSLSLWSAGANANGDLLFNGASSQMSYSFNNESIN------IGAN 793

Query: 831  EQIKELNLGNNIYPYSAVFLNDSSTIYAYMEPNTRLNRLIHSNGEQISWSWKNKISSMAF 890
              ++ LN   +I PY  +++N S   Y Y + +    R+  +NG Q SW W N + +  +
Sbjct: 794  NIVQGLNFNESIDPYLGLYMNTSHGAYFYQDDDNT--RVYFTNGSQPSWQWPNDVVAAIY 851

Query: 891  FPNESLLSVGTISDKDVFPSFSILNLTSNKVIANE-TLNKNSQISSLLYFTKNSSVLVGG 949
              N+SLL  GT S  +     ++LN T+  VIANE   ++ SQIS ++ F  N++ ++GG
Sbjct: 852  SDNQSLLIAGTSSSLESSSFLTVLNTTTYDVIANESLSSQQSQISGIVNFASNATAIIGG 911

Query: 950  NFTFSDYQCSGLCLFNYETKNWSTFMNNTLEGTVSKLELKNNSNILISGTLSTNKSANID 1009
            NF+  +  C GLCLFNY    WS+F + ++ GTV  ++L N S +++SG  ST   ++I 
Sbjct: 912  NFSMPNVNCFGLCLFNYGNSTWSSFADASINGTVDHMQLFNESELIVSGLFSTKNISSIT 971

Query: 1010 LALLNLNTYNVSILL--QNTNLTSFEFTGNQIAAWNSSTLFQYNNEAWSQILLPNGTESL 1067
            +A LNL    ++ L   ++    SF     +I AWN++ L  Y +  W+   + N   S 
Sbjct: 972  MASLNLKNNKITALKSGESNTFKSFTVADQKIVAWNNTALSIYEDNVWTVERISNINSSS 1031

Query: 1068 KLDSISIFDITNKNSSSILEKRALRDTNIMVATGQFYSKGLGTVQALYYTSDTWIPYFYG 1127
             +D+++   +     +S L KR    ++ ++ +GQ Y    G +QA+ Y   +W+PY   
Sbjct: 1032 VVDNLNYVTL-----ASALSKRDTSSSDAILVSGQLYDNSYGHIQAMVYDFSSWVPY--- 1083

Query: 1128 NLTNNMDTSNSINIFPNKDISSKIISDFVLKNWNFNLSDVGXXXXXXXXXXXXXXXXXXX 1187
             L  N ++ +SIN F ++D+SS   +   L                              
Sbjct: 1084 -LLINSESDSSINAFIDRDMSSFTNTQVAL------------------LTNSGTVSNSSS 1124

Query: 1188 XXXXXXXXXXXXIIPIIGKQQNKKHKIQRGFVVLIGLALSLATVAXXXXXXXXXXXXXRD 1247
                         IP     +  K KI RGFVVL+GLAL+L TVA             RD
Sbjct: 1125 STTSPGASASATSIP----NKTHKRKIDRGFVVLLGLALALGTVAVLGIAGVIMAYVFRD 1180

Query: 1248 SRGDYESLKPRTTEHEMFDAVPPEKLMPFV 1277
              G YE + PR  E+EM + VPPEKLM ++
Sbjct: 1181 DNGAYEPINPRIDENEMIETVPPEKLMKYI 1210

>KNAG0G02000 Chr7 complement(443631..447239) [3609 bp, 1202 aa] {ON}
            Anc_8.256 YLR084C
          Length = 1202

 Score =  641 bits (1654), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 432/1267 (34%), Positives = 696/1267 (54%), Gaps = 102/1267 (8%)

Query: 23   ANQLNHLKDILEIENIPAPQFNLQDSTNQSLQLLTSNGFDTLNFVHYNGQQNFTQPIISS 82
            A+ L +++ IL    +  P F++ +  NQ  Q+L  +  + ++F  Y GQQNFT     +
Sbjct: 18   ASNLENVRRILNATEVTVPTFDVGNKNNQ-FQIL--DDINGISFYEYLGQQNFTTDANVT 74

Query: 83   SQNHLIYYSNDTYIRLLD-IPYSTRIQHIIPYGQDAFILSGTGSLNGFELSNQLVYNLTD 141
                LIYYSN+T++ L D I    +IQ IIP G D+FILSG G +N   L++QLV+N+TD
Sbjct: 75   DVQRLIYYSNETFMSLSDSIAAEAQIQGIIPLGDDSFILSGQGMINNVSLASQLVFNMTD 134

Query: 142  LSLTPIFENKLVPEVRTIFKDPDTNLVYFGGNFSYLLPDSNISNGLIIWDSSSNDTISYE 201
            LS+T IF+  L          P   LVYF GNF++     N + G I+WDS         
Sbjct: 135  LSITKIFDTPLRSIEGVTVDGP---LVYFMGNFTF-----NNNTGAIMWDSRDRSINLLP 186

Query: 202  FGGFGSNSVINNILKLNSNDLLFSGQFYTLDDPSILHIPYNITFPNNTSSLLSQQNVSTF 261
            F GFG  + IN+ILKLN +++LF+G F T+ + S+L +  N+       S  S +N ++ 
Sbjct: 187  FHGFGPYANINSILKLNDDNILFAGHFSTVWNSSLL-LQSNV-------SEESVRNTTSL 238

Query: 262  ELNQRIPLTFGKFSTADTNDYINKNQLICPTSEIEAWASDSKAGSLQITLPFSIRPSKIR 321
             LN  +PL   ++S   TN  ++ +QLICP    ++W+  +  G     LPF I PSKIR
Sbjct: 239  LLNPSVPL---QYSQWKTNGELDSSQLICPDPSKDSWSVSATTGDFTCELPFQITPSKIR 295

Query: 322  IFNSPDPDDEVATFRINPGNQNSIMSLAYLDPLDGQLKYCSEFCPLYNRNQLKLFNSNDN 381
            I+NSPD D +V+ FR       SIM+L YLDPL G +  C  FCPLY++  L+    ++ 
Sbjct: 296  IYNSPDKDSQVSLFRFLTYPAGSIMNLTYLDPLSGNMTSCDAFCPLYSKTVLQ-SQWDNT 354

Query: 382  LKSHVITLLDNNTTDIKWSTTYQEFAFVNQFDLTTLEFQALSSYGSRVGLSGLSLFQSDI 441
             +++ + +++NN+T+I+W+  YQEFA V+    T+LEF AL+SYG+ +GL+G  ++Q+  
Sbjct: 355  AEANTVAIINNNSTNIQWTPNYQEFALVSPVAATSLEFNALASYGNNLGLAGFQIYQASF 414

Query: 442  AVFANESYNKPSCNDQTAYDNEDLIKAALPRVMGSSYSILSDNDWYTPLPNSDYLACTYL 501
            + F N S+N P+CN+     N     ++L           S N+W +     +YL   Y 
Sbjct: 415  SAFGNNSFNTPNCNNNDKDSNNTFTSSSL-----------SPNNWTSV---GEYLTVGYT 460

Query: 502  SSSKLIPTVTFYPNLLYAGNYTVDMITPGCTADNSCDSRGIVNVTMWNQTDSSILQTSLI 561
             +   +P VT+  ++ ++G Y++++ TPGC+ADN+C +RGIVN T+++   + +L TSLI
Sbjct: 461  PNENPVPKVTYKIDIQHSGEYSINVFTPGCSADNTCSTRGIVNYTLFDTVTNKMLATSLI 520

Query: 562  YQTNENYKFDQIFNGYLDPLVKITMSFYSGVYSNTGNFTIVADRINLIINSLDFVTTTSS 621
            YQ N+  K+D +++G L+   +ITM++YSG+Y++    TIVADR++L I S+D      S
Sbjct: 521  YQNNDEIKYDTLYSGQLNSSCEITMTYYSGLYASNTVTTIVADRVDLNIISMDL-----S 575

Query: 622  NEIDIYNVTLNGLFQYPEYNSVNN-LNENYTNSTINQYAYSNYPANVSLIAAAYDKDTLL 680
            +  ++  + LNGLFQY   N  N+ +     N+++NQ+A +N+  +VSL A      ++L
Sbjct: 576  HRTEVSKLALNGLFQYQISNFTNDSIPMKIANTSLNQFALNNFEPSVSLRAFPLSNSSIL 635

Query: 681  VGGSINKLQEFQIEKNGQNISLQNTFKDLNS--VTGIVPYSDGLIAYGDIMDSSGSYKAI 738
            + G+   +  F I  N  ++S+QN+ + +++   T   PYS+GL+    ++D  G+   +
Sbjct: 636  LSGTEGNM--FSINLN-TDLSVQNSTRLISTENFTTFQPYSNGLV----MLDGQGN---V 685

Query: 739  TFTNNKFGTLGNFTDE--IQSFSNISLTTSWEILSFNNKYFYNQSNMEDFK-NTSTFELS 795
            +   + F  L    D       +NI+L    E+L FNN Y YN ++ +  + N+S F L+
Sbjct: 686  SLFKDNFKNLNTTMDGSLATDVANITLNGD-ELLVFNNGYIYNVTSQQQTRSNSSIFNLT 744

