Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0E043808.255ON88988939040.0
NCAS0B038808.255ON70662314460.0
YDR108W (TRS85)8.255ON69862114240.0
Suva_2.2688.255ON69562514170.0
NDAI0J014108.255ON71662214130.0
Kpol_392.118.255ON67562514060.0
TDEL0F038208.255ON68765113900.0
KAFR0B055708.255ON66962113861e-180
Skud_4.3698.255ON69862113831e-180
Smik_4.3548.255ON69863713831e-180
ZYRO0C01826g8.255ON69964013611e-176
TPHA0B032608.255ON71462113321e-172
CAGL0B01705g8.255ON67261613241e-171
KLTH0G13860g8.255ON70864813021e-167
Kwal_56.235838.255ON70064212351e-157
SAKL0H17226g8.255ON71966212051e-153
KNAG0H032708.255ON64865411191e-141
Ecym_43168.255ON6236209431e-115
AGR096C8.255ON6236209121e-111
KLLA0F18953g8.255ON6476278461e-101
Kpol_538.347.31ON40592920.024
Ecym_81695.363ON101968743.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0E04380
         (889 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0E04380 Chr5 (1112393..1115062) [2670 bp, 889 aa] {ON} Anc_8...  1508   0.0  
NCAS0B03880 Chr2 complement(691369..693489) [2121 bp, 706 aa] {O...   561   0.0  
YDR108W Chr4 (671269..673365) [2097 bp, 698 aa] {ON}  TRS85Subun...   553   0.0  
Suva_2.268 Chr2 (465716..467803) [2088 bp, 695 aa] {ON} YDR108W ...   550   0.0  
NDAI0J01410 Chr10 complement(323873..326023) [2151 bp, 716 aa] {...   548   0.0  
Kpol_392.11 s392 complement(30871..32898) [2028 bp, 675 aa] {ON}...   546   0.0  
TDEL0F03820 Chr6 (699240..701303) [2064 bp, 687 aa] {ON} Anc_8.2...   540   0.0  
KAFR0B05570 Chr2 complement(1140432..1142441) [2010 bp, 669 aa] ...   538   e-180
Skud_4.369 Chr4 (642869..644965) [2097 bp, 698 aa] {ON} YDR108W ...   537   e-180
Smik_4.354 Chr4 (632598..634694) [2097 bp, 698 aa] {ON} YDR108W ...   537   e-180
ZYRO0C01826g Chr3 complement(143874..145973) [2100 bp, 699 aa] {...   528   e-176
TPHA0B03260 Chr2 complement(749568..751712) [2145 bp, 714 aa] {O...   517   e-172
CAGL0B01705g Chr2 (157245..159263) [2019 bp, 672 aa] {ON} highly...   514   e-171
KLTH0G13860g Chr7 complement(1201656..1203782) [2127 bp, 708 aa]...   506   e-167
Kwal_56.23583 s56 (607721..609823) [2103 bp, 700 aa] {ON} YDR108...   480   e-157
SAKL0H17226g Chr8 complement(1526848..1529007) [2160 bp, 719 aa]...   468   e-153
KNAG0H03270 Chr8 complement(609643..611589) [1947 bp, 648 aa] {O...   435   e-141
Ecym_4316 Chr4 complement(683492..685363) [1872 bp, 623 aa] {ON}...   367   e-115
AGR096C Chr7 complement(917898..919769) [1872 bp, 623 aa] {ON} S...   355   e-111
KLLA0F18953g Chr6 (1737522..1739465) [1944 bp, 647 aa] {ON} simi...   330   e-101
Kpol_538.34 s538 complement(75072..76289) [1218 bp, 405 aa] {ON}...    40   0.024
Ecym_8169 Chr8 (355430..355444,355614..358658) [3060 bp, 1019 aa...    33   3.6  

>TBLA0E04380 Chr5 (1112393..1115062) [2670 bp, 889 aa] {ON}
           Anc_8.255 YDR108W
          Length = 889

 Score = 1508 bits (3904), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 755/889 (84%), Positives = 755/889 (84%)

Query: 1   MPFSYENYMNLLFHLDRTNEEIPTDIAKRIVQNSIAPLISVTATPELDKHVQDSYNIDSL 60
           MPFSYENYMNLLFHLDRTNEEIPTDIAKRIVQNSIAPLISVTATPELDKHVQDSYNIDSL
Sbjct: 1   MPFSYENYMNLLFHLDRTNEEIPTDIAKRIVQNSIAPLISVTATPELDKHVQDSYNIDSL 60

Query: 61  YMLLRYFGGCISDRDQYHEPHHQHPNELDHKNELHAALISPDTSITETPDTSMDMLIDNS 120
           YMLLRYFGGCISDRDQYHEPHHQHPNELDHKNELHAALISPDTSITETPDTSMDMLIDNS
Sbjct: 61  YMLLRYFGGCISDRDQYHEPHHQHPNELDHKNELHAALISPDTSITETPDTSMDMLIDNS 120

Query: 121 MNXXXXXXXXXXXXXXXXXXXXXASPTTEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 180
           MN                     ASPTTE                               
Sbjct: 121 MNTLTKEETIISTTTGTPTPTILASPTTENTITKPHNKTTTIKKNTKEHYTTTHNYTHHH 180

Query: 181 RQKTRKRSNSLFQRDSTQSQYIRFTKPIPDLVNTRDPTDSLFDHQSLETLLKGYLKIIET 240
           RQKTRKRSNSLFQRDSTQSQYIRFTKPIPDLVNTRDPTDSLFDHQSLETLLKGYLKIIET
Sbjct: 181 RQKTRKRSNSLFQRDSTQSQYIRFTKPIPDLVNTRDPTDSLFDHQSLETLLKGYLKIIET 240

Query: 241 NTTPDMPHNALKKSLYHRFFSMTVTSTTNLCPFESFDHPIVSLLSIDLTLNQNYDTAKEM 300
           NTTPDMPHNALKKSLYHRFFSMTVTSTTNLCPFESFDHPIVSLLSIDLTLNQNYDTAKEM
Sbjct: 241 NTTPDMPHNALKKSLYHRFFSMTVTSTTNLCPFESFDHPIVSLLSIDLTLNQNYDTAKEM 300

Query: 301 LIKFKNIHSKTPNFPVYLNINDILPVFLLCYDASSPEQLDIAKKISTKIKKQLFFESILL 360
           LIKFKNIHSKTPNFPVYLNINDILPVFLLCYDASSPEQLDIAKKISTKIKKQLFFESILL
Sbjct: 301 LIKFKNIHSKTPNFPVYLNINDILPVFLLCYDASSPEQLDIAKKISTKIKKQLFFESILL 360

Query: 361 PLWNDKIYNNDKFVKLHEPMMSSVDETLYFLQQYLQKNSCVTDNKLPLSLVKYIYEMIAN 420
           PLWNDKIYNNDKFVKLHEPMMSSVDETLYFLQQYLQKNSCVTDNKLPLSLVKYIYEMIAN
Sbjct: 361 PLWNDKIYNNDKFVKLHEPMMSSVDETLYFLQQYLQKNSCVTDNKLPLSLVKYIYEMIAN 420

Query: 421 LSVNLIIPFMQRKIRFWDETILQPRKSIFRNKLFKSFMNRXXXXXXXXXXXXXXXXXXXX 480
           LSVNLIIPFMQRKIRFWDETILQPRKSIFRNKLFKSFMNR                    
Sbjct: 421 LSVNLIIPFMQRKIRFWDETILQPRKSIFRNKLFKSFMNRNSNVSSSTGTSSSEISNSIS 480

Query: 481 XXXXXLLTKDSNGHEYFSALSTEFQLRKLADWSMMVSDFKTAYTTYESLSRDLENTSKYM 540
                LLTKDSNGHEYFSALSTEFQLRKLADWSMMVSDFKTAYTTYESLSRDLENTSKYM
Sbjct: 481 KHHHSLLTKDSNGHEYFSALSTEFQLRKLADWSMMVSDFKTAYTTYESLSRDLENTSKYM 540

Query: 541 ASCLEWWAVSILMGAQNIVTAKMLKNDVDPLIESALESYEKPLPPVXXXXXXXXXXXXXX 600
           ASCLEWWAVSILMGAQNIVTAKMLKNDVDPLIESALESYEKPLPPV              
Sbjct: 541 ASCLEWWAVSILMGAQNIVTAKMLKNDVDPLIESALESYEKPLPPVPNSRLPSNNINSLN 600

Query: 601 XXXXXXXATKAEVSLIENNHTIRSYEIRCMXXXXXXXXXXXDTWTSTPYALRYLETILSD 660
                  ATKAEVSLIENNHTIRSYEIRCM           DTWTSTPYALRYLETILSD
Sbjct: 601 SRSSISSATKAEVSLIENNHTIRSYEIRCMLLLSELFLSLSDTWTSTPYALRYLETILSD 660

Query: 661 YKLGPCSQTILWERLSFCYDLRVDPRIKRKPTITNINKGTKATGSEASHSSIKEVNEKYR 720
           YKLGPCSQTILWERLSFCYDLRVDPRIKRKPTITNINKGTKATGSEASHSSIKEVNEKYR
Sbjct: 661 YKLGPCSQTILWERLSFCYDLRVDPRIKRKPTITNINKGTKATGSEASHSSIKEVNEKYR 720

Query: 721 NDGKQEKYSIDRKNSLIIDVNSNEEYDCGYDILSDGFTXXXXXXXXXXXXXXXWSEQKQW 780
           NDGKQEKYSIDRKNSLIIDVNSNEEYDCGYDILSDGFT               WSEQKQW
Sbjct: 721 NDGKQEKYSIDRKNSLIIDVNSNEEYDCGYDILSDGFTRKRKAAFFKLIAAKKWSEQKQW 780

Query: 781 RQLDWCLKDIENVYKEVGFSDRXXXXXXXXXXQLNKYYIKNNIKCTKEDSRSIDMELDSK 840
           RQLDWCLKDIENVYKEVGFSDR          QLNKYYIKNNIKCTKEDSRSIDMELDSK
Sbjct: 781 RQLDWCLKDIENVYKEVGFSDRKDLILIKLKDQLNKYYIKNNIKCTKEDSRSIDMELDSK 840

Query: 841 ITQDVQASPATATVKTSVGSTDTSNTNLINDSQANSLQSSKIDHEITFP 889
           ITQDVQASPATATVKTSVGSTDTSNTNLINDSQANSLQSSKIDHEITFP
Sbjct: 841 ITQDVQASPATATVKTSVGSTDTSNTNLINDSQANSLQSSKIDHEITFP 889

>NCAS0B03880 Chr2 complement(691369..693489) [2121 bp, 706 aa] {ON}
           Anc_8.255 YDR108W
          Length = 706

 Score =  561 bits (1446), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/623 (47%), Positives = 390/623 (62%), Gaps = 62/623 (9%)

Query: 181 RQKTRKRSNSLFQRDSTQSQYIRFTKPIPDLVNTRDPTDSLFDHQSLETLLKGYLKIIET 240
           R + R RSNSLFQRDSTQSQYIRFTKP+ D++ T++  D LFD+ SLE  L+ YL +I+ 
Sbjct: 106 RTRGRSRSNSLFQRDSTQSQYIRFTKPLGDVIATKNANDMLFDYHSLEIYLQNYLDLIQK 165

Query: 241 NTTPDMPHNALKKSLYHRFFSMTVTSTTNLCPFESFDHPIVSLLSIDLTLNQNYDTAKEM 300
           NT  + P+  LKKS+YH FFS+ ++STT L P+E F+HP+VSL+++D++L QNYD  +++
Sbjct: 166 NTDDNTPYELLKKSIYHSFFSLAISSTTILSPYECFNHPVVSLIAVDISLGQNYDDVRDL 225

Query: 301 LIKFKNIHSKTPNFPVYLNINDILPVFLLCYDASSPEQLDIAKKISTKIKKQLFFESILL 360
           L+ FKN++S T NFP+++N ND+LPV LLCYD    EQ +  + ++ KIKKQLF E I L
Sbjct: 226 LVDFKNLNSSTHNFPIFMNTNDMLPVVLLCYDDQFIEQFETCQALTKKIKKQLFVECISL 285

Query: 361 PLWNDKIYNNDKFVKLHEPMMSSVDETLYFLQQYLQKNSCVTDNKLPLSLVKYIYEMIAN 420
           PLW D  Y +D  V LH+P+MSS++E +YFL Q         +  LP  L++ IY ++ +
Sbjct: 286 PLWKDS-YPSDPQVHLHQPVMSSLEEMIYFLNQ-------PKEVTLPYELIQSIYNILDS 337

Query: 421 LSVNLIIPFMQRKIRFWDETILQPRKSIFRN-KLFKSFMNRXXXXXXXXXXXXXXXXXXX 479
           L  NL+IPFM+RKI FWDETILQPRKS+F   K  K FM +                   
Sbjct: 338 LVYNLMIPFMKRKIAFWDETILQPRKSLFHGAKFLKKFMTK-----------------TA 380

Query: 480 XXXXXXLLTKDSNGHEYFSALSTEFQLRKLADWSMMVSDFKTAYTTYESLSRDLENTSKY 539
                 LLTKD+ G+EYF++ S+EF +RKLADWSMM+SDFKTAY TYESL+ DLE+  KY
Sbjct: 381 LTHQENLLTKDAQGNEYFTSASSEFLMRKLADWSMMLSDFKTAYATYESLTHDLESFPKY 440

Query: 540 MASCLEWWAVSILMGAQNIVTAKMLKNDVDPLIESALESYEKPLPPVXXXXXXXXXXXXX 599
            ASCLEW AVS+LMGAQNIVT KMLKND++PLIE AL +YE                   
Sbjct: 441 SASCLEWCAVSLLMGAQNIVTVKMLKNDINPLIEKALSTYEN----------------CA 484

Query: 600 XXXXXXXXATKAEVSLIENNHTIRSYEIRCMXXXXXXXXXXXDTWTSTPYALRYLETILS 659
                       E+ ++     +RSYE RCM           DTWTSTPYA+ YLETIL 
Sbjct: 485 TVLPETDKRNTDELIVVP----VRSYETRCMILASELFLSLSDTWTSTPYAISYLETILV 540

Query: 660 DYKLGPCSQTILWERLSFCYDLRVDPRIKRKPTITNINKGTKATGSEASHSSIKEVNEKY 719
           + KLG CSQ ++WERLS CY+LRVDPRIK            KA G+ A+ SS K+ +E  
Sbjct: 541 ECKLGACSQIMIWERLSDCYELRVDPRIKH-----------KAAGTIANTSSPKKSSESD 589

