Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0E043708.254ON67667635200.0
NCAS0B049708.254ON66666423740.0
NDAI0B023708.254ON72268123700.0
YLR083C (EMP70)8.254ON66766323690.0
Skud_12.1518.254ON66466423520.0
Smik_12.1428.254ON66366323520.0
Suva_10.1678.254ON68467423450.0
KAFR0B026808.254ON66466022760.0
CAGL0B01683g8.254ON69168222770.0
YDR107C (TMN2)8.254ON67266722730.0
Kpol_543.358.254ON65866922700.0
Suva_2.2678.254ON67266422630.0
ZYRO0C01848g8.254ON64766822300.0
KNAG0G019908.254ON66765922310.0
KLLA0F18931g8.254ON66566622220.0
Smik_4.3538.254ON69066422240.0
TBLA0H014508.254ON67368022200.0
Skud_4.3688.254ON67266422060.0
Kwal_56.235778.254ON68367521650.0
SAKL0H17248g8.254ON66066221220.0
TPHA0A018408.254ON68567921110.0
KLTH0G13882g8.254ON68767720890.0
NCAS0B038908.254ON66366620500.0
TDEL0F038108.254ON65666120270.0
AGR097W8.254ON65366318610.0
NDAI0J014208.254ON61963018530.0
Ecym_43178.254ON60566615460.0
NCAS0A145207.411ON6706984224e-43
ZYRO0B03784g7.411ON6586444073e-41
SAKL0F12914g7.411ON7077374032e-40
KNAG0C034307.411ON6807133987e-40
NDAI0A015107.411ON6796803881e-38
KLLA0E20835g7.411ON6766663721e-36
TDEL0C027107.411ON6786993676e-36
YER113C (TMN3)7.411ON7067413598e-35
CAGL0G03487g7.411ON7046893562e-34
Smik_5.2587.411ON7067033526e-34
Suva_5.2347.411ON7067243233e-30
KLTH0C06226g7.411ON6947043223e-30
Skud_5.2667.411ON7077293205e-30
Kwal_27.107467.411ON6907253152e-29
KAFR0K019507.411ON6646853142e-29
Ecym_71437.411ON6767082031e-15
TBLA0I003307.411ON7134711628e-11
Kpol_1045.287.411ON6817011611e-10
TPHA0K007307.411ON7332901441e-08
AGL295C7.411ON6571051351e-07
NCAS0B075601.303ON49558820.26
TBLA0A066703.338ON44046751.9
Suva_16.447.125ON54947733.4
NCAS0E021307.125ON52647723.9
NDAI0E036707.125ON52247724.5
Smik_6.4677.125ON54847724.9
Smik_13.2392.626ON32731715.0
YPL260W7.125ON55147725.0
CAGL0H09108g7.125ON53247715.2
KLLA0E15291gna 1ON693127725.3
Skud_16.187.125ON55047715.9
Ecym_83527.125ON57947716.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0E04370
         (676 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0E04370 Chr5 complement(1108954..1110984) [2031 bp, 676 aa] ...  1360   0.0  
NCAS0B04970 Chr2 complement(909770..911770) [2001 bp, 666 aa] {O...   919   0.0  
NDAI0B02370 Chr2 complement(593012..595180) [2169 bp, 722 aa] {O...   917   0.0  
YLR083C Chr12 complement(294091..296094) [2004 bp, 667 aa] {ON} ...   917   0.0  
Skud_12.151 Chr12 complement(277467..279461) [1995 bp, 664 aa] {...   910   0.0  
Smik_12.142 Chr12 complement(273932..275923) [1992 bp, 663 aa] {...   910   0.0  
Suva_10.167 Chr10 complement(299075..301129) [2055 bp, 684 aa] {...   907   0.0  
KAFR0B02680 Chr2 complement(537048..539042) [1995 bp, 664 aa] {O...   881   0.0  
CAGL0B01683g Chr2 complement(154275..156350) [2076 bp, 691 aa] {...   881   0.0  
YDR107C Chr4 complement(669016..671034) [2019 bp, 672 aa] {ON}  ...   880   0.0  
Kpol_543.35 s543 complement(78246..80222) [1977 bp, 658 aa] {ON}...   879   0.0  
Suva_2.267 Chr2 complement(463458..465476) [2019 bp, 672 aa] {ON...   876   0.0  
ZYRO0C01848g Chr3 (146621..148564) [1944 bp, 647 aa] {ON} simila...   863   0.0  
KNAG0G01990 Chr7 complement(441326..443329) [2004 bp, 667 aa] {O...   863   0.0  
KLLA0F18931g Chr6 complement(1734636..1736633) [1998 bp, 665 aa]...   860   0.0  
Smik_4.353 Chr4 complement(630320..632392) [2073 bp, 690 aa] {ON...   861   0.0  
TBLA0H01450 Chr8 complement(321416..323437) [2022 bp, 673 aa] {O...   859   0.0  
Skud_4.368 Chr4 complement(640627..642645) [2019 bp, 672 aa] {ON...   854   0.0  
Kwal_56.23577 s56 complement(605281..607332) [2052 bp, 683 aa] {...   838   0.0  
SAKL0H17248g Chr8 (1530599..1532581) [1983 bp, 660 aa] {ON} simi...   822   0.0  
TPHA0A01840 Chr1 (371758..373815) [2058 bp, 685 aa] {ON} Anc_8.2...   817   0.0  
KLTH0G13882g Chr7 (1204180..1206243) [2064 bp, 687 aa] {ON} simi...   809   0.0  
NCAS0B03890 Chr2 (693950..695941) [1992 bp, 663 aa] {ON} Anc_8.254    794   0.0  
TDEL0F03810 Chr6 complement(696251..698221) [1971 bp, 656 aa] {O...   785   0.0  
AGR097W Chr7 (920133..922094) [1962 bp, 653 aa] {ON} Syntenic ho...   721   0.0  
NDAI0J01420 Chr10 (326749..328608) [1860 bp, 619 aa] {ON} Anc_8....   718   0.0  
Ecym_4317 Chr4 (685854..687671) [1818 bp, 605 aa] {ON} similar t...   600   0.0  
NCAS0A14520 Chr1 complement(2860704..2862716) [2013 bp, 670 aa] ...   167   4e-43
ZYRO0B03784g Chr2 complement(314902..316878) [1977 bp, 658 aa] {...   161   3e-41
SAKL0F12914g Chr6 complement(1013914..1016037) [2124 bp, 707 aa]...   159   2e-40
KNAG0C03430 Chr3 (674411..676453) [2043 bp, 680 aa] {ON} Anc_7.4...   157   7e-40
NDAI0A01510 Chr1 (335693..337732) [2040 bp, 679 aa] {ON} Anc_7.4...   154   1e-38
KLLA0E20835g Chr5 complement(1857426..1859456) [2031 bp, 676 aa]...   147   1e-36
TDEL0C02710 Chr3 complement(474759..476795) [2037 bp, 678 aa] {O...   145   6e-36
YER113C Chr5 complement(387932..390052) [2121 bp, 706 aa] {ON}  ...   142   8e-35
CAGL0G03487g Chr7 complement(337133..339247) [2115 bp, 704 aa] {...   141   2e-34
Smik_5.258 Chr5 complement(396781..398901) [2121 bp, 706 aa] {ON...   140   6e-34
Suva_5.234 Chr5 complement(363605..365725) [2121 bp, 706 aa] {ON...   129   3e-30
KLTH0C06226g Chr3 (541022..543106) [2085 bp, 694 aa] {ON} simila...   128   3e-30
Skud_5.266 Chr5 (431486..433609) [2124 bp, 707 aa] {ON} YER113C ...   127   5e-30
Kwal_27.10746 s27 (479237..481309) [2073 bp, 690 aa] {ON} YER113...   125   2e-29
KAFR0K01950 Chr11 complement(401168..403162) [1995 bp, 664 aa] {...   125   2e-29
Ecym_7143 Chr7 (290555..292585) [2031 bp, 676 aa] {ON} similar t...    83   1e-15
TBLA0I00330 Chr9 (52200..54341) [2142 bp, 713 aa] {ON} Anc_7.411...    67   8e-11
Kpol_1045.28 s1045 (64235..66280) [2046 bp, 681 aa] {ON} (64237....    67   1e-10
TPHA0K00730 Chr11 (150877..153078) [2202 bp, 733 aa] {ON} Anc_7....    60   1e-08
AGL295C Chr7 complement(152197..154170) [1974 bp, 657 aa] {ON} S...    57   1e-07
NCAS0B07560 Chr2 complement(1426000..1427477,1427593..1427602) [...    36   0.26 
TBLA0A06670 Chr1 complement(1630701..1632023) [1323 bp, 440 aa] ...    33   1.9  
Suva_16.44 Chr16 (64828..66477) [1650 bp, 549 aa] {ON} YPL260W (...    33   3.4  
NCAS0E02130 Chr5 (408158..409738) [1581 bp, 526 aa] {ON} Anc_7.1...    32   3.9  
NDAI0E03670 Chr5 (792667..794235) [1569 bp, 522 aa] {ON} Anc_7.1...    32   4.5  
Smik_6.467 Chr6 complement(770217..771863) [1647 bp, 548 aa] {ON...    32   4.9  
Smik_13.239 Chr13 complement(375639..376622) [984 bp, 327 aa] {O...    32   5.0  
YPL260W Chr16 (49303..50958) [1656 bp, 551 aa] {ON} Putative sub...    32   5.0  
CAGL0H09108g Chr8 (889038..890636) [1599 bp, 532 aa] {ON} highly...    32   5.2  
KLLA0E15291g Chr5 complement(1359509..1361590) [2082 bp, 693 aa]...    32   5.3  
Skud_16.18 Chr16 (28372..30024) [1653 bp, 550 aa] {ON} YPL260W (...    32   5.9  
Ecym_8352 Chr8 complement(703563..705302) [1740 bp, 579 aa] {ON}...    32   6.3  