Query: 796  LWSAGKNAQNDLIFSGLVSENEN--VNLTGVVSINANEQIKELNLGNNIYPYSAVFLNDS 853
            + SAG N+ ND IF G V + +    N +  V+ + N+ I++++L +N  P   +FLND 
Sbjct: 745  VSSAGANSINDTIFLGKVVQWQYAIANQSAQVNADFNDGIEQMSLPSNTVPSRGIFLNDD 804

Query: 854  STIYAYMEPNTRLNRLIHSNGEQISWSWKNKISSMAFFPNESLLSVGTISDKDVFPSFSI 913
            ST Y Y E N     + +SN       W  +  ++ +  N++LL VG  +D     + S+
Sbjct: 805  STGYFYKESNKSKLYITNSNSTS-GLEWYGEPETVVYDKNDTLLMVGYYNDNTFSSTLSL 863

Query: 914  LNLTSNKVIANETLNKNSQISSLLYFTKNSSVLVGGNFTFSDYQCSGLCLFNYETKNWST 973
             NLTS  VI  E LN  S ISSLLYF KN ++LV G+F  S+  CS LCL+NY++  W +
Sbjct: 864  TNLTSFDVIKEENLNVGSSISSLLYFAKNDTLLVAGDFEPSNGNCSDLCLYNYKSGQWDS 923

Query: 974  FMNNTLEGTVSKLELKNNSNILISGTLSTNKSANIDLALLNLNTYNVSILLQN----TNL 1029
              NN++ G+V+ L+L  N  IL+ G L+  ++ ++++A +NL+  +V  L+       NL
Sbjct: 924  LANNSVSGSVAALQLYQNDTILVLGNLTLPQANDVNMAFVNLSNNHVGSLIMKKDAPVNL 983

Query: 1030 TSFEFTGNQIAAWNSSTLFQYNNEAWSQILLPNGTESLKLDSISIFDITNKNSSSILEKR 1089
             S   + ++I AWN + LF ++  +W+++ +P GT+S           T+ +S   +   
Sbjct: 984  HSMIVSNSRIVAWNDTVLFSFDGNSWTRVSVP-GTDS---------SATSISSVQFISME 1033

Query: 1090 ALRDTNIMVATGQFYSKGLGTVQALYYTSDTWIPYFYGNLTNNMDTSNSINIFPNKDISS 1149
               D  +++  G+F     G ++++ Y    WIPY    L  +     + ++F N+DIS 
Sbjct: 1034 GTDDALLLL--GEFRHSEFGDIKSIVYNFRDWIPYL---LYVDGPRQGTGHLFMNRDISL 1088

Query: 1150 KIISDFVLKNWNFNLSDVGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIIPIIGKQQN 1209
              I+   L N    L++                                  +P +    +
Sbjct: 1089 HNIAQIPLLNSTRVLTN-----------------QSFASSTSSSVSSTSTTLPKVSTTHS 1131

Query: 1210 K--KHKIQRGFVVLIGLALSLATVAXXXXXXXXXXXXXRDSRGD-YESLKPRTTEHEMFD 1266
            K  +  + RGFVVLIGLAL+LATV+             RD+ GD Y++L PR  E+ M +
Sbjct: 1132 KPGRRIVDRGFVVLIGLALALATVSVMGVAGVLLAYIFRDNVGDSYQTLNPRMDENAMVN 1191

Query: 1267 AVPPEKL 1273
             +PPEKL
Sbjct: 1192 TLPPEKL 1198

>Kwal_56.23589 s56 complement(610601..614242) [3642 bp, 1213 aa] {ON}
            YLR084C (RAX2) - YLR084C [contig 176] FULL
          Length = 1213

 Score =  585 bits (1509), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 410/1277 (32%), Positives = 656/1277 (51%), Gaps = 105/1277 (8%)

Query: 23   ANQLNHLKDILEIENIPAPQFNLQDSTNQSLQLLTSNGFDTLNFVHYNGQQNFTQPIISS 82
               LN ++  L ++N   P  +L  S N+ +QLL    F  LN+  Y GQ NFT      
Sbjct: 20   GTHLNTIESALGVKNFEVPSLDLSGSNNEEIQLL--GNFQNLNYYRYTGQDNFTGISDEK 77

Query: 83   SQNHLIYYSNDTYIRLLDIPYSTR---IQHIIPYGQDAFILSGTGSLNGFELSNQLVYNL 139
            ++  LIY+SN T + L    YS     + H+IP   D+FILSGTG+++G  L +Q+V+NL
Sbjct: 78   ARESLIYHSNGTLLELSSPQYSNESFSVDHVIPLRDDSFILSGTGAISGAVLDHQVVFNL 137

Query: 140  TDLSLTPIFENKLVPEVRTIFKDPDTNLVYFGGNFSYLLPDSNISNGLIIWDSSSNDTIS 199
            +DLS T IF   L P V  I    + N  YFGG+F +  PD + ++GLI+WD   N+  +
Sbjct: 138  SDLSYTAIFNQSLSP-VNAI--TVNGNKAYFGGSFKFKGPDQD-THGLIVWDFVKNEVET 193

Query: 200  YEFGGFGSNSVINNILKLNSNDLLFSGQFYTLDDPSILHIPYNITFPNNTSSLLSQQNVS 259
              FGG G +S +N+IL L+ N++LF+G F T+D+ S L+    I   N+TS        S
Sbjct: 194  LPFGGLGKDSNVNSILVLDDNNILFAGNFSTIDEKSALNSTLGI---NSTSD-------S 243

Query: 260  TFELNQRIPLTFGKFSTADTNDYINKNQLICPT-SEIEAWASDSKAGSLQITLPFSIRPS 318
              EL+ +IPL   K+++  +   + K+ L+CP+ S   AW      G  ++++  +IRPS
Sbjct: 244  APELSHKIPLKTAKWTSDGS---LQKDDLVCPSNSATSAWLGTGTTGQFELSIAHTIRPS 300

Query: 319  KIRIFNSPDPDDEVATFRINPGNQNSIMSLAYLDPLDGQLKYCSEFCPLYNRNQLKLFNS 378
            K+R+ N+   D+EV+ FR+     N IM+L YLDP  G+L+ C  +CPL +   L    S
Sbjct: 301  KLRLHNARTLDEEVSLFRVITTPSNGIMNLTYLDPSSGELRTCDAWCPLLSTQNLTAAKS 360

Query: 379  NDNLKSHVITLLDNNTTDIKWSTTYQEFAFVNQFDLTTLEFQALSSYGSRVGLSGLSLFQ 438
                   V  L  NN T ++WS +YQ+FAFVN   +T++ F AL SYGS VG++G  L++
Sbjct: 361  KAASTDQVEFL--NNQTTVQWSESYQDFAFVNSVPVTSITFMALDSYGSSVGVNGFELYE 418

Query: 439  SDIAVFANESYNKPSCNDQTAYDNEDLIKAALPRVMGSSYSILSDNDWYTPLPNSDYLAC 498
             D +V+AN+S+N P C+  + Y                S + LS + W     + DY+  
Sbjct: 419  DDFSVYANDSFNVPDCSSTSNY----------------SKASLSASQWDQGSSDEDYV-Y 461

Query: 499  TYLSSSKLIPTVTFYPNLLYAGNYTVDMITPGCTADNSCDSRGIVNVTMWNQTDSSILQT 558
            T + +S+  P+VTFYP ++Y+G YT++++TPGC AD SC SR +VN ++W+  + ++L +
Sbjct: 462  TLVENSQEAPSVTFYPQIVYSGLYTINVLTPGCLADGSCQSRSVVNASLWDSNNGTLLSS 521

Query: 559  SLIYQTNENYKFDQIFNGYLDPLVKITMSFYSGVYSNTGNFTIVADRINLIINSLDFVTT 618
              IYQ N+  K+D +++GYL+  VK+ + +   + +  G+  +VA +I++  +  D    
Sbjct: 522  ITIYQNNDYEKYDNLYSGYLENEVKVVLEYEGAIGNTEGSPMMVAGQISVNTDEFD---- 577

Query: 619  TSSNEIDIYNV-TLNG---LFQYPEYNSVNNLNENYTNST-INQYAYSNYPANVSLIAAA 673
             SS   D Y    LNG          + + N   N  NST + QY+ SN+  N +     
Sbjct: 578  -SSVFTDKYKTGKLNGLLHYSLSNSSSYLQNFKSN--NSTDLAQYSVSNFAKNSNFFVDK 634

Query: 674  YDKDTLLVGGSINKLQEFQIEKNGQNISLQNTFKDLNSVTGIVPYSDGLIAYGDIMDSSG 733
            + K+ +++  S  K+ + +I++   ++    T +  + V+G+  +S+GL   G I    G
Sbjct: 635  F-KNYIMLFASSGKVSKLEIDQQ-FDVRTVTTEEVGDEVSGVFAFSEGL---GVIGTFDG 689