Query: 720 RNDGKQEKYSIDRKNSLIIDVNSNEEYDCGYDILSDGFTXXXXXXXXXXXXXXXWSEQKQ 779
                     + ++     DV+++   D   DI+S GFT               W+EQK+
Sbjct: 590 MQGHVMTPSPLTKE-----DVSNDANNDTDQDIVSKGFTRKRKAAFFRLMAAKKWAEQKR 644

Query: 780 WRQLDWCLKDIENVYKEVGFSDR 802
           WRQ+ WCL+ I++ Y ++G +DR
Sbjct: 645 WRQVSWCLQSIDDTYSKIGLADR 667

 Score =  125 bits (313), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 57/101 (56%), Positives = 75/101 (74%)

Query: 1   MPFSYENYMNLLFHLDRTNEEIPTDIAKRIVQNSIAPLISVTATPELDKHVQDSYNIDSL 60
           M FSYE+YMNLLFHLD   E +P++IAKRIV N+I+P+I+VT+T ELD H+ ++YNIDSL
Sbjct: 1   MNFSYEHYMNLLFHLDYGKETVPSEIAKRIVSNAISPVIAVTSTSELDHHILETYNIDSL 60

Query: 61  YMLLRYFGGCISDRDQYHEPHHQHPNELDHKNELHAALISP 101
           YMLLR+F GC+SDRDQ +E      +++   N L     SP
Sbjct: 61  YMLLRFFSGCVSDRDQANELEKSQKDKISSNNTLTLPTTSP 101

>YDR108W Chr4 (671269..673365) [2097 bp, 698 aa] {ON}  TRS85Subunit
           of TRAPPIII (transport protein particle), a multimeric
           guanine nucleotide-exchange factor for Ypt1p, required
           for membrane expansion during autophagy and the CVT
           pathway; directs Ypt1p to the PAS; late post-replication
           meiotic role
          Length = 698

 Score =  553 bits (1424), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/621 (46%), Positives = 389/621 (62%), Gaps = 76/621 (12%)

Query: 181 RQKTRKRSNSLFQRDSTQSQYIRFTKPIPDLVNTRDPTDSLFDHQSLETLLKGYLKIIET 240
           ++ +R RSNSLFQRDSTQSQYIRFT+P+ DL+ TRD  D LF++ SLE  L  YLK++  
Sbjct: 112 KKGSRSRSNSLFQRDSTQSQYIRFTRPLGDLIETRDANDMLFNYHSLEVFLDNYLKLVAA 171

Query: 241 NTTPDMPHNALKKSLYHRFFSMTVTSTTNLCPFESFDHPIVSLLSIDLTLNQNYDTAKEM 300
           NT   +PHN LKKS+YH FFS+ ++ST NL P+E+F+HPI+SL+++D++  + Y+ A+++
Sbjct: 172 NTDEMVPHNLLKKSIYHSFFSLAISSTNNLSPYETFNHPILSLIALDISNGEVYEDARDL 231

Query: 301 LIKFKNIHSKTPNFPVYLNINDILPVFLLCYDASSPEQLDIAKKISTKIKKQLFFESILL 360
           L+ FKN++  T NFP+++N N++LPVFLLCY+  S E+ +  + ++ K+KKQLF ESILL
Sbjct: 232 LVNFKNLNHNTENFPIFMNTNEMLPVFLLCYNDDSQEEFEKCQALAKKLKKQLFVESILL 291

Query: 361 PLWNDK-IYNNDKFVKLHEPMMSSVDETLYFLQQYLQKNSCVTDNKLPLSLVKYIYEMIA 419
            LW D  IY+ +  ++LH+P+MSS++E L+FLQ         T   L L+L+  IY+M+ 
Sbjct: 292 ALWKDSFIYDENSVIQLHQPVMSSLEEILFFLQ-------APTQTTLSLALINSIYDMLD 344

Query: 420 NLSVNLIIPFMQRKIRFWDETILQPRKSIFRN-KLFKSFMNRXXXXXXXXXXXXXXXXXX 478
            L  +L+IPFM+RK+ FW+ETILQPRKS+F   K FK FMN+                  
Sbjct: 345 YLVYDLMIPFMKRKVSFWEETILQPRKSLFNGAKFFKKFMNKNPVNGNHQHNS------- 397

Query: 479 XXXXXXXLLTKDSNGHEYFSALSTEFQLRKLADWSMMVSDFKTAYTTYESLSRDLENTSK 538
                   LT+DS G+EYF++ S+EF +RKLADWSMM+SDFKTAY+TYESL  DL+   K
Sbjct: 398 --------LTRDSQGNEYFASSSSEFLMRKLADWSMMLSDFKTAYSTYESLMDDLDAFPK 449

Query: 539 YMASCLEWWAVSILMGAQNIVTAKMLKNDVDPLIESALESYEKPLPPVXXXXXXXXXXXX 598
           Y+ASC+EW AVS+LMGAQ+IVT KM+KND++PLIE AL +YE                  
Sbjct: 450 YLASCIEWCAVSLLMGAQSIVTVKMIKNDINPLIERALATYEN----------------- 492

Query: 599 XXXXXXXXXATKAEVSLIENNHTIRSYEIRCMXXXXXXXXXXXDTWTSTPYALRYLETIL 658
                        E + ++    +RSYE RCM           +TWTSTPYA++YLETIL
Sbjct: 493 ---CSRIQRGKGKESNSLDVTEPVRSYETRCMILASELFLSLSNTWTSTPYAIQYLETIL 549

Query: 659 SDYKLGPCSQTILWERLSFCYDLRVDPRIKRKPTITNINKGTKATGSEASHSSIKEVNEK 718
            + KLGPCSQ ++WERLS CY+LRVDPRIK +  +  + K  K T             E 
Sbjct: 550 DECKLGPCSQIMVWERLSDCYNLRVDPRIKHR--VGAMKKDAKDT-------------ED 594

Query: 719 YRNDGKQEKYSIDRKNSLIIDVNSNEEYDCGYDILSDGFTXXXXXXXXXXXXXXXWSEQK 778
            R    + KYS D              +    DILS+G T               W+EQK
Sbjct: 595 LRG---EHKYSTD--------------HFTDEDILSEGLTRRRKAAFFRLIAAKKWAEQK 637

Query: 779 QWRQLDWCLKDIENVYKEVGF 799
           QWRQ+ WCLKDIE+ Y E+ F
Sbjct: 638 QWRQVSWCLKDIESTYSEIKF 658

 Score =  128 bits (322), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 56/89 (62%), Positives = 74/89 (83%), Gaps = 1/89 (1%)

Query: 1  MPFSYENYMNLLFHLDRTNEEIPTDIAKRIVQNSIAPLISVTATPELDKHVQDSYNIDSL 60
          M FSYE+YMNLLFHLD + E +P +IAKRI+ N+IAP+I+VT+TP  DKH+Q++Y +DSL
Sbjct: 1  MVFSYEHYMNLLFHLDNSKETVPPEIAKRIISNAIAPVITVTSTPLFDKHIQETYKVDSL 60

Query: 61 YMLLRYFGGCISDRDQYHEPH-HQHPNEL 88
          YMLLR+FGGC+SDRDQ +E    QH +E+
Sbjct: 61 YMLLRFFGGCVSDRDQANEAKVGQHEHEV 89

>Suva_2.268 Chr2 (465716..467803) [2088 bp, 695 aa] {ON} YDR108W
           (REAL)
          Length = 695

 Score =  550 bits (1417), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/625 (45%), Positives = 388/625 (62%), Gaps = 84/625 (13%)

Query: 181 RQKTRKRSNSLFQRDSTQSQYIRFTKPIPDLVNTRDPTDSLFDHQSLETLLKGYLKIIET 240
           ++ +R RSNSLFQRDSTQSQY+RFT+P+ DL+ TRD  D LF++ SLE  L  YLK++  
Sbjct: 109 KRGSRSRSNSLFQRDSTQSQYVRFTRPLGDLIETRDTNDMLFNYHSLEVFLDNYLKLVAG 168

Query: 241 NTTPDMPHNALKKSLYHRFFSMTVTSTTNLCPFESFDHPIVSLLSIDLTLNQNYDTAKEM 300
           NT   +PH+ LKKS+YH FFS+ ++ST NL P+E+F+HPI+SL+++D++  + Y+ A+++
Sbjct: 169 NTDEKVPHDLLKKSIYHSFFSLAISSTNNLSPYETFNHPILSLIALDISYGEVYEDARDL 228

Query: 301 LIKFKNIHSKTPNFPVYLNINDILPVFLLCYDASSPEQLDIAKKISTKIKKQLFFESILL 360
           L+ FKN++  T +FP+++N N++LPVFLLCY+  S E+ +  + ++ K+KKQLF ESILL
Sbjct: 229 LVNFKNLNHNTESFPIFMNTNEMLPVFLLCYNDESQEEFEKCQALAKKLKKQLFVESILL 288

Query: 361 PLWNDKIYN-NDKFVKLHEPMMSSVDETLYFLQQYLQKNSCVTDNKLPLSLVKYIYEMIA 419
           PLW D   +  +  ++LH+P+MSS++E L+FL+         T  KL L L+  IY+M+ 
Sbjct: 289 PLWKDSFVDVENSNIQLHQPVMSSLEEILFFLR-------APTQTKLSLPLINSIYDMLD 341

Query: 420 NLSVNLIIPFMQRKIRFWDETILQPRKSIFRN-KLFKSFMNRXXXXXXXXXXXXXXXXXX 478
            L  +L+IPFM+RKI FW+ETILQPRKS+F   K FK FMN+                  
Sbjct: 342 YLVYDLMIPFMKRKISFWEETILQPRKSLFNGAKFFKKFMNKAPVNGNHQHNS------- 394

Query: 479 XXXXXXXLLTKDSNGHEYFSALSTEFQLRKLADWSMMVSDFKTAYTTYESLSRDLENTSK 538
                   LTKD+ G+EYF++ S+EF +RKLADWSMM+SDFKTAY+TYESL  DL+   K
Sbjct: 395 --------LTKDNQGNEYFASSSSEFLMRKLADWSMMLSDFKTAYSTYESLMDDLDAFPK 446

Query: 539 YMASCLEWWAVSILMGAQNIVTAKMLKNDVDPLIESALESYEKPLPPVXXXXXXXXXXXX 598
           Y+ASC+EW AVS+LMGAQ+IVT KM+KND++PLIE AL +YE                  
Sbjct: 447 YLASCIEWCAVSLLMGAQSIVTVKMIKNDINPLIERALATYEN----------------- 489

Query: 599 XXXXXXXXXATKAEVSLIENNHTIRSYEIRCMXXXXXXXXXXXDTWTSTPYALRYLETIL 658
                        E++       +RSYE RCM           DTWTSTPYA++YLETIL
Sbjct: 490 ---CSRMQRRNSKELTSSGVLEPVRSYETRCMILASELFLSLSDTWTSTPYAIQYLETIL 546

Query: 659 SDYKLGPCSQTILWERLSFCYDLRVDPRIKRKPTITNINKGTKATGSEASHSSIKEVNEK 718
            + KLGPCSQ ++WERLS CY+LRVDPR+K K  +  + K  K T             E 
Sbjct: 547 DECKLGPCSQIMVWERLSDCYNLRVDPRVKHK--VGGMKKSVKNT-------------ED 591

Query: 719 YRNDGKQEKYSIDRKNSLIIDVNSNEEYDCGY----DILSDGFTXXXXXXXXXXXXXXXW 774
            RND                     +EYD  +    DILS+G T               W
Sbjct: 592 LRND---------------------DEYDTDHFTEEDILSEGLTRRRKAAFFRLMAAKKW 630

Query: 775 SEQKQWRQLDWCLKDIENVYKEVGF 799
           +EQKQWRQ+ WCLKDIEN Y ++ F
Sbjct: 631 AEQKQWRQVSWCLKDIENTYSDIDF 655

 Score =  127 bits (320), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 54/79 (68%), Positives = 70/79 (88%)

Query: 1  MPFSYENYMNLLFHLDRTNEEIPTDIAKRIVQNSIAPLISVTATPELDKHVQDSYNIDSL 60
          M FSYE+YMNLLFHLD + E +P +IAKRIV N+IAP+I+VT+TP  DKH+Q++Y++DSL
Sbjct: 1  MVFSYEHYMNLLFHLDHSRETVPPEIAKRIVSNAIAPVITVTSTPLFDKHIQEAYSVDSL 60

Query: 61 YMLLRYFGGCISDRDQYHE 79
          YMLLR+FGGC+SDRDQ +E
Sbjct: 61 YMLLRFFGGCVSDRDQANE 79

>NDAI0J01410 Chr10 complement(323873..326023) [2151 bp, 716 aa] {ON}
           Anc_8.255 YDR108W
          Length = 716

 Score =  548 bits (1413), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/622 (46%), Positives = 392/622 (63%), Gaps = 60/622 (9%)

Query: 182 QKTRKRSNSLFQRDSTQSQYIRFTKPIPDLVNTRDPTDSLFDHQSLETLLKGYLKIIETN 241
           ++ R RSNSLFQRDSTQSQYIRFTKPI D+V  +   D LFD+ SLE  L+ YL++I TN
Sbjct: 115 RRGRSRSNSLFQRDSTQSQYIRFTKPIDDIVAIKSSNDMLFDYHSLEIYLEQYLQLIATN 174

Query: 242 TTPDMPHNALKKSLYHRFFSMTVTSTTNLCPFESFDHPIVSLLSIDLTLNQNYDTAKEML 301
           T    P+  LK S+YH FFS+ ++STT L P+E+F+HPIVSL+++D+++ Q YD  +++L
Sbjct: 175 TNNSTPYELLKNSIYHNFFSLAISSTTQLSPYETFNHPIVSLIAVDISMGQTYDDIRDLL 234

Query: 302 IKFKNIHSKTPNFPVYLNINDILPVFLLCYDASSPEQLDIAKKISTKIKKQLFFESILLP 361
           ++FKN+++ TPNFP+++N ND+LP+FLLCYDA+  EQ +I + ++ ++KKQLF ES++LP
Sbjct: 235 VEFKNLNTTTPNFPIFMNTNDMLPIFLLCYDANYQEQFEICQSLTKRLKKQLFVESLILP 294

Query: 362 LWNDKIYNNDKFVKLHEPMMSSVDETLYFLQQYLQKNSCVTDNKLPLSLVKYIYEMIANL 421
           LWN++ Y  D  V LH+P+MSS++E +YFLQ            KL +SL+  IY ++ +L
Sbjct: 295 LWNEQ-YEIDIKVDLHQPIMSSLEEMIYFLQTPFSA-------KLSISLINSIYNILDSL 346