>TBLA0E04370 Chr5 complement(1108954..1110984) [2031 bp, 676 aa]
           {ON} Anc_8.254 YLR083C
          Length = 676

 Score = 1360 bits (3520), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 665/676 (98%), Positives = 665/676 (98%)

Query: 1   MTKLITAVSICLITLSVTNGFYLPGVAPTTYHELDSIPLLVNHLTPSMFFKHKDSDGNEL 60
           MTKLITAVSICLITLSVTNGFYLPGVAPTTYHELDSIPLLVNHLTPSMFFKHKDSDGNEL
Sbjct: 1   MTKLITAVSICLITLSVTNGFYLPGVAPTTYHELDSIPLLVNHLTPSMFFKHKDSDGNEL 60

Query: 61  SSDKENFLYSYDYYYSKLHFCKPLDREIKKQPESLGSILFGDRIYNSPFELKMLVDENCK 120
           SSDKENFLYSYDYYYSKLHFCKPLDREIKKQPESLGSILFGDRIYNSPFELKMLVDENCK
Sbjct: 61  SSDKENFLYSYDYYYSKLHFCKPLDREIKKQPESLGSILFGDRIYNSPFELKMLVDENCK 120

Query: 121 ELCSTNIPGDDAKFINDLIKSGFLQNWLIDGLPAARQLYDQTTKSSFYGSGFELGSVEMI 180
           ELCSTNIPGDDAKFINDLIKSGFLQNWLIDGLPAARQLYDQTTKSSFYGSGFELGSVEMI
Sbjct: 121 ELCSTNIPGDDAKFINDLIKSGFLQNWLIDGLPAARQLYDQTTKSSFYGSGFELGSVEMI 180

Query: 181 QVVDEAPSHTTPKQPIVEDVLSQELDEEQATEKRANQMLVSSVERTYFANHFDIHIEYHD 240
           QVVDEAPSHTTPKQPIVEDVLSQELDEEQATEKRANQMLVSSVERTYFANHFDIHIEYHD
Sbjct: 181 QVVDEAPSHTTPKQPIVEDVLSQELDEEQATEKRANQMLVSSVERTYFANHFDIHIEYHD 240

Query: 241 RGNNEYRIVGVTVNPISMKRDSAICDTNLGKLALSEVSDTDVIFTYSVTFEKSDTVWATR 300
           RGNNEYRIVGVTVNPISMKRDSAICDTNLGKLALSEVSDTDVIFTYSVTFEKSDTVWATR
Sbjct: 241 RGNNEYRIVGVTVNPISMKRDSAICDTNLGKLALSEVSDTDVIFTYSVTFEKSDTVWATR 300

Query: 301 WDKYLHIYDPTIQWFSLINFTXXXXXXXXXXXHFLTKALKNDFVRYNEFNLNDSFDEDSG 360
           WDKYLHIYDPTIQWFSLINFT           HFLTKALKNDFVRYNEFNLNDSFDEDSG
Sbjct: 301 WDKYLHIYDPTIQWFSLINFTVIVVVLSIIVVHFLTKALKNDFVRYNEFNLNDSFDEDSG 360

Query: 361 WKLAHGDVFRIPTKSMLLSIFVGSGTQLFFMISSVLVLAALGFLSPSARGSLPTIMFILY 420
           WKLAHGDVFRIPTKSMLLSIFVGSGTQLFFMISSVLVLAALGFLSPSARGSLPTIMFILY
Sbjct: 361 WKLAHGDVFRIPTKSMLLSIFVGSGTQLFFMISSVLVLAALGFLSPSARGSLPTIMFILY 420

Query: 421 AVFGFVGSYTSMGVYRFFNGPYWKANMILTPLIVPGGIFMFIISMNLFLVFVHSSDVVPI 480
           AVFGFVGSYTSMGVYRFFNGPYWKANMILTPLIVPGGIFMFIISMNLFLVFVHSSDVVPI
Sbjct: 421 AVFGFVGSYTSMGVYRFFNGPYWKANMILTPLIVPGGIFMFIISMNLFLVFVHSSDVVPI 480

Query: 481 GTLSLMVLLWIVLSLPLSFAGSLISFKRCTWYDHPTKTNEVLRQIPFQPWYLKTVPATLI 540
           GTLSLMVLLWIVLSLPLSFAGSLISFKRCTWYDHPTKTNEVLRQIPFQPWYLKTVPATLI
Sbjct: 481 GTLSLMVLLWIVLSLPLSFAGSLISFKRCTWYDHPTKTNEVLRQIPFQPWYLKTVPATLI 540

Query: 541 GGIFPFGSIAVELYFIYSSLWFNKIFYMFGFLLVSFLLLTMTTSLVTIIVTYHSLCLENW 600
           GGIFPFGSIAVELYFIYSSLWFNKIFYMFGFLLVSFLLLTMTTSLVTIIVTYHSLCLENW
Sbjct: 541 GGIFPFGSIAVELYFIYSSLWFNKIFYMFGFLLVSFLLLTMTTSLVTIIVTYHSLCLENW 600

Query: 601 RWQWRSFIIGGIGCSIYIFIHSILFTEFKLGGFITIVLYVGYSALIAILCAMVTGAIGFI 660
           RWQWRSFIIGGIGCSIYIFIHSILFTEFKLGGFITIVLYVGYSALIAILCAMVTGAIGFI
Sbjct: 601 RWQWRSFIIGGIGCSIYIFIHSILFTEFKLGGFITIVLYVGYSALIAILCAMVTGAIGFI 660

Query: 661 SNMFFVKKIYSSIKVE 676
           SNMFFVKKIYSSIKVE
Sbjct: 661 SNMFFVKKIYSSIKVE 676

>NCAS0B04970 Chr2 complement(909770..911770) [2001 bp, 666 aa] {ON} 
          Length = 666

 Score =  919 bits (2374), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 448/664 (67%), Positives = 533/664 (80%), Gaps = 13/664 (1%)

Query: 15  LSVTNGFYLPGVAPTTYHELDSIPLLVNHLTPSMFFKHKDSDGNELSSDKENFLYSYDYY 74
           LS+T  FYLPGVAPTTYHE D IPLLVNHLTPS++F+  D++G   S +KE+FLYS+DYY
Sbjct: 14  LSLTRAFYLPGVAPTTYHEGDEIPLLVNHLTPSVYFQRTDANGK--SKNKEHFLYSFDYY 71

Query: 75  YSKLHFCKPLDREIKKQPESLGSILFGDRIYNSPFELKMLVDENCKELCSTNIPGDDAKF 134
           + +LHFCKP    I+KQPESLGSI+FGDRIYNSPFELKML ++ C  LC + IPG DAKF
Sbjct: 72  FDRLHFCKP--EHIEKQPESLGSIIFGDRIYNSPFELKMLEEKTCVSLCKSTIPGKDAKF 129