Query: 734  SYKAITFTNNKFGTLGNFTDEIQSFSNISLTTSWEILSFNNKYFYNQSNMEDFKNTSTFE 793
            S K   F N  F  +      + +F+N +L  + E++S  N Y  N +    F+N+S   
Sbjct: 690  STKGAKFYNGSFFDIPLSHSNVTTFTNFTLDGA-ELVSLGNYYAINTTTDTLFRNSSKMT 748

Query: 794  LSLWSAGKNAQNDLIFSGLVSENENVNLTG-VVSINANEQIKELNLGNNIYPYSAVFLND 852
            L+  SAG N   + +F G ++ NE  +L G     + ++    L        Y A ++++
Sbjct: 749  LTARSAGLNNLGETVFYGSLTRNEYTDLNGSFFISSNSQSSSRLRGSQGRIWYDATYIDN 808

Query: 853  SSTIYAYMEP---NTRLNRLIH---SNGEQISWSWKNKISSMAFFPNESLLSVGTISDKD 906
            S+T YA+ +P   N      I+   +    +S+ W N + SM +  N SLL++G + ++ 
Sbjct: 809  STTGYAFYDPSSTNGSYGVSIYKDMAKERDLSYRWTNMVGSMLYSKNSSLLALG-MKNET 867

Query: 907  VFPSFSILNLTSNKVIANETLNKNSQISSLLYFTKNSSVLVGGNFTFSDYQCSGLCLFNY 966
              P   + NLT+ +  A      N  I+SL++F +N+SVLVGG+F  S+  CSGLCLF+Y
Sbjct: 868  RSPQLLLTNLTTGEDTATFEWKTNVSINSLIFFDQNTSVLVGGDFNESESNCSGLCLFDY 927

Query: 967  ETKNWSTFMNNTLEGTVSKLELKNNSNILISGTLSTNKSANIDLALLNLNTYNVSILLQN 1026
            E K+WS F +N + G++  +++ N S++++ G    N +  ++LA ++L   + +IL Q 
Sbjct: 928  ERKHWSPFFDNMINGSIHSMKIFNKSSLVLGGFFDINDTKQVNLASMSLTDGSYNILHQG 987

Query: 1027 TN-LTSFEFTGNQI---AAWNSSTLFQYNNEAWSQILLPNGTESLKLDSISIFDITNKN- 1081
            T  +  F F   ++    A +++ LF+  N  W  I       S + D  S+F   ++  
Sbjct: 988  TETILDFIFVDGKVDNLVAVSANDLFRLTNNNWESI-------SAQFDDSSVFGGLSEFP 1040

Query: 1082 -SSSILEKRALRDTNIMVATGQFYSKGLGTVQALYYTSDTWIPYFYGNLTNNMDTSNSIN 1140
                   K+   + N ++ TG    K  G + A  Y  + WIPYF      + D      
Sbjct: 1041 IQQGGQNKKREEEKNSLLITGDLLHKTYGKISAALYDFNDWIPYFSTTPATSTDGLGQSR 1100

Query: 1141 IFPNKDISSKIISDFVLKNWNFNLSDVGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXI 1200
            I+ NKDISS      VL++                                         
Sbjct: 1101 IYSNKDISSAFNYQGVLQS------------------------SRGGNSSSVPSGTSSPT 1136

Query: 1201 IPIIGKQQNKKHKIQRGFVVLIGLALSLATVAXXXXXXXXXXXXXRDSRGDYESLKPRTT 1260
                 +   KK+KI RGFVVLIGLAL++ T+A               S   Y+SL+PR  
Sbjct: 1137 SSSPSQLGAKKNKIARGFVVLIGLALAMGTLAVMGVIGIALTFFFGKSSDKYQSLEPRAD 1196

Query: 1261 EHEMFDAVPPEKLMPFV 1277
            E EM D VPPEKLM F+
Sbjct: 1197 ESEMIDTVPPEKLMRFI 1213

>KLTH0G13838g Chr7 (1197919..1201563) [3645 bp, 1214 aa] {ON} similar
            to uniprot|Q12465 Saccharomyces cerevisiae YLR084C RAX2
            N-glycosylated protein involved in the maintenance of bud
            site selection during bipolar budding localization
            requires Rax1p
          Length = 1214

 Score =  563 bits (1452), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 380/1167 (32%), Positives = 636/1167 (54%), Gaps = 87/1167 (7%)

Query: 7    TILGILLLSVAPSSVVANQLNHLKDILEIENIPAPQFNLQDSTNQSLQLLTSNGFDTLNF 66
            T L   +L++A      + L+ L+  L +E    P  +L  S N  +QLL    F  +N 
Sbjct: 5    TCLATSVLALAKF-CSGSHLDALESKLGVEVYDIPNLDLSKSKNNEVQLL--GNFKDINI 61

Query: 67   VHYNGQQNFTQPIISSSQNHLIYYSNDTYIRLLDIPYSTRI---QHIIPYGQDAFILSGT 123
            + Y+GQ+NFT  +  + +N LIYYSN+T++ +     S+ +    HI+P+  DAFILSG 
Sbjct: 62   LKYSGQKNFTGEVSGNPENALIYYSNETFLEIYSSSDSSEVFSVDHIVPFKDDAFILSGA 121

Query: 124  GSLNGFELSNQLVYNLTDLSLTPIFENKLVPEVRTIFKDPDTNLVYFGGNFSYLLPDSNI 183
            GS++G +LS QL++NL+ L    IF   L  +V TI  + D   V+FGG+F Y + +  I
Sbjct: 122  GSISGHQLSRQLLFNLSSLEFREIFGQDLA-QVNTITANGDK--VFFGGSFEYEMSNQTI 178

Query: 184  SNGLIIWDSSSNDTISYEFGGFGSNSVINNILKLNSNDLLFSGQFYTLDDPSILHIPYNI 243
             + L++WDS  +      FGGFG NS +N+IL L+++++LF+G F  +D+   L+   NI
Sbjct: 179  -HSLLVWDSIKDGVEVLPFGGFGKNSTVNSILNLDNSNILFAGNFSAVDNTQQLN---NI 234

Query: 244  TFPNNTSSLLSQQNVSTFELNQRIPLTFGKFSTADTNDYINKNQLICPTSEIEAW-ASDS 302
               N +       N S  EL  +I L    + +  T   ++K+ + CP++E   W  + S
Sbjct: 235  NVSNTS-------NTSVPELGHQISLQSAAWVSDGT---LDKSAIKCPSTESTGWLKTGS 284

Query: 303  KAGSLQITLPFSIRPSKIRIFNSPDPDDEVATFRINPGNQNSIMSLAYLDPLDGQLKYCS 362
              G  ++ +P   RPSK+R+FN+ D D++V+ FRI     N IM+L YLDP  G+L  C 
Sbjct: 285  TQGQFELYMPEETRPSKLRVFNARDSDEQVSLFRIVTTPSNGIMNLTYLDPTTGELASCD 344

Query: 363  EFCPLYNRNQLKLFNSNDNLKSHVITLLDNNTTDIKWSTTYQEFAFVNQFDLTTLEFQAL 422
             +CPL +   L   +S  +     +   +N TT ++WS ++Q+FAFVN   ++ L F AL
Sbjct: 345  AWCPLLSSQNLTDISSK-SYPGDQVQYFENRTT-LQWSESFQDFAFVNNVPVSDLTFIAL 402

Query: 423  SSYGSRVGLSGLSLFQSDIAVFANESYNKPSCNDQTAYDNEDLIKAALPRVMGSSYSILS 482
             SYGS VGL+G+ L++S  +V+AN + N P+C   +A  N                ++LS
Sbjct: 403  DSYGSSVGLAGIELYESAYSVYANNTLNAPNCAQGSATSN----------------ALLS 446

Query: 483  DND-WYTPLPNSDYLACTYLSSSKLIPTVTFYPNLLYAGNYTVDMITPGCTADNSCDSRG 541
            ++  W +     +YL+ T +  S+  P V FYP+++Y G YT+D++TPGC  D+SC +RG
Sbjct: 447  NSSAWDSGSSEGNYLS-TSVQDSETNPFVIFYPSIIYPGVYTIDVLTPGCLEDSSCQTRG 505

Query: 542  IVNVTMWNQTDSSILQTSLIYQTNENYKFDQIFNGYLDPLVKITMSFYSGVYSNTGNFTI 601
            I+N T+ +  ++++L +  IYQ N+  KFD +++G+LD  VK+T+ F   + S T    +
Sbjct: 506  IINATIRDVQNNTLLDSIEIYQNNDYEKFDTLYSGFLDSEVKVTLEFDGAINSGTEVPVM 565

Query: 602  VADRINLIINSLDFVTTTSSNEIDIYNVTLNGLFQYPEYNSVNNLNE--NYTNSTINQYA 659
            VA +I  ++N  DF  +   N    +   +NGL  Y   N+ + L+E  +Y+ + +  Y+
Sbjct: 566  VASKI--VVNIEDFDQSVFENNTSGF---INGLLHYSTSNTSSFLSELGSYSATDLAHYS 620