Query: 422 SVNLIIPFMQRKIRFWDETILQPRKSIFRN-KLFKSFMNRXXXXXXXXXXXXXXXXXXXX 480
             +L++PFM+RK+ FW+ETILQPR+S+F   K  K FM +                    
Sbjct: 347 IYDLMLPFMKRKLLFWEETILQPRRSLFHGAKFLKKFMTK-----------------NNN 389

Query: 481 XXXXXLLTKDSNGHEYFSALSTEFQLRKLADWSMMVSDFKTAYTTYESLSRDLENTSKYM 540
                +LTKDS G+EYF+  STE  +RKLADWSMM+SDFKTAY+TYESLSRDL+   KY+
Sbjct: 390 GPQENILTKDSEGNEYFAFSSTELLMRKLADWSMMISDFKTAYSTYESLSRDLDTFPKYL 449

Query: 541 ASCLEWWAVSILMGAQNIVTAKMLKNDVDPLIESALESYEKPLPPVXXXXXXXXXXXXXX 600
           ASCLEW A S+LMGAQ+IVT KM+KND++PLIE AL++YE                    
Sbjct: 450 ASCLEWCATSLLMGAQSIVTVKMIKNDINPLIERALQTYEN------------------- 490

Query: 601 XXXXXXXATKAEVSLIENNHTIRSYEIRCMXXXXXXXXXXXDTWTSTPYALRYLETILSD 660
                   T  +V   ++   +RSYE RCM           DTWTSTPYA+ YLETIL++
Sbjct: 491 CAITLIQDTTNKVFAEQSVEPLRSYETRCMILLSELFLSLSDTWTSTPYAITYLETILTE 550

Query: 661 YKLGPCSQTILWERLSFCYDLRVDPRIKRKPTITNINKGTKATGSEASHSSIKEVNEKYR 720
            KLGPCSQ  +WERLS CY LR+DPRI+ K     IN     T +  + ++ K V     
Sbjct: 551 CKLGPCSQIQIWERLSDCYKLRIDPRIRYK-----INDTATTTTTVTTTTADKVVATPST 605

Query: 721 NDGKQEKYSIDRKNSLIIDVNSNEEYDCGYDILSDGFTXXXXXXXXXXXXXXXWSEQKQW 780
           +  K  ++  D ++ L            G +ILS GFT               W+EQKQW
Sbjct: 606 DKPKTIQWESDLESKL----------GSGKNILSKGFTRRRKSAFFRLIAAKKWAEQKQW 655

Query: 781 RQLDWCLKDIENVYKEVGFSDR 802
           RQ+ WCLKD+E++Y       R
Sbjct: 656 RQVAWCLKDMESIYDATDLGKR 677

 Score =  133 bits (334), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 62/94 (65%), Positives = 74/94 (78%), Gaps = 8/94 (8%)

Query: 1  MPFSYENYMNLLFHLDRTNEEIPTDIAKRIVQNSIAPLISVTATPELDKHVQDSYNIDSL 60
          M FSYE+YMNLLFHLD   E +P +IAKRIV N+IAP+I+VT+TP+LD H+Q++YNIDSL
Sbjct: 1  MVFSYEHYMNLLFHLDHAKESVPPEIAKRIVSNAIAPVITVTSTPQLDNHIQETYNIDSL 60

Query: 61 YMLLRYFGGCISDRDQYHEPHHQHPNELDHKNEL 94
          YMLLRYFGGC+SDRDQ         NEL  K EL
Sbjct: 61 YMLLRYFGGCVSDRDQ--------ANELVGKQEL 86

>Kpol_392.11 s392 complement(30871..32898) [2028 bp, 675 aa] {ON}
           complement(30871..32898) [2028 nt, 676 aa]
          Length = 675

 Score =  546 bits (1406), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/625 (47%), Positives = 389/625 (62%), Gaps = 97/625 (15%)

Query: 184 TRKRSNSLFQRDSTQSQYIRFTKPIPDLVNTRDPTDSLFDHQSLETLLKGYLKIIETNTT 243
           +R RSNSLFQRDSTQS YIRFTKPI DL+N+RD  D LFD+ SLE  L+  L +I+ NT 
Sbjct: 120 SRSRSNSLFQRDSTQSHYIRFTKPIEDLINSRDSHDMLFDYHSLEVYLEKCLSLIDKNTN 179

Query: 244 PDMPHNALKKSLYHRFFSMTVTSTTNLCPFESFDHPIVSLLSIDLTLNQNYDTAKEMLIK 303
            +  H ALK SL+HRFFS  ++STT L P+ESF+HP++SL+++D++  QNY+ A+++LIK
Sbjct: 180 DETDHKALKMSLFHRFFSSAISSTTYLSPYESFNHPLISLVALDISKGQNYEDARDLLIK 239

Query: 304 FKNIHSKTPNFPVYLNINDILPVFLLCYDASSPEQLDIAKKISTKIKKQLFFESILLPLW 363
           FKN ++    FP +++ NDIL VFLLCYD  S EQ +I + +  K+KKQLF ES++LPLW
Sbjct: 240 FKNQNNAVEEFPPFMSTNDILLVFLLCYDGDSEEQKEICQDVVKKLKKQLFAESLMLPLW 299

Query: 364 NDKIYNNDKFVKLHEPMMSSVDETLYFLQQYLQKNSCVTDNKLPLSLVKYIYEMIANLSV 423
           N K ++ D  V+LH+P MSS+DE LYF ++        + ++LPL+L+  IY+++  L V
Sbjct: 300 N-KSHSEDVQVELHQPAMSSLDEMLYFFER-------PSVHELPLNLINTIYDLMEKLVV 351

Query: 424 NLIIPFMQRKIRFWDETILQPRKSIFR-NKLFKSFMNRXXXXXXXXXXXXXXXXXXXXXX 482
           +L+IPFMQRKI FW+ETILQPRKS+F  NKLF+ FMNR                      
Sbjct: 352 DLMIPFMQRKISFWEETILQPRKSLFHGNKLFRKFMNRSSSQTANQYNN----------- 400

Query: 483 XXXLLTKDSNGHEYFSALSTEFQLRKLADWSMMVSDFKTAYTTYESLSRDLENTSKYMAS 542
               + KDS G+EYF++ S EF LRKLADWSMM+SDFKTAY+TYE+L  DLE   KY+AS
Sbjct: 401 ----IVKDSRGNEYFTSSSPEFLLRKLADWSMMISDFKTAYSTYETLISDLEAHPKYLAS 456

Query: 543 CLEWWAVSILMGAQNIVTAKMLKNDVDPLIESALESYEKPLPPVXXXXXXXXXXXXXXXX 602
           CLEW A+SILMGAQNIVTAKM+KNDV+PLIE +L++YE+                     
Sbjct: 457 CLEWCAISILMGAQNIVTAKMIKNDVNPLIERSLDTYEQ--------------------- 495

Query: 603 XXXXXATKAEVSLIENNHT----IRSYEIRCMXXXXXXXXXXXDTWTSTPYALRYLETIL 658
                +  A+ SL EN+      +RSYE RCM           DTWTSTPYAL  LETIL
Sbjct: 496 ----CSILAQNSL-ENDELLSEPVRSYETRCMLLTSELFLSLNDTWTSTPYALSNLETIL 550

Query: 659 SDYKLGPCSQTILWERLSFCYDLRVDPRIK-RKPTITNINKGTKATGSEASHSSIKEVNE 717
           ++ KLG CSQ ++WERLS CY++R DPRI+ R  T+T I                     
Sbjct: 551 AECKLGICSQIMIWERLSDCYNMRTDPRIRHRVETVTKIEN------------------- 591

Query: 718 KYRNDGKQEKYSIDRKNSLIIDVNSNEEYDCGYDILSDGFTXXXXXXXXXXXXXXXWSEQ 777
              N+G Q+         L  D           DI+S G                 W+EQ
Sbjct: 592 ---NEGGQQ---------LQTD-----------DIVSKGLARKRKAAFFRLLAAKKWAEQ 628

Query: 778 KQWRQLDWCLKDIENVYKEVGFSDR 802
           KQWRQ+ WCL+D+E +Y ++ FS R
Sbjct: 629 KQWRQVSWCLRDVEYIYDDLSFSKR 653

 Score =  134 bits (337), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 58/79 (73%), Positives = 71/79 (89%)

Query: 1  MPFSYENYMNLLFHLDRTNEEIPTDIAKRIVQNSIAPLISVTATPELDKHVQDSYNIDSL 60
          + FSYENYMNL++HLDR NE +P DI+KRIV N+IAP+I+V +T ELD+HVQDSYNIDSL
Sbjct: 4  LQFSYENYMNLVYHLDRVNEPVPQDISKRIVSNAIAPVITVMSTSELDQHVQDSYNIDSL 63

Query: 61 YMLLRYFGGCISDRDQYHE 79
          Y+L+RYFGGCISDRDQ +E
Sbjct: 64 YLLMRYFGGCISDRDQANE 82

>TDEL0F03820 Chr6 (699240..701303) [2064 bp, 687 aa] {ON} Anc_8.255
           YDR108W
          Length = 687

 Score =  540 bits (1390), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/651 (44%), Positives = 385/651 (59%), Gaps = 88/651 (13%)

Query: 184 TRKRSNSLFQRDSTQSQYIRFTKPIPDLVNTRDPTDSLFDHQSLETLLKGYLKIIETNTT 243
           +RKRSNSLFQRD+TQSQYIRFT+P+ DLV + D  D LFD+ +LE+ L+  L +IE +T 
Sbjct: 108 SRKRSNSLFQRDATQSQYIRFTRPLRDLVESADTNDMLFDYHTLESFLENILLLIEKSTN 167

Query: 244 PDMPHNALKKSLYHRFFSMTVTSTTNLCPFESFDHPIVSLLSIDLTLNQNYDTAKEMLIK 303
              PH  LKKSLYHRFFS+ ++ST  L P+E+F+HP+VSL+++D+ + Q Y+ A+++L K
Sbjct: 168 DKTPHKLLKKSLYHRFFSLAISSTAYLSPYETFNHPVVSLIALDIPIGQGYEEARDLLTK 227

Query: 304 FKNIHSKTPNFPVYLNINDILPVFLLCYDASSPEQLDIAKKISTKIKKQLFFESILLPLW 363
           FKN++  T NFPV+LN ND+LPVFLLCY+  S EQ +I + ++ K+KKQLF E ILLPLW
Sbjct: 228 FKNLNHTTKNFPVFLNTNDVLPVFLLCYNGDSEEQYEICQSLTKKLKKQLFVEGILLPLW 287

Query: 364 NDKIYNNDKFVKLHEPMMSSVDETLYFLQQYLQKNSCVTDNKLPLSLVKYIYEMIANLSV 423
            D  Y     V LH+P+M+S+DE LYFL++        +  +L L L+  IY+++  L  
Sbjct: 288 KDN-YKTATQVILHQPIMTSLDEVLYFLRE-------PSRIELSLELINSIYDVLEILIN 339

Query: 424 NLIIPFMQRKIRFWDETILQPRKSIFRN-KLFKSFMNRXXXXXXXXXXXXXXXXXXXXXX 482
            L+IPFMQRKI FW+ETILQPR+S+F   K  K FM++                      
Sbjct: 340 GLMIPFMQRKISFWEETILQPRRSLFHGSKFLKRFMSKTTSGTNIHQQAS---------- 389

Query: 483 XXXLLTKDSNGHEYFSALSTEFQLRKLADWSMMVSDFKTAYTTYESLSRDLENTSKYMAS 542
               + KD+NG EYF + S EF +RKLADWSMM+SD+KTAY+TY+SLS DLE+  KY+AS
Sbjct: 390 ----IAKDANGKEYFVSSSAEFLMRKLADWSMMLSDYKTAYSTYDSLSHDLEHYPKYLAS 445

Query: 543 CLEWWAVSILMGAQNIVTAKMLKNDVDPLIESALESYEKPLPPVXXXXXXXXXXXXXXXX 602
           CLEW +VS+LMGAQNIVTAKMLK D+DPLI+ A+E+YE                      
Sbjct: 446 CLEWCSVSVLMGAQNIVTAKMLKTDIDPLIQRAVETYEN-----------------CALY 488

Query: 603 XXXXXATKAEVSLIENNHTIRSYEIRCMXXXXXXXXXXXDTWTSTPYALRYLETILSDYK 662
                 +K   S+      +RSYE RCM           DTWTSTPYALR LETIL++ +
Sbjct: 489 DTQLSGSKKSNSMA----PVRSYETRCMFLASELFLSLSDTWTSTPYALRNLETILAECR 544

Query: 663 LGPCSQTILWERLSFCYDLRVDPRIKRKPTITNINKGTKATGSEASHSSIKEVNEKYRND 722
           LGPCSQ ++WERLS CY  R+D RI+ K     +N G  +              EK  N+
Sbjct: 545 LGPCSQIMIWERLSNCYQQRIDHRIRHK-----VNDGAMSN------------EEKVENE 587

Query: 723 GKQEKYSIDRKNSLIIDVNSNEEYDCGYDILSDGFTXXXXXXXXXXXXXXXWSEQKQWRQ 782
              EK                       DI++ G T               W+EQKQWRQ
Sbjct: 588 DDSEKEHTHA------------------DIVTRGLTRMRKAAFFQLIAANKWAEQKQWRQ 629

Query: 783 LDWCLKDIENVYKEVGFSDRXXXXXXXXXXQLNKYYIKNNIKCTKEDSRSI 833
             WCLKD E+ Y  + F +R           L    +K  +K  + DSR+I
Sbjct: 630 ASWCLKDTEDAYAGIEFVNR---------KDLALAKLKETLKNVEIDSRTI 671

 Score =  122 bits (307), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 50/79 (63%), Positives = 67/79 (84%)

Query: 1  MPFSYENYMNLLFHLDRTNEEIPTDIAKRIVQNSIAPLISVTATPELDKHVQDSYNIDSL 60
          +  SYENYMNLL HLD  ++ +P DIAKRIV N+I+P+I VT+TPELD+H+Q+++++DSL
Sbjct: 2  VKLSYENYMNLLLHLDHGDDRVPADIAKRIVSNAISPVICVTSTPELDRHIQETHHLDSL 61

Query: 61 YMLLRYFGGCISDRDQYHE 79
          YMLLR+FG C+ DRDQ HE
Sbjct: 62 YMLLRFFGDCVGDRDQAHE 80

>KAFR0B05570 Chr2 complement(1140432..1142441) [2010 bp, 669 aa]
           {ON} Anc_8.255 YDR108W
          Length = 669

 Score =  538 bits (1386), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 288/621 (46%), Positives = 378/621 (60%), Gaps = 71/621 (11%)