Query: 135 INDLIKSGFLQNWLIDGLPAARQLYDQTTKSSFYGSGFELGSVEMIQVVD-EAPSHTTPK 193
           IN LIK+GF QNWLIDGLPAA Q+YD+ TKS FYG+GFELG VE  Q +D +AP+ T PK
Sbjct: 130 INKLIKNGFFQNWLIDGLPAATQVYDRKTKSEFYGTGFELGFVESFQAIDGQAPATTKPK 189

Query: 194 QPIVEDVLSQELDEEQATEKRANQMLVSSVERTYFANHFDIHIEYHDRGNNEYRIVGVTV 253
           Q   E +       E  T +  N  +V ++E  YF NH+DI +EYHDRG   YR+VGV V
Sbjct: 190 QTTNEGL-------ELETREAKNVQMVKNIEIAYFVNHYDIQVEYHDRGEGTYRVVGVIV 242

Query: 254 NPISMKRDS-AICDTNLGKLALSEVSDTDVIFTYSVTFEKSDTVWATRWDKYLHIYDPTI 312
           NP+S+KR +   C+T    L LSE +D DV FTYSV F  S+TVWATRWDKYLH YDPTI
Sbjct: 243 NPVSIKRSTPGTCETTGDPLVLSEDADNDVYFTYSVKFVPSETVWATRWDKYLHTYDPTI 302

Query: 313 QWFSLINFTXXXXXXXXXXXHFLTKALKNDFVRYNEFNLNDSFDEDSGWKLAHGDVFRIP 372
           QWFSL+NF+           H L KALK+DF RYNEFNL D F ED+GWKL HGDVFRIP
Sbjct: 303 QWFSLVNFSIIVLLLSSVVIHSLMKALKSDFARYNEFNLEDDFQEDAGWKLGHGDVFRIP 362

Query: 373 TKSMLLSIFVGSGTQLFFMISSVLVLAALGFLSPSARGSLPTIMFILYAVFGFVGSYTSM 432
            KSMLLS+ VGSG QLF MIS  +  AALGFLSPS+RGSL T+MFILYA+FGFVGSYTSM
Sbjct: 363 HKSMLLSVLVGSGVQLFLMISCSIFFAALGFLSPSSRGSLATVMFILYALFGFVGSYTSM 422

Query: 433 GVYRFFNGPYWKANMILTPLIVPGGIFMFIISMNLFLVFVHSSDVVPIGTLSLMVLLWIV 492
            VY+FF GPYWK NM+LTP ++PG IF+ I+ +N FL+F HSS VVP GTL  M+LLW +
Sbjct: 423 AVYKFFKGPYWKVNMLLTPFMIPGFIFLTIVGLNFFLMFAHSSGVVPAGTLFFMILLWFI 482

Query: 493 LSLPLSFAGSLISFKRCTWYDHPTKTNEVLRQIPFQPWYLKTVPATLIGGIFPFGSIAVE 552
            S+PL+FAGSLI+ K+CTW +HPTKTN++ RQIPFQPWYLKT PAT+I GIFPFGSIAVE
Sbjct: 483 FSIPLAFAGSLIAHKKCTWDEHPTKTNQIARQIPFQPWYLKTWPATMIAGIFPFGSIAVE 542

Query: 553 LYFIYSSLWFNKIFYMFGFLLVSFLLLTMTTSLVTIIVTYHSLCLENWRWQWRSFIIGGI 612
           LYFIY+SLWFNKIFYMFGFLL SFLLLT+TTSLVTI++TYHSLCLENW+WQWR FI+GG+
Sbjct: 543 LYFIYTSLWFNKIFYMFGFLLFSFLLLTLTTSLVTILITYHSLCLENWQWQWRGFIVGGV 602

Query: 613 GCSIYIFIHSILFTEFKLGGFITIVLYVGYSALIAILCAMVTGAIGFISNMFFVKKIYSS 672
           GC+IY+F+HSILFT+FKLGGF TIVLYVGYS +I++L  +VTGAIGF+S++ FV+KIYS+
Sbjct: 603 GCAIYVFVHSILFTKFKLGGFATIVLYVGYSTMISLLFCVVTGAIGFLSSLIFVRKIYSA 662

Query: 673 IKVE 676
           IKV+
Sbjct: 663 IKVD 666

>NDAI0B02370 Chr2 complement(593012..595180) [2169 bp, 722 aa] {ON}
           Anc_8.254
          Length = 722

 Score =  917 bits (2370), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 454/681 (66%), Positives = 538/681 (79%), Gaps = 13/681 (1%)

Query: 1   MTKLITAVSICLI---TLSVTNGFYLPGVAPTTYHELDSIPLLVNHLTPSMFFKHKDSDG 57
           + K + A S+ L+    LS+T  FYLPGVAPTTYH  D IPLLVNHLTPSM+F+HK+ DG
Sbjct: 50  LRKTMIAPSLVLLFAFCLSLTRAFYLPGVAPTTYHPDDEIPLLVNHLTPSMYFQHKNEDG 109

Query: 58  NELSSDKENFLYSYDYYYSKLHFCKPLDREIKKQPESLGSILFGDRIYNSPFELKMLVDE 117
             + SDKE FLYSYDYYY + HFC+P    I+KQPESLGSI+FGDRIYNSPF++ ML D+
Sbjct: 110 KTMKSDKERFLYSYDYYYDRFHFCQP--EHIEKQPESLGSIIFGDRIYNSPFQINMLQDK 167

Query: 118 NCKELCSTNIPGDDAKFINDLIKSGFLQNWLIDGLPAARQLYDQTTKSSFYGSGFELGSV 177
            C  LC T IPG DAKFIN LIK+GF QNWLIDGLPAARQ+YD  TK+ FYG+GFELG V
Sbjct: 168 TCVSLCKTTIPGKDAKFINKLIKNGFFQNWLIDGLPAARQVYDSRTKTEFYGTGFELGFV 227

Query: 178 EMIQVVDEAP-SHTTPKQPIVEDVLSQELDEEQATEKRANQMLVSSVERTYFANHFDIHI 236
           +++Q       ++T  K+P   + L  ELD   A     N  ++ + E  YFANHFDI +
Sbjct: 228 DVVQGTTTGDNANTVAKKPTTNEGL--ELDTRDA----KNVQMLKNFELPYFANHFDIQV 281

Query: 237 EYHDRGNNEYRIVGVTVNPISMKRDS-AICDTNLGKLALSEVSDTDVIFTYSVTFEKSDT 295
           EYHDRG N YR+VGV VNP+S+KR +   C+T+   L LSE  D DV FTYSV F  S+T
Sbjct: 282 EYHDRGENNYRVVGVIVNPVSIKRSTPGTCETSGAPLMLSEDQDNDVYFTYSVKFIPSET 341

Query: 296 VWATRWDKYLHIYDPTIQWFSLINFTXXXXXXXXXXXHFLTKALKNDFVRYNEFNLNDSF 355
           +WATRWDKYLHIYDP IQWFSLINF+           H L KALK+DF RYNE NL+D F
Sbjct: 342 IWATRWDKYLHIYDPAIQWFSLINFSVVVLLLSSVVIHSLLKALKSDFARYNELNLDDDF 401

Query: 356 DEDSGWKLAHGDVFRIPTKSMLLSIFVGSGTQLFFMISSVLVLAALGFLSPSARGSLPTI 415
            E++GWKL HGDVFRIP +S+LLS+ VGSG QLF MI   +  AALGFLSPS+RGSL T+
Sbjct: 402 QEEAGWKLGHGDVFRIPHRSLLLSVLVGSGVQLFLMIICSIFFAALGFLSPSSRGSLATV 461

Query: 416 MFILYAVFGFVGSYTSMGVYRFFNGPYWKANMILTPLIVPGGIFMFIISMNLFLVFVHSS 475
           MFILYA+FGFVGSYTSMGVY+FF GPYWK NM+LTP++VPG IF  I+++N+FL+FVHSS
Sbjct: 462 MFILYALFGFVGSYTSMGVYKFFGGPYWKVNMLLTPILVPGLIFCGIVALNIFLLFVHSS 521