Query: 660  YSNYPANVSLIAAAYDKDTLL--VGGSINKLQEFQIEKNGQNISLQN-TFKDLNS-VTGI 715
             S  P + ++ A  ++ D +L    G + +L      K   N+S++  TF+ +   ++ I
Sbjct: 621  VSKLPKHSNIFANMFEDDLVLFTTDGEMARL------KLANNLSIEEYTFETIGKDISTI 674

Query: 716  VPYSDGLIAYGDIMDSSGSYKAITFTNNKFGTLGNFTDEIQSFSNISLTTSWEILSFNNK 775
              YS GLI  G    SS    A    N  F  L  F   +++FSN++L  + E+L F+  
Sbjct: 675  SEYSGGLIIVGTFNGSS--EPAARGFNGTFFNLTEFNSTVRTFSNLTLGQT-EMLIFDKN 731

Query: 776  YFYNQSNMEDFKNTSTFELSLWSAGKNAQNDLIFSGLVSENENVNLTGVVSINANEQIKE 835
               N +  E   +TS   L + SAG+N  ND +F G V +N+  NL G   I+ N +   
Sbjct: 732  IILNGTTGEKIYDTSKLTLEVASAGRNPYNDTLFQGYVLQNDYTNLNGSFFISTNSEEVS 791

Query: 836  LN---LGNNIYPYSAVFLNDSSTIYAYMEPNTRLNR----LIHSNGEQISWS-WKNKISS 887
             N   LG  + PY A F+++S+T YAY  P+   N     +++ +G  +  S W  K+ +
Sbjct: 792  QNFWALGGKL-PYDAAFVDNSTTAYAYYNPDNTSNSFGVSVMNDSGSTVQLSAWSGKVGA 850

Query: 888  MAFFPNESLLSVGTISDKDVFPSFSILNLTSNKVIANETLNKNSQISSLLYFTKNSSVLV 947
            MA   N+SLL++G   D+       + N +S + +A+   +    ++S+++F +N+SVLV
Sbjct: 851  MASSKNDSLLAIGG-KDQHTDSQLLVTNSSSGESLASYKWDSEISLNSIIFFARNNSVLV 909

Query: 948  GGNFTFSDYQCSGLCLFNYETKNWSTFMNNTLEGTVSKLELKNNSNILISGTLSTNKSAN 1007
            GG+F  ++ QCSGLCLFNY+ K WS F+NN++ G ++++E+ NNSN+LI+G+   N++  
Sbjct: 910  GGSFRVNNTQCSGLCLFNYQDKKWSPFLNNSIRGVINRMEIFNNSNLLIAGSFRLNETDG 969

Query: 1008 IDLALLNLNTYNVSILLQN----TNLTSFEFTGNQIAAWNSSTLFQYNNEAWSQILLPNG 1063
            + LA + L   +  IL +         S + + N + A++ ++L Q  +  W QI   N 
Sbjct: 970  VSLASICLKDSSSEILHEGNITLNGFVSMDGSSNNVVAFSDTSLLQLESGKWQQI-STNF 1028

Query: 1064 TESLKLDSISIFDITNKNSSSILEKRALRDTN--IMVATGQFYSKGLGTVQALYYTSDTW 1121
            TE+ K   + +F + +        ++  RD++  +++ TG       G++ A +Y S  W
Sbjct: 1029 TENSKFKGLDVFPLKDTT------RKQKRDSSSKVLLITGSLQHAKFGSINAAFYDSGEW 1082

Query: 1122 IPYFYGNLTNNMDTSNSINIFPNKDIS 1148
             P+   N   +     + ++F N+D+S
Sbjct: 1083 TPFLSSNQATSSSDLETSHVFLNRDLS 1109

 Score = 72.8 bits (177), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 42/70 (60%)

Query: 1208 QNKKHKIQRGFVVLIGLALSLATVAXXXXXXXXXXXXXRDSRGDYESLKPRTTEHEMFDA 1267
            Q KK KI RGF+VLI LAL+L T+A              DS   Y+  KPRT E+EM D 
Sbjct: 1145 QRKKKKIDRGFIVLISLALALGTLAVLGLLGVIFSYFFGDSGDGYQLSKPRTDENEMIDT 1204

Query: 1268 VPPEKLMPFV 1277
            VPPEKLM F+
Sbjct: 1205 VPPEKLMRFI 1214

>CAGL0L12144g Chr12 complement(1304574..1308044) [3471 bp, 1156 aa]
            {ON} similar to uniprot|Q12465 Saccharomyces cerevisiae
            YLR084c
          Length = 1156

 Score =  539 bits (1389), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 372/1103 (33%), Positives = 619/1103 (56%), Gaps = 91/1103 (8%)

Query: 43   FNLQDSTNQSLQLLTSNGFDTLNFVHYNGQQNFTQPIISSSQNHL--IYYSNDTYIRLLD 100
             N   S N  +QLL S   +T N+ +Y GQQNFT    SSSQN L  IYYSN+T +RL  
Sbjct: 2    LNFSSSRNNEIQLLGS--IETFNYYNYQGQQNFTTA--SSSQNELELIYYSNNTLLRLDA 57

Query: 101  IPYSTRIQHIIPYGQDAFILSGTGSLNGFELSNQLVYNLTDLSLTPIFENKLVPEVRTIF 160
            +P    ++HIIP+  D FILSG G+++G ELS Q++ NLT LS  PIFE +L   V++IF
Sbjct: 58   VPTDVEMRHIIPFMDDCFILSGIGTISGIELSRQILLNLTQLSYQPIFEKEL-GMVKSIF 116

Query: 161  KDPDTNLVYFGGNFSYLLPDSNISNG--LIIWDSSSNDTISYEFGGFGSNSVINNILKLN 218
             D +  +VYFGG+ +Y   ++N  +G  ++ W+S++N +    FGGFGSNS +N+I++L 
Sbjct: 117  VDNE--VVYFGGDITY---NNNGVSGRSVVQWNSTTNSSSLLPFGGFGSNSTVNSIIRLE 171

Query: 219  SNDLLFSGQFYTLDDPSILHIPYNITFPNNTSSLLSQQNVSTFELNQRIPLTFGKFSTAD 278
            +N+LLF+GQF  L++ S       ++  N T +       S  E+ Q+I L   + +T +
Sbjct: 172  NNNLLFTGQFAKLENNSF------VSKTNRTRNFSISMEDS--EVGQQISL---RQATWN 220

Query: 279  TNDYINKNQLICPTSEIEAWASDSKAGSLQITLPFSIRPSKIRIFNSPDPDDEVATFRIN 338
             N  ++ +  ICP S+ +AW S+   G +    P ++  SKIRI+N+P  D++++ FR+ 
Sbjct: 221  ANSNLDVDAFICPNSDQQAWYSEGSYGVITCNFPNTLTLSKIRIYNTPITDNQISLFRLI 280

Query: 339  PGNQNSIMSLAYLDPLDGQLKYCSEFCPLYNRNQLKLFNSNDNLKSHVITLLDNNTTDIK 398
                N I++L YLDP+   +K+C+E CPL+ R  L     N   +S VI  ++NN+T+IK
Sbjct: 281  AIPGNGILNLTYLDPISHDIKHCTENCPLFTRETLLNAMGNVTQESDVIRFINNNSTNIK 340

Query: 399  WSTTYQEFAFVNQFDLTTLEFQALSSYGSRVGLSGLSLFQSDIAVFANESYNKPSCNDQT 458
            W+  YQEFAFVNQ  +T+L+F A +SY   VGLSG  ++Q    +F N S+N+P+C    
Sbjct: 341  WNEYYQEFAFVNQLPITSLQFVASNSYYQNVGLSGFQIYQDSFPIFPNNSFNEPNCPSS- 399

Query: 459  AYDNEDLIKAALPRVMGSSYSILSDNDWYTPLPNSDYLACTYLSSSKLIPTVTFYPNLLY 518
                 D+          +SY  LS N W+T   ++ YLA +Y+ +    P++T++  +  
Sbjct: 400  ----NDI----------ASYVKLSGNGWFTVANDNSYLANSYIPNQGTKPSITYFVGINV 445

Query: 519  AGNYTVDMITPGCTADNSCDSRGIVNVTMWNQTDSSILQTSLIYQTNENYKFDQIFNGYL 578
             G Y ++++TPGC  DN+C +RGIVNVT ++ ++ +IL ++LIYQ N N K+DQIF G L
Sbjct: 446  PGEYVLNLVTPGCDKDNTCSTRGIVNVTTFDNSNGNILGSALIYQNNNNLKYDQIFAGVL 505

Query: 579  DPLVKITMSFYSGVYSNTGNFTIVADRINLIINSL--DFVTTTSSNEIDI-YNVTLNGLF 635
            +  + + + +YSG+ +NTG  T+V   ++++  S+  +F+    S++ID   ++ LNG+F
Sbjct: 506  NNSISVQVEYYSGINTNTGTATVVVGVVDVVRVSISSEFI----SDQIDGDRSLHLNGIF 561