Query: 183 KTRKRSNSLFQRDSTQSQYIRFTKPIPDLVNTRDPTDSLFDHQSLETLLKGYLKIIETNT 242
           + R RSNSLFQRDSTQSQYIRFT+P+PDLV   D  D LFDH SLE+ L+ YL+++E  T
Sbjct: 99  RARSRSNSLFQRDSTQSQYIRFTRPLPDLVERHDKNDMLFDHHSLESYLRQYLELVEKFT 158

Query: 243 TPDMPHNALKKSLYHRFFSMTVTSTTNLCPFESFDHPIVSLLSIDLTLNQNYDTAKEMLI 302
                H  LKKSLYH FFS+ ++STT L PFESF+HPI+SL+++D+T +Q+Y+ AK +LI
Sbjct: 159 FDSTSHQLLKKSLYHNFFSLAISSTTTLSPFESFNHPIMSLIALDITNSQSYEDAKGLLI 218

Query: 303 KFKNIHSKTPNFPVYLNINDILPVFLLCYDASSPEQLDIAKKISTKIKKQLFFESILLPL 362
           KFKN+H+    FP+Y+N  D+LPVFLLCY+A SPE++   +++S KIKKQLF ESI LPL
Sbjct: 219 KFKNLHNTIDKFPIYINTYDMLPVFLLCYNADSPEEVQQCEELSVKIKKQLFVESISLPL 278

Query: 363 WNDKIYNNDKFVKLHEPMMSSVDETLYFLQQYLQKNSCVTDNKLPLSLVKYIYEMIANLS 422
           W +  Y  + F+KLH+P+MSS+DE +YFLQ   Q       N LP+ L    Y+M+  L 
Sbjct: 279 WKNS-YQTEPFIKLHQPVMSSLDEMIYFLQSDEQ-------NTLPIELTNTTYDMLEKLV 330

Query: 423 VNLIIPFMQRKIRFWDETILQPRKSIFRN-KLFKSFMNRXXXXXXXXXXXXXXXXXXXXX 481
             L+IPFMQRKI FW+ET+LQP+KSIF   K  K  M+R                     
Sbjct: 331 YALLIPFMQRKIAFWEETVLQPKKSIFHGSKFLKKLMSR---------------ASTSSH 375

Query: 482 XXXXLLTKDSNGHEYFSALSTEFQLRKLADWSMMVSDFKTAYTTYESLSRDLENTSKYMA 541
               +LTKD +G+EYF++ S E  LRKLADWS+M+SDFKT Y TYE LS DLE   KY+A
Sbjct: 376 QQQNILTKDHDGNEYFASSSPELLLRKLADWSIMLSDFKTGYATYEILSHDLELFPKYLA 435

Query: 542 SCLEWWAVSILMGAQNIVTAKMLKNDVDPLIESALESYEKPLPPVXXXXXXXXXXXXXXX 601
           SCLEW AVS+LMGAQNIVT KM+KND+ PLI+ AL++Y+                     
Sbjct: 436 SCLEWEAVSLLMGAQNIVTVKMMKNDISPLIDRALDAYD-------------ACAANTHL 482

Query: 602 XXXXXXATKAEVSLIENNHTIRSYEIRCMXXXXXXXXXXXDTWTSTPYALRYLETILSDY 661
                  T    SL      + SYE RC+           DTWTSTPYA+ YLE+IL + 
Sbjct: 483 SNKKIGPTNESTSL----EPVLSYETRCLILSSELFLSLSDTWTSTPYAINYLESILEES 538

Query: 662 KLGPCSQTILWERLSFCYDLRVDPRIKRKPTITNINKGTKATGSEASHSSIKEVNEKYRN 721
           +LGPCS+ ++WERLS CYDLRVDPRIK K                        V +  + 
Sbjct: 539 RLGPCSRIMIWERLSDCYDLRVDPRIKSK------------------------VEQVQKQ 574

Query: 722 DGKQEKYSIDRKNSLIIDVNSNEEYDCGYDILSDGFTXXXXXXXXXXXXXXXWSEQKQWR 781
           D  +E    D ++ ++   NS ++ +   +I+S G T               W+EQ QW+
Sbjct: 575 DNLEE--PADNEHRIL---NSQDDLNPS-NIVSQGLTRKRKAAFFRLLAAKMWAEQGQWK 628

Query: 782 QLDWCLKDIENVYKEVGFSDR 802
           Q+ WCL +I ++Y  VG  +R
Sbjct: 629 QVKWCLDNITDIYSRVGLVNR 649

 Score =  130 bits (326), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 56/84 (66%), Positives = 74/84 (88%)

Query: 3  FSYENYMNLLFHLDRTNEEIPTDIAKRIVQNSIAPLISVTATPELDKHVQDSYNIDSLYM 62
          FSYE+YMNLLFHL+ ++E IP++IA+RIV ++IAP+I+VT+TPELDKH+QD+Y+IDSLYM
Sbjct: 4  FSYEHYMNLLFHLECSDENIPSEIARRIVSHAIAPVITVTSTPELDKHIQDTYSIDSLYM 63

Query: 63 LLRYFGGCISDRDQYHEPHHQHPN 86
          LLR+FGGC+SDRDQ  E     P+
Sbjct: 64 LLRFFGGCVSDRDQASESKANAPH 87

>Skud_4.369 Chr4 (642869..644965) [2097 bp, 698 aa] {ON} YDR108W
           (REAL)
          Length = 698

 Score =  537 bits (1383), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 281/621 (45%), Positives = 384/621 (61%), Gaps = 76/621 (12%)

Query: 181 RQKTRKRSNSLFQRDSTQSQYIRFTKPIPDLVNTRDPTDSLFDHQSLETLLKGYLKIIET 240
           ++ +R RSNSLFQRDSTQSQYIRFT+P+ DL+ TRD  D LF++ SLE  L  YLK++  
Sbjct: 112 KKGSRSRSNSLFQRDSTQSQYIRFTRPLGDLIETRDTNDMLFNYHSLEVYLDNYLKLVTE 171

Query: 241 NTTPDMPHNALKKSLYHRFFSMTVTSTTNLCPFESFDHPIVSLLSIDLTLNQNYDTAKEM 300
           NT    PH+ LKKS+YH FFS+ ++ST NL P+E+F+HPI+SL+++D++  + Y+ A+++
Sbjct: 172 NTNETAPHDLLKKSIYHSFFSLAISSTNNLSPYETFNHPILSLIALDISNGEVYEDARDL 231

Query: 301 LIKFKNIHSKTPNFPVYLNINDILPVFLLCYDASSPEQLDIAKKISTKIKKQLFFESILL 360
           L+ FKN++  T NFP+++N N++LPVFL+CY+  S E+ +  + ++ K+KKQLF ESI L
Sbjct: 232 LVNFKNLNHNTENFPIFMNTNEMLPVFLICYNDESQEEFEKCQALAKKLKKQLFVESIFL 291

Query: 361 PLWNDKIYNND-KFVKLHEPMMSSVDETLYFLQQYLQKNSCVTDNKLPLSLVKYIYEMIA 419
           PLW +   +++   +KLH+P+MSS++E L+FLQ         T   L L L+  IY+++ 
Sbjct: 292 PLWKESFIDDENSSIKLHQPVMSSLEEILFFLQ-------APTQTTLSLPLINSIYDILD 344

Query: 420 NLSVNLIIPFMQRKIRFWDETILQPRKSIFRN-KLFKSFMNRXXXXXXXXXXXXXXXXXX 478
            L  +L+IPFM+RK+ FW+ETILQPRKS+F   K FK FMN+                  
Sbjct: 345 YLVYDLMIPFMKRKVSFWEETILQPRKSLFNGAKFFKKFMNKNPANGSHQHNS------- 397

Query: 479 XXXXXXXLLTKDSNGHEYFSALSTEFQLRKLADWSMMVSDFKTAYTTYESLSRDLENTSK 538
                   LT+D  G+EYFS+ S+EF +RKLADWSMM+SDFKTAY+TYESL  DL+   K
Sbjct: 398 --------LTRDRQGNEYFSSSSSEFLMRKLADWSMMLSDFKTAYSTYESLMDDLDAFPK 449

Query: 539 YMASCLEWWAVSILMGAQNIVTAKMLKNDVDPLIESALESYEKPLPPVXXXXXXXXXXXX 598
           Y+ASC+EW AVS+LMGAQ+IVT KM+KND++PLIE AL +YEK                 
Sbjct: 450 YLASCIEWCAVSLLMGAQSIVTVKMIKNDINPLIERALATYEK----------------- 492

Query: 599 XXXXXXXXXATKAEVSLIENNHTIRSYEIRCMXXXXXXXXXXXDTWTSTPYALRYLETIL 658
                        E+S       +RSYE RCM           DTWTSTPYA++YLETIL
Sbjct: 493 ---CSQIQRHKGKELSSSSVTEPVRSYETRCMILASELFLSLSDTWTSTPYAIQYLETIL 549

Query: 659 SDYKLGPCSQTILWERLSFCYDLRVDPRIKRKPTITNINKGTKATGSEASHSSIKEVNEK 718
            + KLGPCSQ ++WERLS CY+LRVDPRIK +  +  + K  K T        ++  +E 
Sbjct: 550 DECKLGPCSQIMIWERLSDCYNLRVDPRIKHRVGV--MKKSFKET------EDLRNGDEH 601

Query: 719 YRNDGKQEKYSIDRKNSLIIDVNSNEEYDCGYDILSDGFTXXXXXXXXXXXXXXXWSEQK 778
           Y +   +E                        DILS+G T               W+EQK
Sbjct: 602 YTDHFIEE------------------------DILSEGLTRRRKAAFFRLIAAKKWAEQK 637

Query: 779 QWRQLDWCLKDIENVYKEVGF 799
            WRQ+ WCLKDIE+ Y E+ F
Sbjct: 638 HWRQVSWCLKDIESTYSEIKF 658

 Score =  129 bits (323), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 58/87 (66%), Positives = 73/87 (83%), Gaps = 1/87 (1%)

Query: 1  MPFSYENYMNLLFHLDRTNEEIPTDIAKRIVQNSIAPLISVTATPELDKHVQDSYNIDSL 60
          M FSYE+YMNLLFHLD + E +P +IAKRIV N+IAP+I+VT+TP  DKH+Q++YN+DSL
Sbjct: 1  MVFSYEHYMNLLFHLDNSEEIVPPEIAKRIVSNAIAPVITVTSTPLFDKHIQETYNVDSL 60

Query: 61 YMLLRYFGGCISDRDQYHEPHHQHPNE 87
          YMLLR+FGGC+SDRDQ +E     PNE
Sbjct: 61 YMLLRFFGGCVSDRDQANEG-KVGPNE 86

>Smik_4.354 Chr4 (632598..634694) [2097 bp, 698 aa] {ON} YDR108W
           (REAL)
          Length = 698

 Score =  537 bits (1383), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 282/637 (44%), Positives = 385/637 (60%), Gaps = 76/637 (11%)

Query: 181 RQKTRKRSNSLFQRDSTQSQYIRFTKPIPDLVNTRDPTDSLFDHQSLETLLKGYLKIIET 240
           ++ +R RSNSLFQRDSTQSQYIRFT+P+ DL+ TRD  D LF++ SLE  L  YLK++  
Sbjct: 112 KKGSRSRSNSLFQRDSTQSQYIRFTRPLDDLIETRDTNDMLFNYHSLEVFLDNYLKLVAD 171

Query: 241 NTTPDMPHNALKKSLYHRFFSMTVTSTTNLCPFESFDHPIVSLLSIDLTLNQNYDTAKEM 300
           NT   +PH+ LKKS+YH FFS+ ++ST NL P+E+F+HPI+SL+++D++  + Y+ A+++
Sbjct: 172 NTDEMVPHDLLKKSIYHSFFSLAISSTNNLSPYETFNHPILSLIALDISNGEVYEDARDL 231

Query: 301 LIKFKNIHSKTPNFPVYLNINDILPVFLLCYDASSPEQLDIAKKISTKIKKQLFFESILL 360
           L+ FKN++  T NFP+++N N++LPVFLLCY+  S E+ +  + ++ K+KKQLF ES+LL
Sbjct: 232 LVNFKNLNHNTENFPLFMNTNEMLPVFLLCYNDESQEEFEKCQALAKKLKKQLFVESVLL 291

Query: 361 PLWNDK-IYNNDKFVKLHEPMMSSVDETLYFLQQYLQKNSCVTDNKLPLSLVKYIYEMIA 419
            LW D  I  N+  ++LH+P+MSS++E L+FLQ         T   L L L+  IY+M+ 
Sbjct: 292 SLWKDSFIEANNSAIQLHQPVMSSLEEILFFLQ-------APTQTSLSLPLINSIYDMLD 344

Query: 420 NLSVNLIIPFMQRKIRFWDETILQPRKSIFRN-KLFKSFMNRXXXXXXXXXXXXXXXXXX 478
            L  +L+IPFM+RK+ FW+ETILQPRKS+F   K FK FMN+                  
Sbjct: 345 YLVYDLMIPFMKRKVSFWEETILQPRKSLFNGAKFFKKFMNKNPSNGNHHHNS------- 397

Query: 479 XXXXXXXLLTKDSNGHEYFSALSTEFQLRKLADWSMMVSDFKTAYTTYESLSRDLENTSK 538
                   LT D+ G+EYF++ S+EF +RKLADWSMM+SDFKTAY+TYESL  DL+   K
Sbjct: 398 --------LTSDNQGNEYFASSSSEFLMRKLADWSMMLSDFKTAYSTYESLMDDLDAFPK 449

Query: 539 YMASCLEWWAVSILMGAQNIVTAKMLKNDVDPLIESALESYEKPLPPVXXXXXXXXXXXX 598
           Y+ASC+EW AVS+LMGAQ IVT KM+KND++PLIE AL +YE                  
Sbjct: 450 YLASCIEWCAVSLLMGAQRIVTVKMIKNDINPLIEKALATYEN----------------- 492

Query: 599 XXXXXXXXXATKAEVSLIENNHTIRSYEIRCMXXXXXXXXXXXDTWTSTPYALRYLETIL 658
                    +   + S       +RSYE RCM           D WTSTPYA++YLETIL
Sbjct: 493 ---CSKIQRSKSEKSSSSNTVEPVRSYETRCMILASELFLSLSDKWTSTPYAIQYLETIL 549

Query: 659 SDYKLGPCSQTILWERLSFCYDLRVDPRIKRKPTITNINKGTKATGSEASHSSIKEVNEK 718
            + KLGPC Q ++WERLS CY LRVDPRIK +  +  + KG            I++  + 
Sbjct: 550 DECKLGPCCQIMIWERLSDCYSLRVDPRIKHR--VGAMKKG------------IRDTEDL 595