Query: 476 DVVPIGTLSLMVLLWIVLSLPLSFAGSLISFKRCTWYDHPTKTNEVLRQIPFQPWYLKTV 535
            V+P  TL  M+LLW V S+PL+ AGSLI+ K+C W +HPTKTN++ RQIPFQPWYLKT 
Sbjct: 522 GVIPAVTLFFMILLWFVFSIPLALAGSLIAHKKCNWDEHPTKTNQIARQIPFQPWYLKTW 581

Query: 536 PATLIGGIFPFGSIAVELYFIYSSLWFNKIFYMFGFLLVSFLLLTMTTSLVTIIVTYHSL 595
           PATLI GIFPFGSIAVELYFIYSSLWFNKIFYMFGFLL SF LLT+TTSLVTI++TYHSL
Sbjct: 582 PATLIAGIFPFGSIAVELYFIYSSLWFNKIFYMFGFLLFSFFLLTLTTSLVTILITYHSL 641

Query: 596 CLENWRWQWRSFIIGGIGCSIYIFIHSILFTEFKLGGFITIVLYVGYSALIAILCAMVTG 655
           CLENW WQWR FIIGG+GC+IY+FIHSILFT+FKLGGF TIVLYVGYS +I++L  +VTG
Sbjct: 642 CLENWMWQWRGFIIGGVGCAIYVFIHSILFTKFKLGGFTTIVLYVGYSTIISLLFCIVTG 701

Query: 656 AIGFISNMFFVKKIYSSIKVE 676
           AIGF+S+MFF++KIYSSIKVE
Sbjct: 702 AIGFLSSMFFIRKIYSSIKVE 722

>YLR083C Chr12 complement(294091..296094) [2004 bp, 667 aa] {ON}
           EMP70Protein with a role in cellular adhesion,
           filamentous growth, and endosome-to-vacuole sorting;
           similar to Tmn2p and Tmn3p; member of Transmembrane Nine
           family of proteins with 9 transmembrane segments
          Length = 667

 Score =  917 bits (2369), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 444/663 (66%), Positives = 533/663 (80%), Gaps = 13/663 (1%)

Query: 15  LSVTNGFYLPGVAPTTYHELDSIPLLVNHLTPSMFFKHKDSDGNELSSDKENFLYSYDYY 74
           +S    FYLPGVAPTTY E D+IPLLVNHLTPSM ++HKD DGN +S DKENFLYSYDYY
Sbjct: 17  VSTVKAFYLPGVAPTTYRENDNIPLLVNHLTPSMNYQHKDEDGNNVSGDKENFLYSYDYY 76

Query: 75  YSKLHFCKPLDREIKKQPESLGSILFGDRIYNSPFELKMLVDENCKELCSTNIPGDDAKF 134
           Y++ HFC+P   +++KQPESLGS++FGDRIYNSPF+L ML ++ C+ LC T IPGDDAKF
Sbjct: 77  YNRFHFCQP--EKVEKQPESLGSVIFGDRIYNSPFQLNMLQEKECESLCKTVIPGDDAKF 134

Query: 135 INDLIKSGFLQNWLIDGLPAARQLYDQTTKSSFYGSGFELGSVEMIQVVDEAPSHTTPKQ 194
           IN LIK+GF QNWLIDGLPAAR++YD  TK+SFYG+GF LG V++ Q  D      TPK 
Sbjct: 135 INKLIKNGFFQNWLIDGLPAAREVYDGRTKTSFYGAGFNLGFVQVTQGTD---IEATPKG 191

Query: 195 PIVEDVLSQELDEEQATEKRANQMLVSSVERTYFANHFDIHIEYHDRGNNEYRIVGVTVN 254
                  ++  D++   E R ++ +V + E  YFANHFDI IEYHDRG   YR+VGV V 
Sbjct: 192 -------AETTDKDVELETRNDRNMVKTYELPYFANHFDIMIEYHDRGEGNYRVVGVIVE 244

Query: 255 PISMKRDS-AICDTNLGKLALSEVSDTDVIFTYSVTFEKSDTVWATRWDKYLHIYDPTIQ 313
           P+S+KR S   C+T    L L E +D +V FTYSV F +S T WATRWDKYLH+YDP+IQ
Sbjct: 245 PVSIKRSSPGTCETTGSPLMLDEGNDNEVYFTYSVKFNESATSWATRWDKYLHVYDPSIQ 304

Query: 314 WFSLINFTXXXXXXXXXXXHFLTKALKNDFVRYNEFNLNDSFDEDSGWKLAHGDVFRIPT 373
           WFSLINF+           H L +ALK+DF RYNE NL+D F EDSGWKL HGDVFR P+
Sbjct: 305 WFSLINFSLVVVLLSSVVIHSLLRALKSDFARYNELNLDDDFQEDSGWKLNHGDVFRSPS 364

Query: 374 KSMLLSIFVGSGTQLFFMISSVLVLAALGFLSPSARGSLPTIMFILYAVFGFVGSYTSMG 433
           +S+ LSI VGSG QLF M++  +  AALGFLSPS+RGSL T+MFILYA+FGFVGSYTSMG
Sbjct: 365 QSLTLSILVGSGVQLFLMVTCSIFFAALGFLSPSSRGSLATVMFILYALFGFVGSYTSMG 424

Query: 434 VYRFFNGPYWKANMILTPLIVPGGIFMFIISMNLFLVFVHSSDVVPIGTLSLMVLLWIVL 493
           +Y+FFNGPYWKAN+ILTPL+VPG I + II++N FL+FVHSS V+P  TL  MV LW + 
Sbjct: 425 IYKFFNGPYWKANLILTPLLVPGAILLIIIALNFFLMFVHSSGVIPASTLFFMVFLWFLF 484

Query: 494 SLPLSFAGSLISFKRCTWYDHPTKTNEVLRQIPFQPWYLKTVPATLIGGIFPFGSIAVEL 553
           S+PLSFAGSLI+ KRC W +HPTKTN++ RQIPFQPWYLKT+PATLI GIFPFGSIAVEL
Sbjct: 485 SIPLSFAGSLIARKRCHWDEHPTKTNQIARQIPFQPWYLKTIPATLIAGIFPFGSIAVEL 544

Query: 554 YFIYSSLWFNKIFYMFGFLLVSFLLLTMTTSLVTIIVTYHSLCLENWRWQWRSFIIGGIG 613
           YFIY+SLWFNKIFYMFGFL  SFLLLT+T+SLVTI++TYHSLCLENW+WQWR FIIGG G
Sbjct: 545 YFIYTSLWFNKIFYMFGFLFFSFLLLTLTSSLVTILITYHSLCLENWKWQWRGFIIGGAG 604

Query: 614 CSIYIFIHSILFTEFKLGGFITIVLYVGYSALIAILCAMVTGAIGFISNMFFVKKIYSSI 673
           C++Y+FIHSILFT+FKLGGF TIVLYVGYS++I++LC +VTG+IGFIS+M FV+KIYSSI
Sbjct: 605 CALYVFIHSILFTKFKLGGFTTIVLYVGYSSVISLLCCLVTGSIGFISSMLFVRKIYSSI 664

Query: 674 KVE 676
           KV+
Sbjct: 665 KVD 667

>Skud_12.151 Chr12 complement(277467..279461) [1995 bp, 664 aa] {ON}
           YLR083C (REAL)
          Length = 664

 Score =  910 bits (2352), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 440/664 (66%), Positives = 533/664 (80%), Gaps = 14/664 (2%)

Query: 15  LSVTNGFYLPGVAPTTYHELDSIPLLVNHLTPSMFFKHKDSDGNELSSDKENFLYSYDYY 74
           +S T  FYLPGVAPTTY E D IPLLVNHLTPSM+++H+D  GN +S DKENFLYSYDYY
Sbjct: 13  VSATKAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHEDEQGNSVSGDKENFLYSYDYY 72

Query: 75  YSKLHFCKPLDREIKKQPESLGSILFGDRIYNSPFELKMLVDENCKELCSTNIPGDDAKF 134
           Y + HFC+P  + ++KQPESLGS++FGDRIYNSPFEL ML ++ C  LC+T IPG+DAKF
Sbjct: 73  YDRFHFCRP--KHVEKQPESLGSVIFGDRIYNSPFELNMLQEKECVPLCNTTIPGNDAKF 130