Query: 636  QY-PEYNSVNN--LNENYTNSTINQYAYSNYPANVSLIAAAYDKDTLL--VGGSINKLQE 690
            +Y P   + +N  L      + ++ +  SN+    S+ A   +++  L    GS+ +L  
Sbjct: 562  EYSPSNFTFDNGYLTGKIDYTILDDFGVSNFNKGASIFAVDQNQNLYLGSTNGSVYELNS 621

Query: 691  FQIEKNGQNI-SLQNTFKDLNSVTGIVPYSDGLIAYGDIMDSSGSYKAITFTNN--KFGT 747
                 NG ++ S +N    L  + G+    +GL+ +G I      Y A+    +      
Sbjct: 622  L----NGSSVPSTENNLSGL--INGMYSVEEGLVIFGSIAHRGREYGAVILNKSITPLDI 675

Query: 748  LGNFTDEIQSFSNISLTTSWEILSFNNKYFYNQSNMEDFKNTSTFELSLWSAGKNAQNDL 807
            + N  D IQ+  N +L  S  +L F+N   +N ++   F+NTS   L L +AGKN+ +D+
Sbjct: 676  VAN--DSIQASFNSTLFGS-NLLVFDNSTIFNMTSFMVFENTSYRNLDLRNAGKNSNDDM 732

Query: 808  IFSGLVSENENVNLTGVVSINANEQIKELNLGNNIYPYSAVFLNDSSTIYAYMEPNTRLN 867
            +  G +    +      + I++N      +L +N     A++LND+  +Y+    N    
Sbjct: 733  LLVGNIVNKGSAIGNESLLISSNGTYSPFSLSDNDTIEGAIYLNDTKALYSLSSGNVNYF 792

Query: 868  RLIHSNGEQISWSWKNKISSMAFFPNESLLSVGTISDKDVFPSFSILNLTSNKVI---AN 924
            +L  S+ +++ W+W++ +  + +   + LL  G I +        +++L S++VI    N
Sbjct: 793  QL--SDKQRLPWTWQSTVVPVFYSNGQQLL--GAIQENSNKSQIVLIDLFSSQVINDTGN 848

Query: 925  ETLNKNSQISSLLYFTKNSSVLVGGNFTFSDYQCSGLCLFNYETKNWSTFMNNTLEGTVS 984
             T++K   I++++ F  N++ LVGG+F+ S+  C GLCL+NY   NWS+F+NN++ G +S
Sbjct: 849  LTMHK---INAIVNFASNATALVGGDFSLSNPACVGLCLYNYNNSNWSSFLNNSITGNIS 905

Query: 985  KLELKNNSNILISGTLSTNKSANIDLALLNLNTYNVSILLQNTN--LTSFEFTGNQIAAW 1042
            +++  N++ +L+SG L  NK+A+I+L  +NL +    ILL N +  L  F    N +  W
Sbjct: 906  QIKF-NDTQMLLSGKLEVNKTADINLLSINLTSNKQDILLYNNSVVLDDFILVRNLVVGW 964

Query: 1043 NSSTLFQYNNEAWSQILLPNGTESLKLDSISIFDITNKNSSSILEKRALRDTNIMVATGQ 1102
            NS+ +F  N   WS              +++IFD     + + +E         ++  GQ
Sbjct: 965  NSTDIFIRNVTQWS--------------NLNIFDDGTNATINRIENFGADSNPALIIYGQ 1010

Query: 1103 FYSKGLGTVQALYYTSDTWIPYF 1125
            F S   GT+ A+ Y  ++W PYF
Sbjct: 1011 FDSMKYGTINAVIYDFNSWYPYF 1033

 Score = 47.4 bits (111), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 27/70 (38%), Positives = 38/70 (54%), Gaps = 1/70 (1%)

Query: 1206 KQQNKKHKIQRGFVVLIGLALSLATVAXXXXXXXXXXXXXRDS-RGDYESLKPRTTEHEM 1264
            K   K +KI+RGFVVLIGLAL+LAT+                S  GDY+ +K   +++  
Sbjct: 1084 KTNEKPYKIRRGFVVLIGLALALATLIVLGITGVVIALLFNPSVNGDYDIIKTNDSDNFA 1143

Query: 1265 FDAVPPEKLM 1274
               + PEKL+
Sbjct: 1144 GSNITPEKLI 1153

>AGR095W Chr7 (914098..917703) [3606 bp, 1201 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YLR084C (RAX2)
          Length = 1201

 Score =  538 bits (1387), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 405/1315 (30%), Positives = 658/1315 (50%), Gaps = 156/1315 (11%)

Query: 5    IRTILGILLLSVAP--SSVVANQLNHLKDILEIENIPAPQFNLQDSTNQSLQLLTSNGFD 62
            +R  +G L+ ++AP    V  + L  +    +I++   P+ +L  + N+  +LL  + F 
Sbjct: 1    MRLHMG-LVAALAPLGDVVRGSHLESVAQHFDIKHWQTPRLDLSAARNE--RLLVFDDFQ 57

Query: 63   TLNFVHYNGQQNFTQPIISSSQNH----LIYYSNDTYIRLLDIPYSTRIQHIIPYGQDAF 118
               + +Y GQQ FT       + H    LIYYS  TY++L  +   T ++ I+P+G D+F
Sbjct: 58   AFEYYNYKGQQLFT-----GQEQHQGSSLIYYSEGTYVQLAKLDDDTVVRRIVPFGSDSF 112

Query: 119  ILSGTGSLNGFELSNQLVYNLTDLSLTPIFENKLVPEVRTIFKDPDTNLVYFGGNFSYLL 178
            ILSGTG L    L +QL+YNL+ L +T I    L   V  I  D D  +VYFGG F+Y  
Sbjct: 113  ILSGTGKLQDQRLEHQLMYNLSTLEVTEILPQSL-ESVNDILVDGD--MVYFGGQFTY-- 167

Query: 179  PDSNIS-NGLIIWDSSSNDTISYEFGGFGSNSVINNILKLNSNDLLFSGQFYTLDDPSIL 237
             D N S +  + W+++S  T    FGGFG  S +NNILKL+ + +LF G+F  L+  S  
Sbjct: 168  SDGNKSGHSAVQWNATSRTTSLLPFGGFGRGSSVNNILKLSGSGVLFVGRFSNLEAAS-- 225

Query: 238  HIPYNITFPNNTSSLLSQQNVSTFELNQRIPLTFGKFSTADTNDYINKNQLICPTSEIEA 297
               Y  T     S+   Q NV+T E N    LT  ++ST  ++ +++K + ICPTS  ++
Sbjct: 226  ---YAETASVLASTEKPQLNVTTIETNA---LTSLRYSTITSDGHLDKGKFICPTSNDDS 279

Query: 298  W----ASDSKA-GSLQITLPFSIRPSKIRIFNSPDPDDEVATFRINPGNQNSIMSLAYLD 352
            W    + D  A G L I +   I PSKIRI+NS    +E+  FRI      SIM++ Y+D
Sbjct: 280  WFVPHSGDGPARGELNIKVLHRIIPSKIRIYNSKKNGNEIKLFRIVTSPSQSIMNMTYID 339

Query: 353  PLDGQLKYCSEFCPLYNRNQLKLFNSNDNLKSHVITLLDNNTTDIKWSTTYQEFAFVNQF 412
            P  G+L  C  +CPL  R+ L    + ++  + V  L+++    IKW+  YQEFAF+NQ 
Sbjct: 340  PNTGELATCDAWCPLMPRSNLT-SKAAESGPADVARLVNDEKVLIKWTPDYQEFAFINQI 398

Query: 413  DLTTLEFQALSSYGSRVGLSGLSLFQSDIAVFANESYNKPSCNDQTAYDNEDLIKAALPR 472
             +  ++F AL SYG+ VGL G+ LFQ++   + N + N+P+C +Q               
Sbjct: 399  HMEEIKFIALDSYGNNVGLVGVELFQTEYDAYVNSTLNQPNCGEQQL------------- 445

Query: 473  VMGSSYSILSDNDWYTPLPNSDYLACTYLSSSKLIPTVTFYPNLLYAGNYTVDMITPGCT 532
               S +S  + N W+    ++ YL+   + S+   P V   P + ++G YT+++ TPGC 
Sbjct: 446  ---SPFSTTA-NIWHQGATDASYLSANVVESN---PMVNVKPVIPHSGTYTLNLYTPGCE 498

Query: 533  ADNSCDSRGIVNVTMWNQTDSSILQTSLIYQTNENYKFDQIFNGYLDPLVKITMSFYSGV 592
             D +CD RGIVNVT+   ++ + L T  IYQ N   K+D ++ G+LDP   + M + S +
Sbjct: 499  DDGTCDYRGIVNVTLL-ASNGTTLMTRWIYQNNYRLKYDPLYTGHLDPNPTVRMEWVSPI 557