Query: 719 YRNDGKQEKYSIDRKNSLIIDVNSNEEYDCGYDILSDGFTXXXXXXXXXXXXXXXWSEQK 778
              DG    +  D                   DILS+G T               W+EQK
Sbjct: 596 RGGDGNSTDHFTDD------------------DILSEGLTRKRKAAFFRLIAARKWAEQK 637

Query: 779 QWRQLDWCLKDIENVYKEVGFSDRXXXXXXXXXXQLN 815
           QWRQ+ WCLKDIE++Y ++ F +           QLN
Sbjct: 638 QWRQVSWCLKDIESIYSDIKFLNGDGLILSKLHNQLN 674

 Score =  127 bits (319), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 54/79 (68%), Positives = 69/79 (87%)

Query: 1  MPFSYENYMNLLFHLDRTNEEIPTDIAKRIVQNSIAPLISVTATPELDKHVQDSYNIDSL 60
          M FSYE+YMNLLFHLD + E +P +IAKRIV N+IAP+I+VT+TP  DKH+Q++Y +DSL
Sbjct: 1  MVFSYEHYMNLLFHLDNSKETVPPEIAKRIVSNAIAPVITVTSTPLFDKHIQEAYKVDSL 60

Query: 61 YMLLRYFGGCISDRDQYHE 79
          YMLLR+FGGC+SDRDQ +E
Sbjct: 61 YMLLRFFGGCVSDRDQANE 79

>ZYRO0C01826g Chr3 complement(143874..145973) [2100 bp, 699 aa] {ON}
           similar to uniprot|P46944 Saccharomyces cerevisiae
           YDR108W GSG1 Subunit of TRAPP (transport protein
           particle) a multi-subunit complex involved in targeting
           and/or fusion of ER-to-Golgi transport vesicles with
           their acceptor compartment protein has late meiotic role
           following DNA replication
          Length = 699

 Score =  528 bits (1361), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 284/640 (44%), Positives = 382/640 (59%), Gaps = 89/640 (13%)

Query: 185 RKRSNSLFQRDSTQSQYIRFTKPIPDLVNTRDPTDSLFDHQSLETLLKGYLKIIETNTTP 244
           RKRSNSLFQRD TQSQY+RFT+PI DL+ + D  D LFD+ SLE  L+  L+++E  T  
Sbjct: 135 RKRSNSLFQRDQTQSQYVRFTRPIDDLIESSDSNDMLFDYHSLEVFLENTLRLVEEYTDD 194

Query: 245 DMPHNALKKSLYHRFFSMTVTSTTNLCPFESFDHPIVSLLSIDLTLNQNYDTAKEMLIKF 304
           + P   LKKSLYH+FFS+ ++STT L P+E+F+HP+VSL++ID++  Q Y+ A+++LIKF
Sbjct: 195 NTPFELLKKSLYHKFFSLAISSTTYLSPYETFNHPVVSLIAIDISAGQGYEEARDLLIKF 254

Query: 305 KNIHSKTPNFPVYLNINDILPVFLLCYDASSPEQLDIAKKISTKIKKQLFFESILLPLWN 364
           KN++    NFP++++  DILPVFLLCY+  S ++ +  ++++ ++KKQLF ES+LLPLW 
Sbjct: 255 KNLNHTVENFPIFMSTGDILPVFLLCYNDESEDEQNACQQLANQLKKQLFVESLLLPLWK 314

Query: 365 DKIYNNDKFVKLHEPMMSSVDETLYFLQQYLQKNSCVTDNKLPLSLVKYIYEMIANLSVN 424
            + Y++   V+LH+P+MSS++E LYFLQ         T  +LPL L+   Y ++  L  +
Sbjct: 315 -RSYSDHGEVELHQPIMSSLEEMLYFLQS-------PTPTRLPLQLINVTYNILEKLVKD 366

Query: 425 LIIPFMQRKIRFWDETILQPRKSIFRNK-LFKSFMNRXXXXXXXXXXXXXXXXXXXXXXX 483
           L++PFM+RKI FW+ETILQPRKS+F     FK  M++                       
Sbjct: 367 LMVPFMKRKISFWEETILQPRKSLFHGANFFKKLMSKNSNGSNNHQPIS----------- 415

Query: 484 XXLLTKDSNGHEYFSALSTEFQLRKLADWSMMVSDFKTAYTTYESLSRDLENTSKYMASC 543
              L KD NG+EYF A STEF +RKLADWSMM+SDFKTAY+TYESL  DLEN  KY+ASC
Sbjct: 416 ---LGKDKNGNEYFVASSTEFLMRKLADWSMMLSDFKTAYSTYESLVHDLENFPKYLASC 472

Query: 544 LEWWAVSILMGAQNIVTAKMLKNDVDPLIESALESYEKPLPPVXXXXXXXXXXXXXXXXX 603
            EW AVS+LMGAQNIVT KM+KND+DPLI+ ALE+YE                       
Sbjct: 473 FEWCAVSVLMGAQNIVTVKMIKNDIDPLIQRALETYEN--------------------CA 512

Query: 604 XXXXATKAEVSLIENNHTIRSYEIRCMXXXXXXXXXXXDTWTSTPYALRYLETILSDYKL 663
               +T  E+ +      +RSYE RCM           DTWTSTPYAL  LETIL++ +L
Sbjct: 513 ADEDSTGEELYV-----PVRSYETRCMFLASELFLSLSDTWTSTPYALNSLETILTECRL 567

Query: 664 GPCSQTILWERLSFCYDLRVDPRIKRKPTITNINKGTKATGSEASHSSIKEVNEKYRNDG 723
           GPCS+ ++WERLS CY  R+DPRI+ K         T A G++A                
Sbjct: 568 GPCSEIMIWERLSDCYYQRIDPRIRHK---------TSAQGAKA---------------- 602

Query: 724 KQEKYSIDRKNSLIIDVNSNEEYDCGYDILSDGFTXXXXXXXXXXXXXXXWSEQKQWRQL 783
                     + L  D  SNEE      I++ G T               W EQKQW+Q 
Sbjct: 603 --------MTDELAPDEESNEE------IVTRGLTRKRKAAFFRLIAANKWVEQKQWKQA 648

Query: 784 DWCLKDIENVYKEVGFSDRXXXXXXXXXXQLNKYYIKNNI 823
            WCLK+IE  Y  + F +R          Q+N+   +NN+
Sbjct: 649 FWCLKEIEEAYAGLDFVNREDLILARLKRQMNE--AQNNV 686

 Score =  122 bits (307), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 50/79 (63%), Positives = 68/79 (86%)

Query: 1  MPFSYENYMNLLFHLDRTNEEIPTDIAKRIVQNSIAPLISVTATPELDKHVQDSYNIDSL 60
          M  SYENYMNLLFHLD   E +P DIA+RIV N+++P+I+V++TPELD+H++D+Y++DSL
Sbjct: 1  MKLSYENYMNLLFHLDHGQETVPPDIARRIVSNAVSPVITVSSTPELDRHIRDTYHLDSL 60

Query: 61 YMLLRYFGGCISDRDQYHE 79
          YM LR+FG C+SDRDQ +E
Sbjct: 61 YMFLRFFGDCVSDRDQANE 79

>TPHA0B03260 Chr2 complement(749568..751712) [2145 bp, 714 aa] {ON}
           Anc_8.255 YDR108W
          Length = 714

 Score =  517 bits (1332), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 293/621 (47%), Positives = 378/621 (60%), Gaps = 81/621 (13%)

Query: 183 KTRKRSNSLFQRDSTQSQYIRFTKPIPDLVNTRDPTDSLFDHQSLETLLKGYLKIIETNT 242
           + R RSNSLFQRDSTQSQ+IRFT+PI DL+ +    D LFD+ +LE  L   LK++E  T
Sbjct: 156 RNRSRSNSLFQRDSTQSQFIRFTRPIEDLLYSGGTGDMLFDYHTLEIFLGSCLKMVEKYT 215

Query: 243 TPDMPHNALKKSLYHRFFSMTVTSTTNLCPFESFDHPIVSLLSIDLTLNQNYDTAKEMLI 302
           T D+ H  L+KSLYHRFFS  ++ST  L P+ESF+HPIVSL++ID+T  QNY+ A+++LI
Sbjct: 216 TDDIDHKTLQKSLYHRFFSSAISSTNCLSPYESFNHPIVSLIAIDITKGQNYELARDLLI 275

Query: 303 KFKNIHSKTPNFPVYLNINDILPVFLLCYDASSPEQLDIAKKISTKIKKQLFFESILLPL 362
            FKN ++   NFP++++ NDILPVF+LCY+ SS E+ + + ++S KIKKQLF E I +PL
Sbjct: 276 AFKNQNTTINNFPIFMSTNDILPVFVLCYNGSSAEESEKSTELSKKIKKQLFAECIRMPL 335

Query: 363 WNDKIYNNDKFVKLHEPMMSSVDETLYFLQQYLQKNSCVTDNKLPLSLVKYIYEMIANLS 422
           W DK Y++D  VKLH+P MSS+DE LY  Q      +  TD KLPL+L+  IY+ +  L+
Sbjct: 336 W-DKRYSDDITVKLHQPAMSSLDEMLYVFQ------TSKTD-KLPLTLINLIYDQLEILT 387

Query: 423 VNLIIPFMQRKIRFWDETILQPRKSIFRN-KLFKSFMNRXXXXXXXXXXXXXXXXXXXXX 481
            +L+IPFMQRKI FW+ETILQP+KS+F+  KLF+ FM R                     
Sbjct: 388 NDLMIPFMQRKITFWEETILQPKKSLFQGTKLFRKFMGR---------------PSMTNG 432

Query: 482 XXXXLLTKDSNGHEYFSALSTEFQLRKLADWSMMVSDFKTAYTTYESLSRDLENTSKYMA 541
               +  KD+ G+EYF++ S  F LRKLADWSMM+SDFKTAYTT+ESL  D+E   KY+A
Sbjct: 433 RQENIPIKDNQGNEYFASTSNVFLLRKLADWSMMISDFKTAYTTFESLLEDIEMYPKYLA 492

Query: 542 SCLEWWAVSILMGAQNIVTAKMLKNDVDPLIESALESYEKPLPPVXXXXXXXXXXXXXXX 601
           SCLEW AV ILMGAQNIVT KM+KNDV+PLIE +L+ Y                      
Sbjct: 493 SCLEWCAVCILMGAQNIVTTKMIKNDVNPLIERSLDVYGN-------------------- 532

Query: 602 XXXXXXATKAEVSLIENNHTIRSYEIRCMXXXXXXXXXXXDTWTSTPYALRYLETILSDY 661
                  + AE     +   +RSYE RCM           DTWTSTPYAL  LETILS+ 
Sbjct: 533 -CALLLNSIAESEESPDTEPVRSYETRCMLITSELFLSLSDTWTSTPYALSNLETILSEC 591

Query: 662 KLGPCSQTILWERLSFCYDLRVDPRIKRKPTITNINKGTKATGSEASHSSIKEVNEKYRN 721
           KLG CSQ ++WERLS CY+LR DPR+K K   +NI   + ++ SE S   IK        
Sbjct: 592 KLGACSQIMIWERLSDCYNLRTDPRVKHKLR-SNI---STSSVSEVSEEEIK-------- 639

Query: 722 DGKQEKYSIDRKNSLIIDVNSNEEYDCGYDILSDGFTXXXXXXXXXXXXXXXWSEQKQWR 781
             KQ             DV+S         I+  G T               W+EQ QWR
Sbjct: 640 --KQ-------------DVSS---------IVLKGLTRQRKASFFRLLAAKKWAEQHQWR 675

Query: 782 QLDWCLKDIENVYKEVGFSDR 802
           Q+ WCL DI  +Y++  F  R
Sbjct: 676 QVSWCLNDISEMYQDTVFGKR 696

 Score =  125 bits (315), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 54/79 (68%), Positives = 66/79 (83%)

Query: 1  MPFSYENYMNLLFHLDRTNEEIPTDIAKRIVQNSIAPLISVTATPELDKHVQDSYNIDSL 60
          M F+YENYMNL+FHLD+ +E +P DI+KRIV N+IAP+I+VTAT ELD H+ + Y IDS 
Sbjct: 1  MTFTYENYMNLIFHLDKVHENVPQDISKRIVSNAIAPVITVTATVELDSHISEEYGIDSF 60

Query: 61 YMLLRYFGGCISDRDQYHE 79
          Y LLRYFGGCISDRDQ +E
Sbjct: 61 YTLLRYFGGCISDRDQSNE 79

>CAGL0B01705g Chr2 (157245..159263) [2019 bp, 672 aa] {ON} highly
           similar to uniprot|P46944 Saccharomyces cerevisiae
           YDR108w GSG1
          Length = 672

 Score =  514 bits (1324), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 276/616 (44%), Positives = 379/616 (61%), Gaps = 79/616 (12%)

Query: 183 KTRKRSNSLFQRDSTQSQYIRFTKPIPDLVNTRDPTDSLFDHQSLETLLKGYLKIIETNT 242
           + R  SNSL+QRD+TQSQY+RFTKP+ DL+NT+D  D LFD+ SLE  L+ YL +++   
Sbjct: 111 RVRSNSNSLYQRDATQSQYVRFTKPLADLINTQDANDMLFDYHSLEVYLQEYLSVVDKKF 170

Query: 243 TPDMPHNALKKSLYHRFFSMTVTSTTNLCPFESFDHPIVSLLSIDLTLNQNYDTAKEMLI 302
           +P +PH+ LK S+YH FF++ ++ST+ L PFE F+HPIVSLL+ID+T N++Y+TA E L 
Sbjct: 171 SPHIPHHLLKTSIYHSFFALAISSTSKLSPFECFNHPIVSLLAIDITRNEDYETAAEQLK 230

Query: 303 KFKNIHSKTPNFPVYLNINDILPVFLLCYDASSPEQLDIAKKISTKIKKQLFFESILLPL 362
           +FK++++  P+FP ++N NDILPVFLLCY+  +  + +  + ++ K+KKQLF ESI+LPL
Sbjct: 231 EFKSMNNNIPSFPSFINTNDILPVFLLCYNKDNETEFEECQTLAGKLKKQLFVESIILPL 290

Query: 363 WNDKIYNNDKFVKLHEPMMSSVDETLYFLQQYLQKNSCVTDNKLPLSLVKYIYEMIANLS 422
           W+ + + ++  V LH+P+MSS++E ++FLQ          D+KLPL LV  IY+ I  + 
Sbjct: 291 WSTE-FTDNLVVSLHQPVMSSIEEIMFFLQN-------PVDHKLPLKLVNCIYDQIDMIV 342