Query: 135 INDLIKSGFLQNWLIDGLPAARQLYDQTTKSSFYGSGFELGSVEMIQVVDEAPSHTTPKQ 194
           IN LIK+GF QNWLIDGLPAAR++YD  TK++FYG+GFELG VE+ Q      S T PKQ
Sbjct: 131 INKLIKNGFFQNWLIDGLPAAREVYDGRTKTNFYGAGFELGDVEVSQ---GTRSKTAPKQ 187

Query: 195 PIVEDVLSQELDEEQATEKRANQM-LVSSVERTYFANHFDIHIEYHDRGNNEYRIVGVTV 253
                  ++  +E      RA    +V + E  YFANHFDI IEYHDRG  +YR+VGV V
Sbjct: 188 -------AETTNEGLELGTRAEDYSIVETFEHPYFANHFDIMIEYHDRGGGDYRVVGVIV 240

Query: 254 NPISMKRD-SAICDTNLGKLALSEVSDTDVIFTYSVTFEKSDTVWATRWDKYLHIYDPTI 312
           NP+S+KR  +  C+T+   L L E  D +V FTYSV F++S T WATRWDKYLH+YDP+I
Sbjct: 241 NPLSIKRSITGTCETDASPLILDEERDNEVSFTYSVKFKESATSWATRWDKYLHVYDPSI 300

Query: 313 QWFSLINFTXXXXXXXXXXXHFLTKALKNDFVRYNEFNLNDSFDEDSGWKLAHGDVFRIP 372
           QWFSLINF+           H L +ALK+DF RYNE NL D F EDSGWKL HGDVFR P
Sbjct: 301 QWFSLINFSLVVVLLSSVVIHSLLRALKSDFARYNELNLEDDFQEDSGWKLNHGDVFRPP 360

Query: 373 TKSMLLSIFVGSGTQLFFMISSVLVLAALGFLSPSARGSLPTIMFILYAVFGFVGSYTSM 432
           + S+LLSI VGSG QLF M++  +  AALGFLSPS+RGSL T+MFILYA+FGFVGSYTSM
Sbjct: 361 SHSLLLSILVGSGVQLFLMVTCSIFFAALGFLSPSSRGSLATVMFILYALFGFVGSYTSM 420

Query: 433 GVYRFFNGPYWKANMILTPLIVPGGIFMFIISMNLFLVFVHSSDVVPIGTLSLMVLLWIV 492
           G+Y+FFNGPYWKAN++LTPL+VPG I + I+++N FL+ VHSS V+P  TL  MV LW +
Sbjct: 421 GIYKFFNGPYWKANLLLTPLLVPGAILLIIVALNFFLMVVHSSGVIPARTLFFMVFLWFL 480

Query: 493 LSLPLSFAGSLISFKRCTWYDHPTKTNEVLRQIPFQPWYLKTVPATLIGGIFPFGSIAVE 552
            S+PLSF GSLI+ K+C W +HPTKTN++ RQIPFQPWYLKT+PATLI GIFPFGSIAVE
Sbjct: 481 FSIPLSFGGSLIARKKCGWDEHPTKTNQIARQIPFQPWYLKTIPATLIAGIFPFGSIAVE 540

Query: 553 LYFIYSSLWFNKIFYMFGFLLVSFLLLTMTTSLVTIIVTYHSLCLENWRWQWRSFIIGGI 612
           LYFIY+SLWFNKIFYMFGFL  SFLLLT+TTSLVTI++TYHSLCLENW+WQWR FI+GG+
Sbjct: 541 LYFIYTSLWFNKIFYMFGFLFFSFLLLTLTTSLVTILITYHSLCLENWKWQWRGFIVGGV 600

Query: 613 GCSIYIFIHSILFTEFKLGGFITIVLYVGYSALIAILCAMVTGAIGFISNMFFVKKIYSS 672
           GC++Y+FIHSILFT+FKLGGF+TIVLYVGYS +I++LC +VTG+IGFIS+MFF+++IYSS
Sbjct: 601 GCALYVFIHSILFTKFKLGGFVTIVLYVGYSYVISLLCCLVTGSIGFISSMFFLRRIYSS 660

Query: 673 IKVE 676
           IKV+
Sbjct: 661 IKVD 664

>Smik_12.142 Chr12 complement(273932..275923) [1992 bp, 663 aa] {ON}
           YLR083C (REAL)
          Length = 663

 Score =  910 bits (2352), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 438/663 (66%), Positives = 532/663 (80%), Gaps = 13/663 (1%)

Query: 15  LSVTNGFYLPGVAPTTYHELDSIPLLVNHLTPSMFFKHKDSDGNELSSDKENFLYSYDYY 74
           +S    FYLPGVAPTTY E D IPLLVNHLTPSM+++HKD +GN +S DKENFLYSYDYY
Sbjct: 13  VSTAKAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHKDEEGNNVSGDKENFLYSYDYY 72

Query: 75  YSKLHFCKPLDREIKKQPESLGSILFGDRIYNSPFELKMLVDENCKELCSTNIPGDDAKF 134
            S+ HFCKP   +++KQPESLGSI+FGDRIYNSPF+LKML ++ C  LC   IPG+DAKF
Sbjct: 73  NSRFHFCKP--EKVEKQPESLGSIIFGDRIYNSPFQLKMLEEKECVSLCKKTIPGNDAKF 130

Query: 135 INDLIKSGFLQNWLIDGLPAARQLYDQTTKSSFYGSGFELGSVEMIQVVDEAPSHTTPKQ 194
           IN LIK+GF QNWLIDGLPAAR + D+ TK+SFYG+GFELG VE+ Q      S  TP  
Sbjct: 131 INKLIKNGFFQNWLIDGLPAARNVSDKRTKTSFYGAGFELGFVEVTQ---GTASEATPNT 187

Query: 195 PIVEDVLSQELDEEQATEKRANQMLVSSVERTYFANHFDIHIEYHDRGNNEYRIVGVTVN 254
                  ++  ++    + R    +V + E  YF NH+DI IEYHDRG   YR+VGV VN
Sbjct: 188 -------AETTNQGVELDTRDGHNMVQTYEHPYFTNHYDIRIEYHDRGEGNYRVVGVIVN 240

Query: 255 PISMKR-DSAICDTNLGKLALSEVSDTDVIFTYSVTFEKSDTVWATRWDKYLHIYDPTIQ 313
           P+S+KR D   C+T+   L L E +D +V FTYSV F +S+T WATRWDKYLH+YDP+IQ
Sbjct: 241 PVSIKRSDPETCETDGSPLMLDEENDNEVYFTYSVKFVESETSWATRWDKYLHVYDPSIQ 300

Query: 314 WFSLINFTXXXXXXXXXXXHFLTKALKNDFVRYNEFNLNDSFDEDSGWKLAHGDVFRIPT 373
           WFSLINF+           H L +ALK+DF RYNE NL+D F EDSGWKL+HGDVFR P+
Sbjct: 301 WFSLINFSLVVVLLSSVVIHSLLRALKSDFARYNELNLDDDFQEDSGWKLSHGDVFRAPS 360

Query: 374 KSMLLSIFVGSGTQLFFMISSVLVLAALGFLSPSARGSLPTIMFILYAVFGFVGSYTSMG 433
           +S+ LSI VGSG QLFFM++  +  AALGFLSPS+RGSL T+MF+LYA+FGFVGSYTSMG
Sbjct: 361 RSLTLSILVGSGVQLFFMVTCSIFFAALGFLSPSSRGSLATVMFMLYALFGFVGSYTSMG 420

Query: 434 VYRFFNGPYWKANMILTPLIVPGGIFMFIISMNLFLVFVHSSDVVPIGTLSLMVLLWIVL 493
           +Y+FF+GPYWKAN+ILTPL+VPG I + II++N FL+FVHSS V+P  TL  MV LW + 
Sbjct: 421 IYKFFDGPYWKANLILTPLLVPGTILIIIIALNFFLMFVHSSGVIPASTLFFMVFLWFLF 480

Query: 494 SLPLSFAGSLISFKRCTWYDHPTKTNEVLRQIPFQPWYLKTVPATLIGGIFPFGSIAVEL 553
           S+PLSFAGSL++ K+C W +HPTKTN++ RQIPFQPWYLKTVPATLI G+FPFGSIAVEL
Sbjct: 481 SIPLSFAGSLVARKKCHWDEHPTKTNQIARQIPFQPWYLKTVPATLIAGVFPFGSIAVEL 540