Query: 593  YSNTGNFTIVADRINLIINSLDFVTTTSSNEIDIYNVTLNGLFQY-PEYNSVNNLNENYT 651
             S      +VADR++ II+SLD +             +LNGLFQY P  +S++N  + Y 
Sbjct: 558  NSAVNRKIMVADRVSAIIDSLDGLDDIRHPR----EKSLNGLFQYTPAGSSLDNGIQKY- 612

Query: 652  NSTINQYAYSNYPANVSLIAAAYDKDTLLVG----GSINKLQEFQIEKNGQNISLQNTFK 707
               IN+   ++ P  VSL+   YD   L++G    G I  +     + N  +++ Q+   
Sbjct: 613  ---INKDPQTDMPEGVSLVGQVYD-GKLILGVKSTGHIAVVTPKGTDWNDVDVTRQDVPG 668

Query: 708  DLNSVTGIVPYSDGLIAYGDIMDSSGSYKAITFTNNKFGTLGNFTDEIQSFSNISLTTSW 767
             LN   GI PYS GL+  G    SSG   A+ +  N FG+  +   E  S  N+++  S 
Sbjct: 669  SLN---GISPYSKGLVFTGKFNLSSGPSSALHYDGN-FGSFFDLNSETSSIINMTIDGS- 723

Query: 768  EILSFNNKYFYNQSNMEDFKNTSTFELSLWSAGKNAQNDLIFSGLVSENENVNLTGVVSI 827
            E+L FNNK+ YN S  +    +S F+LS  SA  N+ NDL+F+G +++ ++ +  G V++
Sbjct: 724  ELLLFNNKFIYNTSTSQ-MLTSSMFQLSALSAAANSNNDLLFTGSIADIKHGSAHGAVAL 782

Query: 828  NANEQIKELNLGNNIYP-------YSAVFLNDSSTIYAY--MEPNTRL---NRLIHSNGE 875
            +A     E N+  +  P       +  V+LND++T YAY  + PN+ +     +I + G 
Sbjct: 783  DA-----EGNIFTSGTPSISGARVHRGVYLNDTATAYAYYSVSPNSSVATGGVVIETPGN 837

Query: 876  QISWSWKNKISS---MAFFPNESLLSVGTISDKDVFPSFSILNLTSNKVIANETLNKNSQ 932
              + S  N I++   M +    + L + T   +    +  + +L + + +A E LN   +
Sbjct: 838  NFNLS--NNIATVREMIYVKKTNFLVISTNEVEGTPGALILYDLRTLQEVAREKLNPGER 895

Query: 933  ISSLLYFTKNSSVLVGGNFTFSDYQCSGLCLFNYETKNWSTFMNNTLEGTVSKLELKNNS 992
            I+S++ F +++++LVGG  +F    C  LCL+N+  ++WS F +  + G + +L+  NN 
Sbjct: 896  INSIVLFGEDNTLLVGG--SFEKDGCHDLCLYNFVKRSWSAFASGLISGEIKQLQFVNNR 953

Query: 993  NILISGTLSTNKSANIDLALLNLNTYNVSILLQNTNLTSFEF--------TGNQIAAWNS 1044
            N++  G+++     NI    LN +     ++ Q+       F        +G++  A + 
Sbjct: 954  NLIAVGSMTVQSRPNI--LFLNFDLVRSRVVEQHEQPNGRAFNSVLTIGDSGDEYVAEDG 1011

Query: 1045 STLFQYNNEAWSQILLPNGTESLKLDSISIFDITNKNSSSILEKRALRDTNIMVATGQFY 1104
              ++ Y+   W  +   +G + +++D IS+  + N  S +   KR      ++V  GQ  
Sbjct: 1012 KQVWHYSGSEWKTVTPLSGGQ-IRIDGISLLMLNNPRSQN---KRNRVGNELVVIHGQMN 1067

Query: 1105 SKGLGTVQALYYTSDTWIPYFYGNLTNNMDTSN--SINIFPNKDISSKIISDFVLKNWNF 1162
            S   G + A++Y  + W PY++   ++  +  N     IF N+DIS +  +   L+    
Sbjct: 1068 SSEYGEINAMHYNFENWEPYYFTIGSSAREEFNVPRGQIFLNQDISRQTTTSLPLE---- 1123

Query: 1163 NLSDVGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIIPIIGKQQNKKHKIQRGFVVLI 1222
                                                 ++         K K+ +G+VVLI
Sbjct: 1124 ------------------------------------VVVSDSPPTAEPKRKLAKGYVVLI 1147

Query: 1223 GLALSLATVAXXXXXXXXXXXXXRDSRGDYESLKPRTTEHEMFDAVPPEKLMPFV 1277
             L L+LAT+A              D    Y+ LKPR  E EM   VPPEKLM F+
Sbjct: 1148 ALGLALATIALLGIIGVILAYAFGDHNA-YQPLKPRINEDEMLKTVPPEKLMKFI 1201

>KLLA0F18975g Chr6 complement(1739543..1743145) [3603 bp, 1200 aa]
            {ON} similar to uniprot|Q12465 Saccharomyces cerevisiae
            YLR084C RAX2 N-glycosylated protein involved in the
            maintenance of bud site selection during bipolar budding
            localization requires Rax1p
          Length = 1200

 Score =  533 bits (1373), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 372/1140 (32%), Positives = 613/1140 (53%), Gaps = 95/1140 (8%)

Query: 11   ILLLSVAPSSVVANQLNHLKDILEIENIPAPQFNLQDSTNQSLQLLTSNGFDTLNFVHYN 70
            I +L V    V  +QL++++ +L I    AP ++  D       L   N F+ L  + Y 
Sbjct: 8    IYVLLVLAGMVRGSQLSNIEKLLNISRYEAPNWDSPD-------LTYMNNFEELTVISYT 60

Query: 71   GQQNFTQPIISSSQNHLIYYSNDTYIRLLDIPYSTRIQHIIPYGQDAFILSGTGSLNGFE 130
            GQQNFT   + ++++ L+YYSNDT+++L +    T +  I+P  +D+FILSGTG +NG  
Sbjct: 61   GQQNFT---VQANESSLLYYSNDTFVKLFETSPETTVTMIVPLFEDSFILSGTGQINGVA 117

Query: 131  LSNQLVYNLTDLSLTPIFENKLVPEVRTIFKDPDTNLVYFGGNFSYLLPDSNISNGLIIW 190
            L  Q++ NLT L+ +PIF +  V  V  I    +T  V F GNFS  + +    +G ++W
Sbjct: 118  LEQQILLNLTSLTTSPIFPSA-VENVMDILTVNET--VIFVGNFSMSVSNET-GHGAVLW 173

Query: 191  DSSSNDTISYEFGGFGSNSVINNILKLNSNDLLFSGQFYTLDDPSILHIPYNITFPNNTS 250
            D  +N T  + F GFG NS++N+++KLNS+++LF+G F  + + S+L       F N T+
Sbjct: 174  DVVANTTELFPFKGFGENSIVNSVVKLNSDNILFAGSFQEIQNASLLQ-----EFGNATN 228

Query: 251  SLLSQQNVSTFELNQRIPLTFGKFSTADTNDYINKNQLICPTSEIEAW-ASDSKAGSLQI 309
            S  S +++++ + +Q +PL         T + +  + L+CP+     W AS++   +LQ 
Sbjct: 229  S--SHEDLTSLQFDQSVPLKLSSI----TGENVQSDILLCPSGGQNGWSASEAVQSTLQF 282

Query: 310  TLPFSIRPSKIRIFNSPDPDDEVATFRINPGNQNSIMSLAYLDPLDGQLKYCSEFCPLYN 369
             L   I PSK+RI+NS + + E++ FRI  G  N IM+L YLDP  G+LK C  +CPL +
Sbjct: 283  DLKNEIHPSKVRIYNSVEENSEISLFRIITGPSNGIMNLTYLDPASGELKQCDAWCPLLS 342

Query: 370  RNQLKLFNSNDNLKSHVITLLDNNTTDIKWSTTYQEFAFVNQFDLTTLEFQALSSYGSRV 429
               L   + N       + + +NN+T++KWS +YQEFAFVN   +T L+F AL+SYGS  
Sbjct: 343  IEDLTQISQNSTAAPKSVGI-NNNSTNLKWSESYQEFAFVNDIPVTMLQFVALASYGSNA 401

Query: 430  GLSGLSLFQSDIAVFANESYNKPSCNDQTAYDNEDLIKAALPRVMGSSYSILSDNDWYTP 489
             L  + +F+++  V+AN SYN+P+C   T Y   +L                S ++WYT 
Sbjct: 402  ALHSIEIFETEFMVYANNSYNEPNCESVTEYSKAEL----------------SSDNWYTT 445

Query: 490  LPNSDYLACTYLSSSKLIPTVTFYPNLLYAGNYTVDMITPGCTADNSCDSRGIVNVTMWN 549
              +  Y++     +   IP VTF+PN+ Y G YT ++ TPGC  DNSC  RGIVNVTM +
Sbjct: 446  DESDTYISTNIDDN---IPYVTFHPNITYPGRYTFNIYTPGCLQDNSCSKRGIVNVTMID 502