Query: 423 VNLIIPFMQRKIRFWDETILQPRKSIFRN-KLFKSFMNRXXXXXXXXXXXXXXXXXXXXX 481
            +L+ PFM+RK+ FW+ETIL PRKS+F   K FK FMN+                     
Sbjct: 343 YDLMKPFMKRKMTFWEETILTPRKSLFHGAKFFKKFMNKSTQALSQPNS----------- 391

Query: 482 XXXXLLTKDSNGHEYFSALSTEFQLRKLADWSMMVSDFKTAYTTYESLSRDLENTSKYMA 541
                L K+++G  Y S+ S EF +RKLADWSMMVSDFKTAYTTYESL +D E   KY+A
Sbjct: 392 -----LLKENHGSNYLSSTSPEFLMRKLADWSMMVSDFKTAYTTYESLCQDFERMPKYLA 446

Query: 542 SCLEWWAVSILMGAQNIVTAKMLKNDVDPLIESALESYEKPLPPVXXXXXXXXXXXXXXX 601
           SC EW AVS+LMGAQNIVTAKMLKN+++P IE AL +YE                     
Sbjct: 447 SCSEWCAVSLLMGAQNIVTAKMLKNEINPAIERALGAYE--------------------L 486

Query: 602 XXXXXXATKAEVSLIENNHTIRSYEIRCMXXXXXXXXXXXDTWTSTPYALRYLETILSDY 661
                 A +      + +  +RSYE RCM           DTWTSTP+A+ YLETIL++ 
Sbjct: 487 CATESNAHRKFGDSDDLSAPVRSYETRCMFLASELFLSLSDTWTSTPFAIAYLETILNEC 546

Query: 662 KLGPCSQTILWERLSFCYDLRVDPRIKRKPTITNINKGTKATGSEASHSSIKEVNEKYRN 721
           KLGP S+ ++WERLS CY +R+DPRIK +  I N+                 E+ +    
Sbjct: 547 KLGPLSEIMIWERLSDCYGMRIDPRIKHR--IGNL-----------------ELLQ---- 583

Query: 722 DGKQEKYSIDRKNSLIIDVNSNEEYDCGYDILSDGFTXXXXXXXXXXXXXXXWSEQKQWR 781
             K+E+   D KN+   DV + E      DILS G T               W EQKQWR
Sbjct: 584 --KKEENMDDPKNA---DVFTTE------DILSKGLTRNRKAALFKLIAARKWCEQKQWR 632

Query: 782 QLDWCLKDIENVYKEV 797
           +L WCL D+E+ Y ++
Sbjct: 633 ELSWCLDDLESTYSDL 648

 Score =  123 bits (309), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 51/79 (64%), Positives = 70/79 (88%)

Query: 1  MPFSYENYMNLLFHLDRTNEEIPTDIAKRIVQNSIAPLISVTATPELDKHVQDSYNIDSL 60
          M FSYE+YMNL++HLD  NE +P+DIAKR+V N++AP+I+VT+T  LD+H++++Y IDSL
Sbjct: 1  MVFSYEHYMNLIYHLDDANETVPSDIAKRVVSNAMAPVITVTSTVLLDRHIEETYGIDSL 60

Query: 61 YMLLRYFGGCISDRDQYHE 79
          YMLLR+FGGC+SDRDQ +E
Sbjct: 61 YMLLRFFGGCVSDRDQANE 79

>KLTH0G13860g Chr7 complement(1201656..1203782) [2127 bp, 708 aa]
           {ON} similar to uniprot|P46944 Saccharomyces cerevisiae
           YDR108W GSG1 Subunit of TRAPP (transport protein
           particle) a multi-subunit complex involved in targeting
           and/or fusion of ER-to-Golgi transport vesicles with
           their acceptor compartment protein has late meiotic role
           following DNA replication
          Length = 708

 Score =  506 bits (1302), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 277/648 (42%), Positives = 378/648 (58%), Gaps = 83/648 (12%)

Query: 181 RQKTRKRSNSLFQRDSTQSQYIRFTKPIPDLVNTRDPTDSLFDHQSLETLLKGYLKIIET 240
           + + R RSNSLFQR +  S Y+RFT+P+ DL++ R+  D LFD+ SLE  L+ YL ++E 
Sbjct: 89  KNRNRARSNSLFQRQA--SHYLRFTRPLTDLIDVRESRDLLFDYHSLEVFLEKYLSLVEA 146

Query: 241 NTTPDMPHNALKKSLYHRFFSMTVTSTTNLCPFESFDHPIVSLLSIDLTLNQNYDTAKEM 300
           NTT D PH  L+ S+YH+FF+  ++ST +L P+ESF+HP+ SLL++D++ +Q Y+ A+++
Sbjct: 147 NTTSDTPHTLLQHSIYHKFFTTAISSTAHLSPYESFNHPVASLLALDISKDQGYEEARDL 206

Query: 301 LIKFKNIHSKTPNFPVYLNINDILPVFLLCYDASSPEQLDIAKKISTKIKKQLFFESILL 360
           LI FKN+H+ TP+FP ++N+NDILPVFLLCY+  S EQ ++ + +S  IKKQLF ES+LL
Sbjct: 207 LIAFKNMHNTTPHFPAFINVNDILPVFLLCYEEDSREQFELCQSLSKTIKKQLFVESLLL 266

Query: 361 PLWNDKIYNNDKFVK-LHEPMMSSVDETLYFLQQYLQKNSCVTDNKLPLSLVKYIYEMIA 419
           P W   I       + LH+P+MSS++ET+Y     + K S +T   LPLSL+ YIY+ + 
Sbjct: 267 PCWGQNINAGASPSRILHQPIMSSLEETMY----SMMKESTIT---LPLSLINYIYDRLT 319

Query: 420 NLSVNLIIPFMQRKIRFWDETILQPRKSIFRN-KLFKSFMNRXXXXXXXXXXXXXXXXXX 478
           NL   L+IPFM+RKI FWDE+ILQPRKSIF N K F+  +++                  
Sbjct: 320 NLIDELMIPFMKRKISFWDESILQPRKSIFPNSKFFRKLISKTPAPPPASDSA------- 372

Query: 479 XXXXXXXLLTKDSNGHEYFSALSTEFQLRKLADWSMMVSDFKTAYTTYESLSRDLENTSK 538
                    T    G  YF+A S EF LRKLADWS M+SDFK AY+TYE LS+D E   +
Sbjct: 373 ---------THSQQGVAYFAATSNEFILRKLADWSFMLSDFKNAYSTYELLSKDFEQRPE 423

Query: 539 YMASCLEWWAVSILMGAQNIVTAKMLKNDVDPLIESALESYEKPLPPVXXXXXXXXXXXX 598
           Y+ASCLEW A+S+LMGAQ+IVT KM+KND+DPLI  AL+SYE                  
Sbjct: 424 YLASCLEWCALSVLMGAQSIVTVKMIKNDIDPLINRALKSYE---------LSARKAKEK 474

Query: 599 XXXXXXXXXATKAEV--------SLIENNHTIRS---------------YEIRCMXXXXX 635
                    A KAE         S + + H+ +                YE RCM     
Sbjct: 475 NAQLKSSALAKKAEKDSKSATLPSTVSDEHSGQELDEGVSSAPSQSAQSYETRCMLLAAE 534

Query: 636 XXXXXXDTWTSTPYALRYLETILSDYKLGPCSQTILWERLSFCYDLRVDPRIKRK-PTIT 694
                 DTWT+TPYA++YLETIL +  LG  S+ +LWERL++CY LRVDPR+K K P++ 
Sbjct: 535 LFLSLSDTWTATPYAIKYLETILDECTLGSLSEIVLWERLAYCYALRVDPRVKGKLPSLD 594

Query: 695 NINKGTKATGSEASHSSIKEVNEKYRNDGKQEKYSIDRKNSLIIDVNSNEEYDCGYDILS 754
             +   +  G E+  S          +D + +KY  D K S           +C   + S
Sbjct: 595 GQSGQNEKRGEESEGSD--------ESDDETQKY--DHKIS----------QNC---MAS 631

Query: 755 DGFTXXXXXXXXXXXXXXXWSEQKQWRQLDWCLKDIENVYKEVGFSDR 802
            G                 W+E KQWRQ  W LKDIE VY E+ F++R
Sbjct: 632 LGLARRRKSTLFRLIATKKWTESKQWRQAYWGLKDIEVVYSELDFANR 679

 Score =  111 bits (277), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 44/76 (57%), Positives = 63/76 (82%)

Query: 1  MPFSYENYMNLLFHLDRTNEEIPTDIAKRIVQNSIAPLISVTATPELDKHVQDSYNIDSL 60
          MP S+  YMNL FHLD   E +PT+I+++IV ++++P+++VT+T  LD+H+Q+SY +DSL
Sbjct: 1  MPLSFGKYMNLAFHLDSALEPVPTEISRKIVSSAVSPVVTVTSTAALDEHIQESYGVDSL 60

Query: 61 YMLLRYFGGCISDRDQ 76
          YMLLRYFG C+SDRDQ
Sbjct: 61 YMLLRYFGDCVSDRDQ 76

>Kwal_56.23583 s56 (607721..609823) [2103 bp, 700 aa] {ON} YDR108W
           (GSG1) - involved in meiosis [contig 176] FULL
          Length = 700

 Score =  480 bits (1235), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 254/642 (39%), Positives = 366/642 (57%), Gaps = 69/642 (10%)

Query: 181 RQKTRKRSNSLFQRDSTQSQYIRFTKPIPDLVNTRDPTDSLFDHQSLETLLKGYLKIIET 240
           + + R RS SLFQR +  SQ++RFT+P+ D++ TR+  D LFD+ SLE  L+ YL++++ 
Sbjct: 89  KSRARSRSGSLFQRQA--SQFLRFTRPLSDIIGTRETRDLLFDYHSLEVFLQKYLELVDV 146

Query: 241 NTTPDMPHNALKKSLYHRFFSMTVTSTTNLCPFESFDHPIVSLLSIDLTLNQNYDTAKEM 300
            T+PD PH  L+ S+YH+FF+  ++ST +L P+E F+HP+ SLL++D++ N+ Y+ A+++
Sbjct: 147 KTSPDTPHTLLQHSIYHKFFTTAISSTAHLSPYECFNHPVCSLLALDISQNEGYEDARDL 206

Query: 301 LIKFKNIHSKTPNFPVYLNINDILPVFLLCYDASSPEQLDIAKKISTKIKKQLFFESILL 360
           L+ FKN+H+KTP+FP ++N+NDILPVFLLCY+  S EQ +  + ++  +KKQLF ES+LL
Sbjct: 207 LVTFKNMHNKTPHFPSFINVNDILPVFLLCYEEGSREQFETCQSLAKMMKKQLFVESLLL 266

Query: 361 PLWNDKIYNNDKFVK-LHEPMMSSVDETLYFLQQYLQKNSCVTDNKLPLSLVKYIYEMIA 419
           P W+      D   + LH+P+MSS++ET++     + K+S      LPL  +++IY+ + 
Sbjct: 267 PCWSVNFTAKDTPTRVLHQPIMSSLEETMF----SMLKDSAF---DLPLPFIEHIYDRLT 319

Query: 420 NLSVNLIIPFMQRKIRFWDETILQPRKSIFRN-KLFKSFMNRXXXXXXXXXXXXXXXXXX 478
            L   L+IPFM+RKI FW+E+ILQPR+SIF N K F+  +++                  
Sbjct: 320 KLVDELMIPFMKRKISFWEESILQPRRSIFPNSKFFRKLISKAPTPSTNNDSA------- 372

Query: 479 XXXXXXXLLTKDSNGHEYFSALSTEFQLRKLADWSMMVSDFKTAYTTYESLSRDLENTSK 538
                    T    G  YF+A S E  LRKLADWS M+SDFKTAY+TYE LS+D E   +
Sbjct: 373 ---------THSEQGLAYFAATSNELLLRKLADWSFMLSDFKTAYSTYELLSKDFEQHPE 423

Query: 539 YMASCLEWWAVSILMGAQNIVTAKMLKNDVDPLIESALESYEKPLPPVXXXXXXXXXXXX 598
           Y+A CLEW A+S+LMGAQ+IVT KM+KND+DPLI  AL+SYE                  
Sbjct: 424 YLAPCLEWCALSVLMGAQSIVTVKMIKNDIDPLITRALKSYELCASKAKERNGLLKSKLQ 483

Query: 599 XXXXXXXXXATKAEVSLIENNH------------------TIRSYEIRCMXXXXXXXXXX 640
                      +     I N+H                  + +SYE RCM          
Sbjct: 484 NRDHDKSLNGFET----ISNSHDDRVSGTTDFEISSTPSQSAQSYETRCMLLAAELFLSL 539

Query: 641 XDTWTSTPYALRYLETILSDYKLGPCSQTILWERLSFCYDLRVDPRIKRKPTITNINKGT 700
            DTWT+TPYA++YLETIL    +G  S+ ++WERL++CY LRVDPR+K + T + I    
Sbjct: 540 SDTWTATPYAIKYLETILDQCTVGALSEIVIWERLAYCYALRVDPRVKSRLTASEIQ--- 596

Query: 701 KATGSEASHSSIKEVNEKYRNDGKQEKYSIDRKNSLIIDVNSNEEYDCGYDILSDGFTXX 760
               S   +  + E +E   ND   E      K S            C   I S G T  
Sbjct: 597 ----SSDQNEKLDEESEGSDNDSGDESQVCQHKMS----------QSC---IASSGLTRK 639

Query: 761 XXXXXXXXXXXXXWSEQKQWRQLDWCLKDIENVYKEVGFSDR 802
                        W+E KQWRQ  W  +D+E +Y  + F++R
Sbjct: 640 RKATLFRLIATKKWTESKQWRQACWSFQDLEVMYSHLVFANR 681

 Score =  114 bits (286), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 46/76 (60%), Positives = 65/76 (85%)

Query: 1  MPFSYENYMNLLFHLDRTNEEIPTDIAKRIVQNSIAPLISVTATPELDKHVQDSYNIDSL 60
          MP SYE YMNL+ HLD  +E +P++I+++IV N+++P+++VT++  LDKH+Q+SY +DSL
Sbjct: 1  MPLSYERYMNLVSHLDSASEPVPSEISRKIVSNAVSPVVTVTSSAALDKHIQESYGLDSL 60