Query: 554 YFIYSSLWFNKIFYMFGFLLVSFLLLTMTTSLVTIIVTYHSLCLENWRWQWRSFIIGGIG 613
           YFIY+SLWFNKIFYMFGFL  SFLLLT+TTSLVTI++TYHSLCLENW+WQWR FI+GG G
Sbjct: 541 YFIYTSLWFNKIFYMFGFLFFSFLLLTLTTSLVTILITYHSLCLENWKWQWRGFIVGGAG 600

Query: 614 CSIYIFIHSILFTEFKLGGFITIVLYVGYSALIAILCAMVTGAIGFISNMFFVKKIYSSI 673
           C++Y+FIHSILFT+FKLGGF TIVLYVGYS++I++LC +VTG+IGFIS+MFF++KIYSSI
Sbjct: 601 CALYVFIHSILFTKFKLGGFTTIVLYVGYSSVISLLCCLVTGSIGFISSMFFIRKIYSSI 660

Query: 674 KVE 676
           KV+
Sbjct: 661 KVD 663

>Suva_10.167 Chr10 complement(299075..301129) [2055 bp, 684 aa] {ON}
           YLR083C (REAL)
          Length = 684

 Score =  907 bits (2345), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 439/674 (65%), Positives = 532/674 (78%), Gaps = 14/674 (2%)

Query: 15  LSVTNGFYLPGVAPTTYHELDSIPLLVNHLTPSMFFKHKDSDGNELSSDKENFLYSYDYY 74
           +S    FYLPGVAPTTY E D IPLLVNHLTPSM+++H+D DGN +S DKE+FLYSYDYY
Sbjct: 13  VSAARAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHQDEDGNNVSGDKEHFLYSYDYY 72

Query: 75  YSKLHFCKPLDREIKKQPESLGSILFGDRIYNSPFELKMLVDENCKELCSTNIPGDDAKF 134
           Y K HFCKP    ++KQPESLGSI+FGDRIYNSPFEL ML ++ C  LC T IPGDDAKF
Sbjct: 73  YDKFHFCKP--EHVEKQPESLGSIIFGDRIYNSPFELNMLQEKECVSLCKTVIPGDDAKF 130

Query: 135 INDLIKSGFLQNWLIDGLPAARQLYDQTTKSSFYGSGFELGSVEMIQVVDEAPSHTTPKQ 194
           IN LIK+GF QNWLIDGLPAAR+++D  TK+ FYG+GF LG VE+ QVVD          
Sbjct: 131 INKLIKNGFFQNWLIDGLPAAREVHDGRTKTDFYGAGFGLGFVEVAQVVDSETEQVQVAS 190

Query: 195 PIVEDVLSQELDEEQATEKRANQ-----------MLVSSVERTYFANHFDIHIEYHDRGN 243
              E   + +   E    K +N+            +V + E  YFANHFDI IEYHDRG 
Sbjct: 191 GETEQTQAADGKTEPEKGKSSNEGMELDARDQGKNMVKTREFPYFANHFDIKIEYHDRGE 250

Query: 244 NEYRIVGVTVNPISMKRDS-AICDTNLGKLALSEVSDTDVIFTYSVTFEKSDTVWATRWD 302
             YR+VGV VNP+S+KR S   C+TN   L L E +D +V FTYSV FE+S T WATRWD
Sbjct: 251 GNYRVVGVIVNPLSIKRSSPGTCETNGSPLVLDEANDNEVYFTYSVKFEESPTSWATRWD 310

Query: 303 KYLHIYDPTIQWFSLINFTXXXXXXXXXXXHFLTKALKNDFVRYNEFNLNDSFDEDSGWK 362
           KYLH+YDP+IQWFSLINF+           H L +ALK+DF RYNE NL+D F EDSGWK
Sbjct: 311 KYLHVYDPSIQWFSLINFSLVVVLLSSVVIHSLLRALKSDFARYNELNLDDDFQEDSGWK 370

Query: 363 LAHGDVFRIPTKSMLLSIFVGSGTQLFFMISSVLVLAALGFLSPSARGSLPTIMFILYAV 422
           L HGDVFR P++S++LSI VGSG Q+F M++  +  AALGFLSPS+RGSL T+MFILYA+
Sbjct: 371 LNHGDVFRPPSQSLMLSILVGSGVQIFLMVTCSIFFAALGFLSPSSRGSLATVMFILYAL 430

Query: 423 FGFVGSYTSMGVYRFFNGPYWKANMILTPLIVPGGIFMFIISMNLFLVFVHSSDVVPIGT 482
           FGFVGSYTSMG+Y+FF+GPYWKAN+I+TPL++PG I + II++N FL+FVHSS V+P  T
Sbjct: 431 FGFVGSYTSMGIYKFFDGPYWKANVIMTPLLIPGAILLVIIALNFFLMFVHSSGVIPAST 490

Query: 483 LSLMVLLWIVLSLPLSFAGSLISFKRCTWYDHPTKTNEVLRQIPFQPWYLKTVPATLIGG 542
           L  MV LW + S+PLSFAGSL++ K+C W +HPTKTN++ RQIPFQPWYLKT+PATLI G
Sbjct: 491 LFFMVFLWFLFSIPLSFAGSLVARKKCHWDEHPTKTNQIARQIPFQPWYLKTLPATLIAG 550

Query: 543 IFPFGSIAVELYFIYSSLWFNKIFYMFGFLLVSFLLLTMTTSLVTIIVTYHSLCLENWRW 602
           IFPFGSIAVELYFIY+SLWFNKIFYMFGFL  SFLLLT+TTSLVT+++TYHSLCLENW+W
Sbjct: 551 IFPFGSIAVELYFIYTSLWFNKIFYMFGFLFFSFLLLTLTTSLVTVMITYHSLCLENWKW 610

Query: 603 QWRSFIIGGIGCSIYIFIHSILFTEFKLGGFITIVLYVGYSALIAILCAMVTGAIGFISN 662
           QWR F +GG+GC++Y+FIHSILFT+FKLGGF TIVLY+GYS++I++LC +VTG+IGFIS+
Sbjct: 611 QWRGFTVGGVGCALYVFIHSILFTKFKLGGFTTIVLYLGYSSVISLLCCLVTGSIGFISS 670

Query: 663 MFFVKKIYSSIKVE 676
           MFF++KIYSSIKV+
Sbjct: 671 MFFIRKIYSSIKVD 684

>KAFR0B02680 Chr2 complement(537048..539042) [1995 bp, 664 aa] {ON}
           Anc_8.254 YLR083C
          Length = 664

 Score =  881 bits (2276), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 435/660 (65%), Positives = 529/660 (80%), Gaps = 11/660 (1%)

Query: 18  TNGFYLPGVAPTTYHELDSIPLLVNHLTPSMFFKHKDSDGNELSSDKENFLYSYDYYYSK 77
           T  FYLPGVAPTTYHE D IPLLVNHL+PSM+++HK+ +G ++SSDK  +LYSYDYYY +
Sbjct: 15  TRAFYLPGVAPTTYHEGDEIPLLVNHLSPSMYWQHKNDEGKDVSSDKNKYLYSYDYYYDR 74

Query: 78  LHFCKPLDREIKKQPESLGSILFGDRIYNSPFELKMLVDENCKELCSTNIPGDDAKFIND 137
            HFC+P   +I+KQPESLGSI+FGDRIYNSPF+L ML ++ C  LC + IPG+DAKFIN 
Sbjct: 75  FHFCQP--EKIEKQPESLGSIMFGDRIYNSPFQLNMLEEKQCASLCKSTIPGNDAKFINK 132

Query: 138 LIKSGFLQNWLIDGLPAARQLYDQTTKSSFYGSGFELGSVEMIQVVDEAPSHTTPKQPIV 197
           LIK+GF QNWLIDGLPAA + +D  T + FYGSGFELG V+++Q VDE  + T     + 
Sbjct: 133 LIKNGFFQNWLIDGLPAAHEAHDTRTGTDFYGSGFELGLVDVVQAVDETEARTK----VA 188