Query: 550  QTDSSILQTSLIYQTNENYKFDQIFNGYLDPLVKITMSFYSGVYSNTGNFTIVADRINLI 609
            ++ + +L + LIYQTN   KFD ++ G L    +I +++   +     +  +V DR+ +I
Sbjct: 503  RSINEVLASVLIYQTNNEDKFDPLYTGSLGSAPEIIVTWDKAI--GESDSVMVVDRLGVI 560

Query: 610  INSLDFVTTTSSNEIDIYNVTLNGLFQYPEYNSVNNLNENYTNSTINQYAYSNYPANVSL 669
               +D + + SSN+   +   LNGLFQY   N   ++    TN T N YA  N+P + +L
Sbjct: 561  TEYIDTI-SISSNDTTFH---LNGLFQYNTANVTASIFS--TNDTFNDYALYNFPLDANL 614

Query: 670  IAAAYDKDTLLVGGSINKLQEFQIEKNGQNISLQNTFKDLNSVTGIVPYSDGLIAYGDI- 728
             AA+ + D +L+GG+ N + + ++      IS           TGI  YS+GL+  G   
Sbjct: 615  YAASLNND-ILIGGNFNGIAKVELNDEAL-ISSSQKLGTSGYTTGIFEYSNGLLLSGTYQ 672

Query: 729  MDSSGSYKAITFTNNKFGTLGNFTDEIQSFSNISLTTSWEILSFNNKYFYNQSNMEDFKN 788
            +++   ++ +++  N F + G   + I    N ++    E+L F+N Y +N S      N
Sbjct: 673  VENDSRHEILSYDGNAFNSFGQLDEPIDRIVNFTI-DGHELLLFDNAYIFNVSANMYVSN 731

Query: 789  TSTFELSLWSAGKNAQNDLIFSGLVSENENVNLTGVVSINANEQIKE---LNLGNNIYPY 845
            +STFE++  SAG N+ ND +  G   +     L G+ S++++ Q+       L  ++ PY
Sbjct: 732  SSTFEITGQSAGINSGNDSLLFGSFLKRSVGELNGLASLSSDGQVSSPTLPELPTDVQPY 791

Query: 846  SAVFLNDSSTIYAYMEPNTR--LNRLI----HSNGEQISWSWKNKISSMAFFPNESLLSV 899
             A ++ND+S  YA  E +T    +R++    +S+   +   W   I++  +    ++L++
Sbjct: 792  KAAYINDTSAAYALQEGSTDNVQHRVLITNTNSSSHMLQIQWSAPINAFLYDNVPNILAI 851

Query: 900  GT-----ISDKDVFPSFSILNLTSNKVIANETLNKNSQISSLLYFTKNSSVLVGGNFTFS 954
            GT      S  DV   FSILNLT  + +A    + N +++S++ F+ N+S+LVGG++   
Sbjct: 852  GTNGSNSSSQYDV--QFSILNLTGYENVARVNFSTNERVNSMVSFSSNNSILVGGSYEID 909

Query: 955  DYQCSGLCLFNYETKNWSTFMNNTLEGTVSKLELKNNSN-ILISGTLSTNKSANIDLALL 1013
            +  C+ LCL+NY+TK W++F+N+++ G + +++  +    +L+ G + TN  +NI L  +
Sbjct: 910  N--CNDLCLYNYQTKEWTSFLNDSITGDIRQMQFADEGKTLLVGGLIKTNNESNIQLLSV 967

Query: 1014 NLNTYNVSILLQNTN-LTSF----EFTGNQIAAWNSSTLFQYNNEAWSQILLPNGTESLK 1068
             + +   S +   T  L SF    + T N IA  NS  L +  +  WS          L 
Sbjct: 968  EVGSNIFSTVKSGTEPLLSFVPIDDSTDNIIAQMNSEIL-RLESGTWSSF-----GPQLN 1021

Query: 1069 LDSI-SIFDITNKNSSSILEKRALRDTNIMVATGQFYSKGLGTVQALYYTSDT--WIPYF 1125
             DSI S F + +   S    K+    ++I++  G   S   G + ++ Y   T  W PYF
Sbjct: 1022 NDSIVSGFKVLSGTES----KKRDEGSHIVLLEGTLNSSEWGNLTSVVYDGSTQKWQPYF 1077

 Score = 72.8 bits (177), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 43/68 (63%), Gaps = 1/68 (1%)

Query: 1210 KKHKIQRGFVVLIGLALSLATVAXXXXXXXXXXXXXRDSRGDYESLKPRTTEHEMFDAVP 1269
            K  KI RGF+VLIGLAL+LATVA              ++ G YESLKPR  + EM D VP
Sbjct: 1134 KDKKIDRGFIVLIGLALALATVAVIGLIGALICYFFINNNG-YESLKPRINQDEMLDTVP 1192

Query: 1270 PEKLMPFV 1277
            PEKLM F+
Sbjct: 1193 PEKLMKFI 1200

>Ecym_4315 Chr4 (679627..683265) [3639 bp, 1212 aa] {ON} similar to
            Ashbya gossypii AGR095W
          Length = 1212

 Score =  524 bits (1350), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 385/1183 (32%), Positives = 625/1183 (52%), Gaps = 89/1183 (7%)

Query: 11   ILLLSVAPSSVVANQLNHLKDILEIENIPAPQFNLQDSTNQSLQLLTSNGFDTLNFVHYN 70
            +L+LS        +Q+N + +   I    AP  +L  ST ++ QLL  + F T ++  Y 
Sbjct: 8    LLVLSFVAGLAQGSQINGVVNHFNITQYTAPHLDL--STVRNSQLLIFDDFQTFDYYTYK 65

Query: 71   GQQNFTQPIISSSQNHLIYYSNDTYIRLLDIPYSTRIQHIIPYGQDAFILSGTGSLNGFE 130
            GQQ FT  +    +N LIYYSN+TY++L ++P    I+ I+P+G D+FILSG G   G  
Sbjct: 66   GQQIFTG-LADERKNSLIYYSNNTYVQLAELPDGAEIKKIVPWGDDSFILSGRGVFEGHR 124

Query: 131  LSNQLVYNLTDLSLTPIFENKLVPEVRTIFKDPDTNLVYFGGNFSYLLPDSNIS-NGLII 189
            L +QL+YNL+   +T I +  L   V  I  D +  +VYFGG F+Y   D N+S + ++ 
Sbjct: 125  LEHQLIYNLSSFEITEILKEPL-EHVNDILTDGE--VVYFGGGFTY--NDGNLSGHSVVK 179

Query: 190  WDSSSNDTISYEFGGFGSNSVINNILKLNSNDLLFSGQFYTLDDPSILHIPYNITFPNNT 249
            WD++   +    F GFG  SV+NNI+KL+ +++LF G+F T+D+ ++L  P+     N +
Sbjct: 180  WDATDKSSSLLPFYGFGQGSVVNNIIKLDDSNILFVGKFSTIDNTALL--PHR----NVS 233

Query: 250  SSLLSQQNVSTFELNQRIPLTFGKFSTADTNDYINKNQLICPTSEIEAWA-SDSKAGSLQ 308
            SS LS  N +  E N    L   +FS+   +  +N +  +CP    ++W    S  G L 
Sbjct: 234  SSFLS--NSTNIETNALASL---RFSSLVHDGTLNSSAFVCPEGSADSWTIPHSTMGELT 288

Query: 309  ITLPFSIRPSKIRIFNSPDPDDEVATFRINPGNQNSIMSLAYLDPLDGQLKYCSEFCPLY 368
            I +   + PSKIRI+NS D +++V  FRI      SIM++ Y+DP+ G L  C  +CPL 
Sbjct: 289  IRVINQMTPSKIRIYNSKDSNNQVNLFRIVTSPSRSIMNMTYVDPITGALAVCDAWCPLQ 348

Query: 369  NRNQLKLFNSNDNLKSHVITLL-DNNTTDIKWSTTYQEFAFVNQFDLTTLEFQALSSYGS 427
              + L   N  +N  S V+    +NN   +KW+  YQEFAFVN+  +  L F A+ S+G 
Sbjct: 349  PLSVLS--NLAENSTSSVMAAFPNNNNVLVKWTAAYQEFAFVNRVPIQELTFIAIDSFGH 406

Query: 428  RVGLSGLSLFQSDIAVFANESYNKPSCNDQTAYDNEDLIKAALPRVMGSSYSILSDNDWY 487
             VGL G+ LFQ++   + N + N+P+C+ Q  +    + K               D  WY
Sbjct: 407  NVGLLGIELFQAEYDTYVNNTLNQPNCDSQQNFPASVVSK---------------DTVWY 451

Query: 488  TPLPNSDYLACTYLSSSKLIPTVTFYPNLLYAGNYTVDMITPGCTADNSCDSRGIVNVTM 547
              LP+  Y+A ++ +     P+VT  P++ Y G YT++++TPGC  DN+C  RGIVNVT+
Sbjct: 452  QGLPDQSYMATSFTAGK---PSVTLTPSIPYPGIYTLNLVTPGCLTDNTCAFRGIVNVTI 508