Query: 61 YMLLRYFGGCISDRDQ 76
          YMLLRYFG CISDRDQ
Sbjct: 61 YMLLRYFGDCISDRDQ 76

>SAKL0H17226g Chr8 complement(1526848..1529007) [2160 bp, 719 aa]
           {ON} similar to uniprot|P46944 Saccharomyces cerevisiae
           YDR108W GSG1 Subunit of TRAPP (transport protein
           particle) a multi-subunit complex involved in targeting
           and/or fusion of ER-to-Golgi transport vesicles with
           their acceptor compartment protein has late meiotic role
           following DNA replication
          Length = 719

 Score =  468 bits (1205), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 268/662 (40%), Positives = 384/662 (58%), Gaps = 89/662 (13%)

Query: 183 KTRKRSNSLFQRDSTQSQYIRFTKPIPDLVNTRDPTDS-LFDHQSLETLLKGYLKIIETN 241
           K R RSNSLFQR+S  S ++RFT+P+ DLV+ R      LFD+ SLE  L  YL++++  
Sbjct: 87  KGRPRSNSLFQRES--STFVRFTRPLIDLVDVRVSDHGMLFDYHSLELFLDKYLRLVDHR 144

Query: 242 TTPDMPHNALKKSLYHRFFSMTVTSTTNLCPFESFDHPIVSLLSIDLTLNQNYDTAKEML 301
            + + PH  LK S+YH+FF+  ++ST  L P+ESF+HP++SLL++D++    Y+ A+++L
Sbjct: 145 VSANTPHRLLKHSIYHKFFTAAISSTAYLSPYESFNHPVMSLLALDISRGDTYENARDLL 204

Query: 302 IKFKNIHSKT---PNFPVYLNINDILPVFLLCYDASSPEQLDIAKKISTKIKKQLFFESI 358
           I+FKN++S T    +FP ++NINDILPVFLLCY+ SS EQ +  + ++  +KKQLF ESI
Sbjct: 205 IRFKNMNSATKSAASFPTFININDILPVFLLCYNDSSHEQFEACQSLAKMLKKQLFVESI 264

Query: 359 LLPLWND-KIYNNDKFVK-LHEPMMSSVDETLYFLQ---------QYLQKNSCVTDNKLP 407
           LLPLW D + Y+ ++  + LH P+MSS++E LYFL           Y   ++ ++  +LP
Sbjct: 265 LLPLWRDSEDYDAEEPRRILHPPIMSSLEEMLYFLDLEAPGKDNISYTGSSNPISSFELP 324

Query: 408 LSLVKYIYEMIANLSVNLIIPFMQRKIRFWDETILQPRKSIFRN-KLFKSFMNRXXXXXX 466
           L+LV+ IY+ +  L   L+IPFM+RKI FW+ETILQPRKSIF N K  + F+++      
Sbjct: 325 LALVETIYDRLNLLITELMIPFMKRKISFWEETILQPRKSIFLNAKFLRRFVSKSAPATP 384

Query: 467 XXXXXXXXXXXXXXXXXXXLLTKDSNG----HEYFSALSTEFQLRKLADWSMMVSDFKTA 522
                               +   S+G      +F A S EF LRKLADWS M+SD++TA
Sbjct: 385 AAP-----------------INSKSDGAVQRSNFFPASSNEFLLRKLADWSFMLSDYRTA 427

Query: 523 YTTYESLSRDLENTSKYMASCLEWWAVSILMGAQNIVTAKMLKNDVDPLIESALESYEKP 582
           Y TY++LS+DLE+  +Y+A CLEW AVS+LMGAQ+IVT KM+KND+DPLI  +L+ YEK 
Sbjct: 428 YATYDTLSKDLEHHLEYLAPCLEWCAVSVLMGAQSIVTVKMIKNDIDPLISKSLQCYEKC 487

Query: 583 LPPVXXXXXXXXXXXXXXXXXXXXXATKAEVSLIENNHTIRSYEIRCMXXXXXXXXXXXD 642
              +                        AE     ++   +SYE RCM           D
Sbjct: 488 ASKLTSPHV-------------------AEADSPVDSKPAQSYETRCMLLSAELFLSLSD 528

Query: 643 TWTSTPYALRYLETILSDYKLGPCSQTILWERLSFCYDLRVDPRI------------KRK 690
           TWT+TPYA++YLETIL +  LGP SQ +LWE+L++CY+LRVDPR+            +R+
Sbjct: 529 TWTATPYAIKYLETILQNCPLGPKSQVLLWEKLAYCYELRVDPRVSHIHAKQRHLQYERE 588

Query: 691 PTITNINKGTKATGSEASHSSIKEVNEKYRNDGKQEKYSIDRKNSLIIDVNSNEEYDCG- 749
             I+  N+      SE+  S+     EK +   ++E+   D K+  +    SN E +   
Sbjct: 589 EVISKSNERAPQHHSESHFST-----EKNQTGNQEEQSDTDSKDEAL----SNREKEHAD 639

Query: 750 ---------YDILSDGFTXXXXXXXXXXXXXXXWSEQKQWRQLDWCLKDIENVYKEVGFS 800
                     DI   G T               W EQKQW+Q  W L+D++ VY  + FS
Sbjct: 640 FVNPNKLPYKDIALLGLTRRRKAAFFRLIAANKWCEQKQWKQASWLLRDVDTVYSGLVFS 699

Query: 801 DR 802
            R
Sbjct: 700 YR 701

 Score =  100 bits (250), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 41/81 (50%), Positives = 65/81 (80%), Gaps = 2/81 (2%)

Query: 1  MPFSYENYMNLLFHLDRTNEEIP--TDIAKRIVQNSIAPLISVTATPELDKHVQDSYNID 58
          M  SYENYMNLL+H+D + E +   +++AK+IV N+++P+++VT+T  LD H+Q++Y + 
Sbjct: 1  MTLSYENYMNLLYHIDHSGESVTVNSEVAKKIVSNAVSPVVAVTSTSLLDSHLQEAYGLH 60

Query: 59 SLYMLLRYFGGCISDRDQYHE 79
          S+YMLLR+FG C++DRDQ +E
Sbjct: 61 SMYMLLRFFGDCVTDRDQENE 81

>KNAG0H03270 Chr8 complement(609643..611589) [1947 bp, 648 aa] {ON}
           Anc_8.255 YDR108W
          Length = 648

 Score =  435 bits (1119), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 246/654 (37%), Positives = 345/654 (52%), Gaps = 147/654 (22%)

Query: 183 KTRKRSNSLFQRDSTQSQYIRFTKPIPDLVNTRDPTDSLFDHQSLETLLKGYLKIIETNT 242
           +TRKRSNSLFQRD+TQSQ+IRF +P+PDL+ +      LFD+ SLE  L  YL  I+  T
Sbjct: 91  RTRKRSNSLFQRDATQSQFIRFAQPLPDLLRSYTEQQGLFDNDSLEWYLTHYLSWIQKLT 150

Query: 243 TPD----------------------MPHNALKKSLYHRFFSMTVTSTTNLCPFESFDHPI 280
             D                      +PH  L+ ++YH FF++ V+STT + PFE+F+ P+
Sbjct: 151 ATDPEKVEQLPDELTPSSPPQRGKPLPHKLLRNAVYHNFFALAVSSTTRISPFETFNVPV 210

Query: 281 VSLLSIDLTLNQNYDTAKEMLIKFKNIHSKTPNFPVYLNINDILPVFLLCYDASSPEQLD 340
           ++L++ID++  Q+Y+  ++++  FKN++    +FPV++N+NDILP+ +LCYDA+   QL 
Sbjct: 211 MNLIAIDVSRGQDYEVVRDLVTTFKNLNKFLEDFPVFINVNDILPMIVLCYDAADETQLA 270

Query: 341 IAKKISTKIKKQLFFESILLPLWNDKIYNNDKFVKLHEPMMSSVDETLYFLQQYLQKNSC 400
             +++  KIKK LF +SI L LW++        V LHEP+MSS+DE + F   Y   +S 
Sbjct: 271 TCEQLQRKIKKCLFVDSIPLALWDED--PESPLVPLHEPIMSSLDEIVKF---YSSNSSA 325

Query: 401 VTDN---------KLPLSLVKYIYEMIANLSVNLIIPFMQRKIRFWDETILQPRKSIFR- 450
             D           LPL+++ ++Y+ +  L   ++IPFM RK ++W+E ILQPRKSIF  
Sbjct: 326 GGDEVGTDGHSRAALPLNIITHMYQALDVLVDEMLIPFMHRKTKYWEENILQPRKSIFHG 385

Query: 451 -NKLFKSFMNRXXXXXXXXXXXXXXXXXXXXXXXXXLLTKDSNGHEYFSALSTEFQLRKL 509
            N  FK F+ +                            +D +  ++F A STE  LRKL
Sbjct: 386 SNNFFKKFIGKTTTQ------------------------RDPSDTQFFPASSTECLLRKL 421

Query: 510 ADWSMMVSDFKTAYTTYESLSRDLENTSKYMASCLEWWAVSILMGAQNIVTAKMLKNDVD 569
           ADWS+M+SDFKTAY TY+SLS DL+N+  Y+ASCLEW AVS+L+GAQNIVT KM+K ++ 
Sbjct: 422 ADWSLMLSDFKTAYLTYDSLSNDLQNSPNYLASCLEWCAVSLLLGAQNIVTVKMIKTEIT 481

Query: 570 PLIESALESYEKPLPPVXXXXXXXXXXXXXXXXXXXXXATKAEVSLIENNHTIRSYEIRC 629
           PLIE A+ +Y +                                          SYE RC
Sbjct: 482 PLIERAVATYRQ--------------------------------------QGRSSYETRC 503

Query: 630 MXXXXXXXXXXXDTWTSTPYALRYLETILSDY-KLGPCSQTILWERLSFCYDLRVDPRIK 688
           M           DTWTSTPYA+RYLETIL D  +LG CSQ ++WERLS CY  R DPR+ 
Sbjct: 504 MILSAELFLALRDTWTSTPYAIRYLETILRDCPQLGACSQVMIWERLSDCYQSRTDPRVA 563

Query: 689 RKPTITNINKGTKATGSEASHSSIKEVNEKYRNDGKQEKYSIDRKNSLIIDVNSNEEYDC 748
              + TN + G+   G+E                                          
Sbjct: 564 SALS-TNTSPGSAQPGNE------------------------------------------ 580

Query: 749 GYDILSDGFTXXXXXXXXXXXXXXXWSEQKQWRQLDWCLKDIENVYKEVGFSDR 802
              IL+ GFT               W+EQ QWRQ+ WCL DI+++Y      D+
Sbjct: 581 ---ILAQGFTRKRKAAFFRLIAAKKWAEQGQWRQVQWCLHDIKDIYTASALYDK 631

 Score =  104 bits (260), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 45/79 (56%), Positives = 61/79 (77%)

Query: 1  MPFSYENYMNLLFHLDRTNEEIPTDIAKRIVQNSIAPLISVTATPELDKHVQDSYNIDSL 60
          M FSYE+YMNLL HL+  +E +P DIA+RIV +++AP+I+VT++  LD H+ +SY + S 
Sbjct: 1  MAFSYEHYMNLLSHLECASETVPPDIARRIVSHAVAPVITVTSSLALDDHIMESYKVQSA 60

Query: 61 YMLLRYFGGCISDRDQYHE 79
          Y+L R FGGCISDRDQ  E
Sbjct: 61 YLLFRLFGGCISDRDQLME 79

>Ecym_4316 Chr4 complement(683492..685363) [1872 bp, 623 aa] {ON}
           similar to Ashbya gossypii AGR096C
          Length = 623

 Score =  367 bits (943), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 233/620 (37%), Positives = 326/620 (52%), Gaps = 112/620 (18%)

Query: 185 RKRSNSLFQRDSTQSQYIRFTKPIPDLVNTRDPTDSLFDHQSLETLLKGYLKIIETNTTP 244
           R+R NSLFQR+S  S+YIRF  P+ D+++  D     F+   LE  L  +LK IE +T  
Sbjct: 90  RQRQNSLFQRNS--SRYIRFQTPLTDIISVGDNHQVEFN--DLEESLSEFLKDIEEHTVN 145

Query: 245 DMPHNALKKSLYHRFFSMTVTSTTNLCPFESFDHPIVSLLSIDLTLNQNYDTAKEMLIKF 304
           D P   LK S++H+F  +T+ S+T L P+ SF+HPI++LL++D+T  + Y+ A+E+L++F
Sbjct: 146 DSPCELLKHSIFHKF--ITMLSSTTLSPYHSFNHPILALLALDITQGEEYELARELLMEF 203

Query: 305 KNIHSKTPNFPVYLNINDILPVFLLCYDASSPEQLDIAKKISTKIKKQLFFESILLPLWN 364
           KN+ +    FP ++N ND+LPVF+LC+D SSP+Q +  + +   IKKQLF ES+ LP++ 
Sbjct: 204 KNLPNTLSKFPAFINTNDVLPVFILCFDQSSPQQWETVQSLMKVIKKQLFVESVPLPIFT 263

Query: 365 DKIYNNDKFVKLHEPMMSSVDETLYFLQQYLQKNSCVTDNKLPLSLVKYIYEMIANLSVN 424
           +     D+ + LH P+ +S+ E LY        +S     KL   LVK IY+ I ++  +
Sbjct: 264 N---FRDRSIVLHPPITNSLQEQLY-------DSSHPVSLKLCPRLVKLIYDTINSMVED 313

Query: 425 LIIPFMQRKIRFWDETILQPRKSIFR-NKLFKSFMNRXXXXXXXXXXXXXXXXXXXXXXX 483
           L+IPFM RKI FWDETILQPRKSIF  NKL K F+++                       
Sbjct: 314 LMIPFMNRKISFWDETILQPRKSIFHSNKLLKRFISKSSGSPTAS--------------- 358

Query: 484 XXLLTKDSNGHEYFSALSTEFQLRKLADWSMMVSDFKTAYTTYESLSRDLENTSKYMASC 543
              +    +GH  F A S EF LRKLADW  M+SD+KTAY+ YE L RD EN   YM+SC
Sbjct: 359 ---MPTSPDGH--FLASSNEFLLRKLADWCFMLSDYKTAYSIYEILIRDFENYPLYMSSC 413

Query: 544 LEWWAVSILMGAQNIVTAKMLKNDVDPLIESALESYEKPLPPVXXXXXXXXXXXXXXXXX 603
            E+ A+S+LMGA +IVTAKM+KND+DPLI   L+                          
Sbjct: 414 QEFSALSLLMGAHSIVTAKMIKNDIDPLIMKYLD-------------------------- 447

Query: 604 XXXXATKAEVSLIENNHTIRSYEIRCMXXXXXXXXXXXDTWTSTPYALRYLETILS--DY 661
                          N+ I   +IRCM           DTWTS P+A++YLE IL   + 
Sbjct: 448 ------------YAVNNIISLDQIRCMIYMTELFLSLSDTWTSAPFAIKYLEVILQKENL 495