Query: 198 EDVLSQELDEEQATEKRANQMLVSSVERTYFANHFDIHIEYHDRGNNEYRIVGVTVNPIS 257
                 ELD   A     N   + +VE  YF NH+DI IEYHDRGN +YR+VGV VNP+S
Sbjct: 189 AANQGAELDARDA----KNVKTIKNVELVYFVNHYDIRIEYHDRGNGDYRVVGVIVNPVS 244

Query: 258 MKRDS-AICDTNLGKLALSEVSDTDVIFTYSVTFEKSDTVWATRWDKYLHIYDPTIQWFS 316
           ++R S   C++    L L E  D DV FTYSVTF  S+T WATRWDKYLH+YDPTIQWFS
Sbjct: 245 IQRSSPGSCESTGQPLTLQEDEDNDVYFTYSVTFVPSETSWATRWDKYLHVYDPTIQWFS 304

Query: 317 LINFTXXXXXXXXXXXHFLTKALKNDFVRYNEFNLNDSFDEDSGWKLAHGDVFRIPTKSM 376
           L+NF+           H L KALKNDF RYNEFNL+D F ED+GWKL HGDVFRIP KSM
Sbjct: 305 LVNFSLIVLLLSTVVLHSLLKALKNDFARYNEFNLDDEFQEDAGWKLCHGDVFRIPHKSM 364

Query: 377 LLSIFVGSGTQLFFMISSVLVLAALGFLSPSARGSLPTIMFILYAVFGFVGSYTSMGVYR 436
           LLS+ VGSG QLF MIS+ +  AALGFLSPS+RG L T+MF+LYA+FGFVGSYTSMGVY+
Sbjct: 365 LLSVLVGSGVQLFIMISTTIFFAALGFLSPSSRGLLGTVMFMLYALFGFVGSYTSMGVYK 424

Query: 437 FFNGPYWKANMILTPLIVPGGIFMFIISMNLFLVFVHSSDVVPIGTLSLMVLLWIVLSLP 496
           FF GPYWKANM+LTP++VPG IF+ II+MN FL++VHSS V+P  TL  MVLLW V S+P
Sbjct: 425 FFRGPYWKANMVLTPILVPGSIFITIIAMNFFLMYVHSSGVIPAKTLFFMVLLWFVFSIP 484

Query: 497 LSFAGSLISFKRCTWYDHPTKTNEVLRQIPFQPWYLKTVPATLIGGIFPFGSIAVELYFI 556
            +FAGSL++ K+C W +HPTKT ++ RQIPFQPWYLKT+PAT I GIFPFGSIAVE+YFI
Sbjct: 485 SAFAGSLVANKKCNWNEHPTKTEQIARQIPFQPWYLKTIPATFIAGIFPFGSIAVEIYFI 544

Query: 557 YSSLWFNKIFYMFGFLLVSFLLLTMTTSLVTIIVTYHSLCLENWRWQWRSFIIGGIGCSI 616
           Y+SLW+NKIFYMFGFL VS LLL +TTSLVT+++TYHSLCLENW WQWRSFI+GG+GC+I
Sbjct: 545 YTSLWYNKIFYMFGFLFVSLLLLALTTSLVTVLITYHSLCLENWNWQWRSFIVGGVGCAI 604

Query: 617 YIFIHSILFTEFKLGGFITIVLYVGYSALIAILCAMVTGAIGFISNMFFVKKIYSSIKVE 676
           Y+FIHSILFT+FKLGGF T+VLY+GYS++I++LC +VTG+IGF+S+MFFV+KI+SSIKV+
Sbjct: 605 YVFIHSILFTKFKLGGFTTVVLYLGYSSIISLLCCIVTGSIGFLSSMFFVRKIFSSIKVD 664

>CAGL0B01683g Chr2 complement(154275..156350) [2076 bp, 691 aa] {ON}
           highly similar to uniprot|Q04562 Saccharomyces
           cerevisiae YDR107c or uniprot|P32802 Saccharomyces
           cerevisiae YLR083c EMP70
          Length = 691

 Score =  881 bits (2277), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 425/682 (62%), Positives = 516/682 (75%), Gaps = 22/682 (3%)

Query: 15  LSVTNGFYLPGVAPTTYHELDSIPLLVNHLTPSMFFKHKDSDGNELSSDKENFLYSYDYY 74
           ++ T GFYLPG AP TY + D+IPLLVNHLTPS+ F+H D DGNE+  DK   LY YDYY
Sbjct: 12  VASTLGFYLPGAAPRTYKQGDAIPLLVNHLTPSLNFQHVDDDGNEIKGDKARMLYPYDYY 71

Query: 75  YSKLHFCKPLDREIKKQPESLGSILFGDRIYNSPFELKMLVDENCKELCSTNIPGDDAKF 134
             KLHFC+P   +I+KQPESLGS++FG++IYNSPF +KML D  C +LCST IPG DAKF
Sbjct: 72  NEKLHFCQP--EKIEKQPESLGSVIFGEKIYNSPFNVKMLEDNECVQLCSTTIPGKDAKF 129

Query: 135 INDLIKSGFLQNWLIDGLPAARQLYDQTTKSSFYGSGFELGSVEMIQVVDEAPSHTTPKQ 194
           IN LIK+GF+QNWLIDGLPAAR+L+D  T + FYG GFELG VE+ Q V       + K+
Sbjct: 130 INKLIKNGFMQNWLIDGLPAARKLHDSRTNTEFYGQGFELGFVEVRQAVGGKIVSESEKE 189

Query: 195 PIVEDVLSQELDEEQATEKRANQMLV------------------SSVERTYFANHFDIHI 236
             + +  ++ + +    E R+ + LV                  ++VE   FANHFDI +
Sbjct: 190 LQLSERDAKNIIDFTDIEIRSPKNLVDLSNLEVREAKNVVDNIVTNVEVPVFANHFDIEV 249

Query: 237 EYHDRGNNEYRIVGVTVNPISMK--RDSAICDTNLGKLALSEVSDTDVIFTYSVTFEKSD 294
           EYHDRGN ++R+VGV VNP+S+   +  +    N  KL L E  D +V+FTYSV F  SD
Sbjct: 250 EYHDRGNGDFRVVGVIVNPVSLDNYKSRSCALANQHKLHLDENKDNEVMFTYSVKFTPSD 309

Query: 295 TVWATRWDKYLHIYDPTIQWFSLINFTXXXXXXXXXXXHFLTKALKNDFVRYNEFNLNDS 354
           T WATRWDKYLHIYDP IQWFSLINF+           H L +ALK+D  RYNEFNL D 
Sbjct: 310 TPWATRWDKYLHIYDPKIQWFSLINFSVIVLLLSSVAIHSLLRALKSDISRYNEFNLGDE 369

Query: 355 FDEDSGWKLAHGDVFRIPTKSMLLSIFVGSGTQLFFMISSVLVLAALGFLSPSARGSLPT 414
           F+EDSGWKL HGDVFR P  SMLLS+ VGSG QLF MI   ++L+ALG LSPS+RGSLPT
Sbjct: 370 FEEDSGWKLVHGDVFRTPKNSMLLSVLVGSGIQLFLMIFLSIILSALGILSPSSRGSLPT 429

Query: 415 IMFILYAVFGFVGSYTSMGVYRFFNGPYWKANMILTPLIVPGGIFMFIISMNLFLVFVHS 474
            MF+ YA+FGFVGSYTSMG+Y+FF GPYWKANMILTP+++PG IF+ +I MN+ L FV S
Sbjct: 430 AMFMFYAIFGFVGSYTSMGIYKFFKGPYWKANMILTPVLLPGIIFLTVIFMNVLLYFVGS 489

Query: 475 SDVVPIGTLSLMVLLWIVLSLPLSFAGSLISFKRCTWYDHPTKTNEVLRQIPFQPWYLKT 534
           S+V+P+ TL  MV LWI+ S+PL+FAGSLIS+K+C W +HPTKTNE+ RQIPFQPW+LKT
Sbjct: 490 SNVIPLATLVFMVFLWILFSIPLAFAGSLISYKKCNWDEHPTKTNEIPRQIPFQPWFLKT 549