Query: 548  WNQTDSSILQTSLIYQTNENYKFDQIFNGYLDPLVKITMSFYSGVYSNTGNFTIVADRIN 607
              Q  + ++    IYQ NEN K+D +F GYLD    + + +   +     N  +VADR+ 
Sbjct: 509  RAQNGTHLMN-RWIYQNNENLKYDPLFRGYLDDSPNVVLEWIGPIDPAAANNVMVADRVT 567

Query: 608  LIINSLDFVTTTSSNEIDIYNVT-----LNGLFQYPEYNSVN-NLNENYTNSTINQYAYS 661
             II+S++        ++++ N T     LNGLFQY   N  N NL+    ++ I+QY   
Sbjct: 568  SIIDSIE--------DLEMKNGTSNSNLLNGLFQYAASNFTNTNLSTLVGSTNIDQYPVR 619

Query: 662  NYPANVSLIAAAYDKDTLLVGG-SINKLQEFQIEKNGQN-ISLQNTFKDLNS-VTGIVPY 718
            N P + SL    Y+ DTL +G  SI+ L +    K+  N I +     D    VTGI PY
Sbjct: 620  NIPHSSSLFGQIYN-DTLFIGSPSIDGLAKISRRKDDWNDIIVDPQLIDTEGPVTGIFPY 678

Query: 719  SDGLIAYGDIMDSSGSYKAITFTNNKFGTLGNFTDEIQSFSNISLTTSW-EILSFNNKYF 777
            S+GL A     + +    +++F N    T+  F     S S ++LT    EIL F+N Y 
Sbjct: 679  SNGL-ALTVHSNQTNMASSLSF-NGSISTI--FRSNAPSLSILNLTIDGSEILVFDNGYV 734

Query: 778  YNQSNMEDFKNTSTFELSLWSAGKNAQNDLIFSGLVSENENVNLTGVVSINA--NEQIKE 835
            YN S+  D  N+ T +LSL SAG N ++DLI +G V   ++    G ++I+A  NE +  
Sbjct: 735  YNVSSQSDISNSETLKLSLLSAGANLEDDLILAGNVQSTKHFVPNGAIAIDADSNEVVTS 794

Query: 836  -LNLGNNIYPYSAVFLNDSSTIYAYMEP---NTRLNRLIHSNGEQISWSWKNK-ISSMAF 890
             L   ++   Y  +F+NDSS+ YAY      +++   +++   E    S  +  ++ M +
Sbjct: 795  GLPSVDDGIIYRGLFINDSSSAYAYYSKSLGSSKGGIVVYGEHEPEYLSTDDSTVNDMLY 854

Query: 891  FPNESLLSVGTISDKDVFPSFSILNLTSNKVIANETLNKNSQISSLLYFTKNSSVLVGGN 950
              + +LL+V T        S  I +L+++     ET      I++++ F +N ++LVGG 
Sbjct: 855  IKDSNLLAVVTSGTSQGLASLYIHDLSADFAPIKETFEIGEVINTMVLFGRNYTLLVGGT 914

Query: 951  FTFSDYQCSGLCLFNYETKNWSTFMNNTLEGTVSKLELKNNSNILISGTLSTNKSANIDL 1010
            FT +   C  LCL+NY T NW+ FM+  + G + +L+  + + ++++G L+++ S ++ L
Sbjct: 915  FTRNG--CRDLCLYNYATNNWTRFMDGNITGDIRQLQFLDGNTLMVAGLLASSDSKDLQL 972

Query: 1011 ALLNLNTYNVSILLQNTNLTSFEF---TGN---QIAAWNSSTLFQYNNEAWSQILLPNGT 1064
              ++L+   +   LQ TN  +F+     GN   ++ A + + +F + +  W  I  P+ +
Sbjct: 973  VEIDLSNMEIISKLQGTNTGTFQHVLTVGNSSSELIAHDGNQVFHFVDGQWKNI-SPDTS 1031

Query: 1065 ESLKLDSISIF--DITNKNSSSILEKRALRDTNIMVATGQFYSKGLGTVQALYYTSDTWI 1122
               +++ +++   D + +NS   + KR      ++V  G F S   G + A+YY  + W 
Sbjct: 1032 GQTQINGLTLLSTDFSQRNS---IMKRDRVGNELVVINGNFSSPDYGDINAMYYDFNGWN 1088

Query: 1123 PYFYG--NLTNNMDTSNSINIFPNKDISSKIISDFVLKNWNFN 1163
            PY++     +N+ +      +F NKD+S    S   L N N N
Sbjct: 1089 PYYFSVPRESNSDEVIPQGQLFLNKDVSFTSSSQIYLSNDNDN 1131

 Score = 43.1 bits (100), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 17/26 (65%), Positives = 18/26 (69%)

Query: 1252 YESLKPRTTEHEMFDAVPPEKLMPFV 1277
            YE LKPR  E EM   VPPEKLM F+
Sbjct: 1187 YEPLKPRINEAEMLKTVPPEKLMKFI 1212

>Ecym_8369 Chr8 complement(739539..745227,745354..745367) [5703 bp,
           1900 aa] {ON} similar to Ashbya gossypii ADL033W
           1-intron
          Length = 1900

 Score = 37.0 bits (84), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 30/104 (28%), Positives = 46/104 (44%), Gaps = 16/104 (15%)

Query: 59  NGFDTLNFVHYNGQQNFTQPIISSSQNHLIYYSNDTYIRLLDIPYSTRIQHIIPYGQDAF 118
           N  + +    Y GQ +F  P+IS+  N L              P    + H IP G    
Sbjct: 331 NAIEIMCLGLYVGQNDFEAPLISTLANVL--------------PGVCTLSHPIPPGVIET 376

Query: 119 ILSGTGSLNGF--ELSNQLVYNLTDLSLTPIFENKLVPEVRTIF 160
           ++S    LN F  ELS QL+Y   ++  +P   ++ V ++ TIF
Sbjct: 377 VISAASLLNFFSEELSAQLLYAFPNVVSSPQITSENVSKISTIF 420

>AGR059C Chr7 complement(827087..827941) [855 bp, 284 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR123C
           (INO2)
          Length = 284

 Score = 33.1 bits (74), Expect = 3.9,   Method: Composition-based stats.
 Identities = 31/108 (28%), Positives = 46/108 (42%), Gaps = 6/108 (5%)

Query: 5   IRTILGILLLSVAPSSVVANQLNHLKDILEIENIPAPQFNLQDSTNQSLQLLTSNGFDTL 64
           +R +L   LLSV  S  + N LN L    +   +PAPQ +L +ST Q+   L+   F   
Sbjct: 77  VRGMLPHNLLSVDESYAIENFLNSLMPSPK-STLPAPQLHLDESTLQTEPSLSHTAFSPP 135

Query: 65  NFVHYNGQQNFTQPIISSSQNHLIYYSNDTYIRLLDIPYSTRIQHIIP 112
           +       Q      +S   N+  Y  N   +  + IP     +H IP
Sbjct: 136 SLTPATLSQPTLPEPVSEDANNDDYRPNPISLPEIKIP-----EHEIP 178

>Kwal_23.5277 s23 complement(1088250..1089662) [1413 bp, 470 aa]
           {ON} YNL295W - Hypothetical ORF [contig 8] FULL
          Length = 470

 Score = 32.7 bits (73), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 17/63 (26%), Positives = 30/63 (47%)

Query: 683 GSINKLQEFQIEKNGQNISLQNTFKDLNSVTGIVPYSDGLIAYGDIMDSSGSYKAITFTN 742
           G++ K++    +  GQ I++Q+  KDL S    VP  D  IA   ++    S   + + +
Sbjct: 127 GTLTKIKRATEDSKGQEINIQSILKDLQSEDPEVPAKDSDIAEKAVIPWDASISGMVYND 186

Query: 743 NKF 745
             F
Sbjct: 187 EPF 189

>AGR113W Chr7 (950399..956863) [6465 bp, 2154 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YER172C (BRR2)
          Length = 2154

 Score = 32.3 bits (72), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 30/61 (49%), Gaps = 3/61 (4%)

Query: 1089 RALRDTNIMV---ATGQFYSKGLGTVQALYYTSDTWIPYFYGNLTNNMDTSNSINIFPNK 1145
            R L + N++V    TG   S  LG + + YY S T I  + G L  ++D  + + +F   
Sbjct: 980  RLLHENNLIVYNPVTGDVQSTDLGRIASQYYISYTTIATYNGELNMHLDQMDILRLFAKS 1039

Query: 1146 D 1146
            D
Sbjct: 1040 D 1040

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.132    0.381 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 149,278,821
Number of extensions: 7565185
Number of successful extensions: 29464
Number of sequences better than 10.0: 278
Number of HSP's gapped: 30229
Number of HSP's successfully gapped: 331
Length of query: 1278
Length of database: 53,481,399
Length adjustment: 121
Effective length of query: 1157
Effective length of database: 39,606,813
Effective search space: 45825082641
Effective search space used: 45825082641
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 72 (32.3 bits)