Query: 662 KLGPCSQTILWERLSFCYDLRVDPRIKRKPTITNINKGTKATGSEASHSSIKEVNEKYRN 721
           KLGP  + ++WER+SF Y LR+DPRI               + S+  H   +E+   Y N
Sbjct: 496 KLGPVCRNLIWERISFAYRLRIDPRI----------HADDDSTSDCDHDLEEEL---YLN 542

Query: 722 DGKQEKYSIDRKNSLIIDVNSNEEYDCGYDILSDGFTXXXXXXXXXXXXXXXWSEQKQWR 781
             K                       CG  I + GFT               W +  Q R
Sbjct: 543 PHK---------------------LHCG-KIQNQGFTRYRKEAVFQLLAAKKWLQCGQTR 580

Query: 782 QLDWCLKDIENVYKEVGFSD 801
           Q  W LK    VY+++ F++
Sbjct: 581 QGAWSLKRCNRVYRDLPFAN 600

 Score = 79.3 bits (194), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 34/74 (45%), Positives = 55/74 (74%)

Query: 3  FSYENYMNLLFHLDRTNEEIPTDIAKRIVQNSIAPLISVTATPELDKHVQDSYNIDSLYM 62
           SYE YMNLL + D+ ++ +P +I+++++ N+++P ISV +T  L++H+++ + I SLY 
Sbjct: 2  LSYEKYMNLLHYPDQWSQPVPREISRKVICNALSPCISVQSTDALNQHLEEVFKIGSLYK 61

Query: 63 LLRYFGGCISDRDQ 76
          LLRYFG  I DRDQ
Sbjct: 62 LLRYFGDYIQDRDQ 75

>AGR096C Chr7 complement(917898..919769) [1872 bp, 623 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR108W
           (GSG1)
          Length = 623

 Score =  355 bits (912), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 225/620 (36%), Positives = 324/620 (52%), Gaps = 110/620 (17%)

Query: 185 RKRSNSLFQRDSTQSQYIRFTKPIPDLVNTRDPTDSLFDHQSLETLLKGYLKIIETNTTP 244
           ++R  S++QR +  S+Y+RF +P+ +++ T +      D + LE  L  +L+ IE  TT 
Sbjct: 83  QRRPGSVYQRQT--SRYVRFQRPLEEVIETVE--QQAVDFEDLEEALGQHLRDIEARTTN 138

Query: 245 DMPHNALKKSLYHRFFSMTVTSTTNLCPFESFDHPIVSLLSIDLTLNQNYDTAKEMLIKF 304
           + P   LK S++H+F  +T+ S+T L P+ + +HPI++LL++D+T  + Y  A+E+L++F
Sbjct: 139 ESPSELLKHSIFHKF--ITMLSSTALSPYHTVNHPIMALLALDVTQGEEYTLARELLVQF 196

Query: 305 KNIHSKTPNFPVYLNINDILPVFLLCYDASSPEQLDIAKKISTKIKKQLFFESILLPLWN 364
           KN+ SK+  FP Y+N ND+LPVF+LC+D SS EQ +  + +   IKKQLF ES+ LP++ 
Sbjct: 197 KNLPSKSSKFPSYINTNDVLPVFILCFDESSSEQWETVQALQKAIKKQLFVESVPLPIFT 256

Query: 365 DKIYNNDKFVKLHEPMMSSVDETLYFLQQYLQKNSCVTDNKLPLSLVKYIYEMIANLSVN 424
           +  Y +D  V LH P+ +S+ E +Y         S     +L   LV  IYE I  +  +
Sbjct: 257 N--YESDPVV-LHPPITNSLQEQVY-------DGSHPPLLRLCPQLVDVIYETINAMVED 306

Query: 425 LIIPFMQRKIRFWDETILQPRKSIFR-NKLFKSFMNRXXXXXXXXXXXXXXXXXXXXXXX 483
           L+IPFM RKI FWDETILQPRKSIF  NK  K FMN+                       
Sbjct: 307 LMIPFMNRKISFWDETILQPRKSIFHGNKFLKRFMNKTNSSAAGT--------------- 351

Query: 484 XXLLTKDSNGHEYFSALSTEFQLRKLADWSMMVSDFKTAYTTYESLSRDLENTSKYMASC 543
              L+  S+G  YF A S EF LRKLADWS M+SD+KTAY+ Y  L RD E   +Y++SC
Sbjct: 352 ---LSTSSDG--YFLASSNEFLLRKLADWSFMLSDYKTAYSIYYILLRDFELYPQYLSSC 406

Query: 544 LEWWAVSILMGAQNIVTAKMLKNDVDPLIESALESYEKPLPPVXXXXXXXXXXXXXXXXX 603
            E+ A+S+LMGA +IVT KM+KND+DPLI   ++S                         
Sbjct: 407 QEFSALSLLMGAHSIVTTKMIKNDIDPLIMKYMDS------------------------- 441

Query: 604 XXXXATKAEVSLIENNHTIRSYEIRCMXXXXXXXXXXXDTWTSTPYALRYLETILSD--Y 661
                T A ++ +         + RC+           DTWTS P+A++YLE IL +   
Sbjct: 442 -----TVASLNYLG--------KFRCLVYMAELFLSLSDTWTSAPFAIKYLELILQNEQL 488

Query: 662 KLGPCSQTILWERLSFCYDLRVDPRIKRKPTITNINKGTKATGSEASHSSIKEVNEKYRN 721
           KLGP S+T+LWER+S+ Y LR+DPRI                            +++Y +
Sbjct: 489 KLGPLSRTMLWERISYAYQLRIDPRI--------------------------HTDDEYLS 522

Query: 722 DGKQEKYSIDRKNSLIIDVNSNEEYDCGYDILSDGFTXXXXXXXXXXXXXXXWSEQKQWR 781
           D   E  + D       D   N      + I S G T               W E    R
Sbjct: 523 DNFMELTTED-------DFCMNPNKLHHWRIHSLGLTRHRKEAVFRLLAAKKWLEYGHIR 575

Query: 782 QLDWCLKDIENVYKEVGFSD 801
           Q  W LK    VY+ +GF++
Sbjct: 576 QGAWSLKGCNKVYRNLGFAN 595

 Score = 68.6 bits (166), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 51/74 (68%)

Query: 3  FSYENYMNLLFHLDRTNEEIPTDIAKRIVQNSIAPLISVTATPELDKHVQDSYNIDSLYM 62
           SYE YMNL+ + +  ++ +P +I++R++ N+++P +SV +T  L+ H+ + ++  SLYM
Sbjct: 2  LSYETYMNLVHYPEHWSQPVPHEISRRVICNALSPCVSVQSTAALEAHLAEEFSEGSLYM 61

Query: 63 LLRYFGGCISDRDQ 76
          LLRYF   + +R +
Sbjct: 62 LLRYFADYVRERGE 75

>KLLA0F18953g Chr6 (1737522..1739465) [1944 bp, 647 aa] {ON} similar
           to uniprot|P46944 Saccharomyces cerevisiae YDR108W GSG1
           Subunit of TRAPP (transport protein particle) a
           multi-subunit complex involved in targeting and/or
           fusion of ER-to-Golgi transport vesicles with their
           acceptor compartment protein has late meiotic role
           following DNA replication
          Length = 647

 Score =  330 bits (846), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 215/627 (34%), Positives = 323/627 (51%), Gaps = 96/627 (15%)

Query: 185 RKRSNSLFQRDSTQSQYIRFTKPIPDLVNTRDPTDSLFDHQSLETLLKGYLK----IIET 240
           R RS+SLFQR +  S+ +RFT+ + DL++  D  D +     +++ L  YL+    I+  
Sbjct: 95  RHRSDSLFQRQA--SECVRFTRSLEDLISI-DSEDHILQSTDIDSFLSQYLQNLEPIMNE 151

Query: 241 NTTPDMPHNALKKSLYHRFFSMTVTSTTNLCPFESFDHPIVSLLSIDLTLNQNYDTAKEM 300
           N TP      LK S+YHRFF     S+ NL  + SF HP+V+LL +D+T  Q Y+ A+E+
Sbjct: 152 NGTPS---KLLKHSIYHRFF--ITLSSINLSRYHSFHHPVVALLPLDITKGQGYENAREI 206

Query: 301 LIKFKNIHSKTPNFPVYLNINDILPVFLLCYDASSPEQLDIAKKISTKIKKQLFFESILL 360
           LI FKN+++   NFP ++NINDILPVF+LCYD +S EQ +  + ++  +KKQLF ES+ +
Sbjct: 207 LIHFKNLNNTLENFPEFININDILPVFVLCYDENSREQWESVQALTKSLKKQLFVESVSI 266

Query: 361 PLWNDKIYNNDKFVKLHEPMMSSVDETLYFLQQYLQKNSCVTDNKLPLSLVKYIYEMIAN 420
            L+    ++N K   LH P+  S+ E ++ +       S  T   +P  L+ +IY+ I+ 
Sbjct: 267 SLFTP--HDNQKSTTLHSPITVSLHEQVFNM-------SHPTSINIPSRLLTHIYDTISF 317

Query: 421 LSVNLIIPFMQRKIRFWDETILQPRKSIFR-NKLFKSFMNRXXXXXXXXXXXXXXXXXXX 479
           +   ++IPFM RK+ FWDET+LQPRKSIF+ NK F+ F++                    
Sbjct: 318 IVEEMMIPFMHRKLVFWDETVLQPRKSIFQSNKFFRRFISPKSNHPIAHKVNDP------ 371

Query: 480 XXXXXXLLTKDSNGHEYFSALSTEFQLRKLADWSMMVSDFKTAYTTYESLSRDLENTSKY 539
                      + G   F A S EF LRKLADWS M+SDFK AY+ Y+ L++D E+  +Y
Sbjct: 372 --------QDPAEGDIMFPASSPEFLLRKLADWSFMLSDFKKAYSIYDLLTKDFESYPQY 423

Query: 540 MASCLEWWAVSILMGAQNIVTAKMLKNDVDPLIESALESYEKPLPPVXXXXXXXXXXXXX 599
           +A CLE+  +S+LMGAQNI+TAK +K +VDPL+  A+E Y+K                  
Sbjct: 424 LAPCLEYKTISLLMGAQNIITAKTIKTEVDPLMTRAIEQYKKQ----------------- 466

Query: 600 XXXXXXXXATKAEVSLIENNHTIRSYEIRCMXXXXXXXXXXXDTWTSTPYALRYLETILS 659
                            +  H++R   I C+           DTW S+P A+ YL  I  
Sbjct: 467 -----------------DEKHSLRV--IHCILTFSDLLLSLSDTWVSSPLAVNYLTYIQK 507

Query: 660 DYKLGPCSQTILWERLSF----CYDLRVDPRIKRKPTITNINKGTKATGSEASHSSIKEV 715
            + LGP +  I+ ER+++    C DLRV+     KP     ++  KA  SEA+ +S K  
Sbjct: 508 SHLLGPYATVIILERIAYAYEICIDLRVNDHFLPKP-----DEENKADESEAAENSKKGE 562

Query: 716 NEKYRNDGKQEKYSIDRKNSLIIDVNSNEEYDCGYDILSDGFTXXXXXXXXXXXXXXXWS 775
           N    +D  + +     +N LI +           ++ S+G T               W 
Sbjct: 563 NGLEVDDMHEWR----NENKLIQN-----------NLRSEGLTRFRKYSLYQLVAAKKWV 607

Query: 776 EQKQWRQLDWCLKDIENVYKEVGFSDR 802
           E  +  Q  WC+      Y+++  S R
Sbjct: 608 ELHKRNQAKWCIYHAAPAYEKLSLSKR 634

 Score = 82.4 bits (202), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 37/76 (48%), Positives = 54/76 (71%)

Query: 1  MPFSYENYMNLLFHLDRTNEEIPTDIAKRIVQNSIAPLISVTATPELDKHVQDSYNIDSL 60
          + FSYE YMNL+ + +  +  IP +I+K+++ N+++P I V +  ELD H++D YNIDS+
Sbjct: 3  LQFSYEKYMNLIQYPEHWSNPIPHEISKKVIYNTLSPCICVQSNLELDNHLKDMYNIDSI 62

Query: 61 YMLLRYFGGCISDRDQ 76
           ML RYFG  I DRDQ
Sbjct: 63 SMLFRYFGDYIQDRDQ 78

>Kpol_538.34 s538 complement(75072..76289) [1218 bp, 405 aa] {ON}
           complement(75072..76289) [1218 nt, 406 aa]
          Length = 405

 Score = 40.0 bits (92), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 39/92 (42%), Gaps = 5/92 (5%)

Query: 9   MNLLFHLDRTNEEIPTDIAKRIVQNSIAPLISVTATPELDKHV-QDSYNIDSLYMLLRYF 67
            N + H     +EIPT +A R  +N + PL   +  PE D H+ Q SY    +     Y 
Sbjct: 247 FNHIIHHFSFGKEIPTKLASRHSKNIVNPLDGRSVAPERDTHLHQFSYYTKIVPTRFEYL 306

Query: 68  GGCISDRDQYHEPHHQHP----NELDHKNELH 95
              + D  Q+   +H  P     + DH N  H
Sbjct: 307 NKAVVDTAQFSATYHDRPLRGGADDDHPNTFH 338

>Ecym_8169 Chr8 (355430..355444,355614..358658) [3060 bp, 1019 aa]
           {ON} similar to Ashbya gossypii AGR364C 1-intron
          Length = 1019

 Score = 33.1 bits (74), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 33/68 (48%), Gaps = 12/68 (17%)

Query: 197 TQSQYIRFT----KPIPDLVNTRDPTDSLFDHQSLETLLKGYLKIIETNTTPDMPHNALK 252
           T  Q +RF     +P P+ VN  DP+D+ F  Q +  +L G  K     TTP+      K
Sbjct: 695 TMYQILRFGYPKGRPTPNSVNESDPSDNYFRIQLISVILLGLEK-----TTPNFTK---K 746

Query: 253 KSLYHRFF 260
             L+ RFF
Sbjct: 747 IPLFMRFF 754

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.131    0.384 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 85,438,781
Number of extensions: 3599913
Number of successful extensions: 14287
Number of sequences better than 10.0: 44
Number of HSP's gapped: 14700
Number of HSP's successfully gapped: 86
Length of query: 889
Length of database: 53,481,399
Length adjustment: 119
Effective length of query: 770
Effective length of database: 39,836,145
Effective search space: 30673831650
Effective search space used: 30673831650
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 70 (31.6 bits)