Query: 535 VPATLIGGIFPFGSIAVELYFIYSSLWFNKIFYMFGFLLVSFLLLTMTTSLVTIIVTYHS 594
           VPATLIGG+  FGSIAVELYFIYSSLWFNKIFYMFGFLL S +L + TT L+ +I+TY +
Sbjct: 550 VPATLIGGLVSFGSIAVELYFIYSSLWFNKIFYMFGFLLFSIVLFSFTTGLINVIITYRA 609

Query: 595 LCLENWRWQWRSFIIGGIGCSIYIFIHSILFTEFKLGGFITIVLYVGYSALIAILCAMVT 654
           LC ENW WQWRSF IGG+GCSIYIFIHSILFT+FKLGGF TIVLYVGYS LI+ L  +VT
Sbjct: 610 LCSENWTWQWRSFFIGGLGCSIYIFIHSILFTQFKLGGFATIVLYVGYSFLISFLTCIVT 669

Query: 655 GAIGFISNMFFVKKIYSSIKVE 676
           GAIGFI +MFFV++I++SIKV+
Sbjct: 670 GAIGFICSMFFVRRIFASIKVD 691

>YDR107C Chr4 complement(669016..671034) [2019 bp, 672 aa] {ON}
           TMN2Protein with a role in cellular adhesion and
           filamentous growth; similar to Emp70p and Tmn3p; member
           of the evolutionarily conserved Transmembrane Nine
           family of proteins with nine membrane-spanning segments
          Length = 672

 Score =  880 bits (2273), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 425/667 (63%), Positives = 524/667 (78%), Gaps = 6/667 (0%)

Query: 11  CLITLSVTNGFYLPGVAPTTYHELDSIPLLVNHLTPSMFFKHKDSDGNELSSDKENFLYS 70
           C  TL  T GF LPG++PTTYH  D IPLLVN LTPS++F+H+D +GN++S DKE+FLYS
Sbjct: 11  CYATL--TKGFSLPGLSPTTYHSGDEIPLLVNRLTPSIYFQHQDEEGNDVSGDKEHFLYS 68

Query: 71  YDYYYSKLHFCKPLDREIKKQPESLGSILFGDRIYNSPFELKMLVDENCKELCSTNIPGD 130
           YDYY  + HFC+P    ++KQPESLGS++FGDRIYNSPF+L ML ++ C  LC + IPG 
Sbjct: 69  YDYYNKRFHFCRP--EHVEKQPESLGSVIFGDRIYNSPFQLNMLEEKECVALCKSTIPGK 126

Query: 131 DAKFINDLIKSGFLQNWLIDGLPAARQLYDQTTKSSFYGSGFELGSVEMIQVVDEAPSHT 190
           DAKFIN LIKSGF QNWL+DGLPAAR+ YD  TK+++YG+GFELG  ++ Q VD     +
Sbjct: 127 DAKFINTLIKSGFFQNWLVDGLPAARKAYDSRTKTNYYGTGFELGFTDVKQTVDGKAVPS 186

Query: 191 TPKQPIVEDVLSQELDEEQATEKRANQMLVSSVERTYFANHFDIHIEYHDRGNNEYRIVG 250
           T ++ +  +  ++++  +    K     LV +VE  YF NHFDI +E+HDRGN+ YR+VG
Sbjct: 187 TMEE-LTSEASNEDVILDARLPKNVKPNLVKTVELPYFVNHFDIEVEFHDRGNDNYRVVG 245

Query: 251 VTVNPISMKRDS-AICDTNLGKLALSEVSDTDVIFTYSVTFEKSDTVWATRWDKYLHIYD 309
           V VNP+S++R S   C T    L L E  D +V FTYSV F  SDTVWATRWDKYLHIYD
Sbjct: 246 VIVNPVSIERSSPGACSTTGKPLILDEDKDNEVYFTYSVKFVASDTVWATRWDKYLHIYD 305

Query: 310 PTIQWFSLINFTXXXXXXXXXXXHFLTKALKNDFVRYNEFNLNDSFDEDSGWKLAHGDVF 369
           P IQWFSLINF+           H L +ALK+D  RYNE NL++ F EDSGWKL HGDVF
Sbjct: 306 PQIQWFSLINFSVIVILLSSVVMHSLLRALKSDLARYNELNLDNEFHEDSGWKLGHGDVF 365

Query: 370 RIPTKSMLLSIFVGSGTQLFFMISSVLVLAALGFLSPSARGSLPTIMFILYAVFGFVGSY 429
           R P+KSMLLSI VGSG QLF M+   +  AA+G +SP +RGSLPT+MF+LYA+FGFVGSY
Sbjct: 366 RTPSKSMLLSILVGSGMQLFLMVMCSIFFAAVGLVSPVSRGSLPTVMFVLYALFGFVGSY 425

Query: 430 TSMGVYRFFNGPYWKANMILTPLIVPGGIFMFIISMNLFLVFVHSSDVVPIGTLSLMVLL 489
            SMGVY+FF GPYWKANMILTP+++PG IF+ I+ MN FL+F HSS V+P  +L  ++LL
Sbjct: 426 ASMGVYKFFRGPYWKANMILTPILLPGAIFLLIVIMNFFLLFAHSSGVIPARSLFFIILL 485

Query: 490 WIVLSLPLSFAGSLISFKRCTWYDHPTKTNEVLRQIPFQPWYLKTVPATLIGGIFPFGSI 549
           W ++S+PLSFAGS+++ K+C W +HPTKTN++ RQIP+QPWYL+T  ATLI GIF FGSI
Sbjct: 486 WFLVSVPLSFAGSIVAHKQCNWDEHPTKTNQIARQIPYQPWYLRTAQATLIAGIFSFGSI 545

Query: 550 AVELYFIYSSLWFNKIFYMFGFLLVSFLLLTMTTSLVTIIVTYHSLCLENWRWQWRSFII 609
           AVELYFIYSSLWFNKIFYMFGFLL SFLLLT+TTSLVTI++TY+SLCLENW WQWRSFII
Sbjct: 546 AVELYFIYSSLWFNKIFYMFGFLLFSFLLLTLTTSLVTILITYYSLCLENWLWQWRSFII 605

Query: 610 GGIGCSIYIFIHSILFTEFKLGGFITIVLYVGYSALIAILCAMVTGAIGFISNMFFVKKI 669
           GG+GCSIY FIHSILFT+FKLGG IT+VLY+GYS +I+ LC +VTGAIGF S+MFF++KI
Sbjct: 606 GGLGCSIYTFIHSILFTKFKLGGVITVVLYLGYSLIISALCCVVTGAIGFFSSMFFIRKI 665

Query: 670 YSSIKVE 676
           YS+IKVE
Sbjct: 666 YSAIKVE 672

>Kpol_543.35 s543 complement(78246..80222) [1977 bp, 658 aa] {ON}
           complement(78246..80222) [1977 nt, 659 aa]
          Length = 658

 Score =  879 bits (2270), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 434/669 (64%), Positives = 525/669 (78%), Gaps = 21/669 (3%)

Query: 11  CLIT--LSVTNGFYLPGVAPTTYHELDSIPLLVNHLTPSMFFKHKDSDGNELSSDKENFL 68
           CL++  L++T+ FYLPGVAPTTY + D IPLLVNHLTPS+ F+HKD  GN++  +KE+FL
Sbjct: 8   CLLSVYLALTSAFYLPGVAPTTYGKGDEIPLLVNHLTPSLNFQHKDDQGNDIKGNKEHFL 67

Query: 69  YSYDYYYSKLHFCKPLDREIKKQPESLGSILFGDRIYNSPFELKMLVDENCKELCSTNIP 128
           YS+DYY+ KLHFCKP    ++KQPESLGSILFGDRIYNSPF +KML ++ C  LC   IP
Sbjct: 68  YSFDYYFPKLHFCKP--EHVEKQPESLGSILFGDRIYNSPFSIKMLENQECTSLCKVTIP 125

Query: 129 GDDAKFINDLIKSGFLQNWLIDGLPAARQLYDQTTKSSFYGSGFELGSVEMIQVVDEAPS 188
            DDAKFIN LIK+GF QNWLIDGLPAAR+L+D  TKS FYG+GF LG+V + Q V     
Sbjct: 126 ADDAKFINKLIKNGFFQNWLIDGLPAARKLHDVKTKSDFYGTGFPLGNVHVRQAVG---- 181

Query: 189 HTTPKQPIVEDVLSQELD-EEQATEKRANQMLVSSVERTYFANHFDIHIEYHDRGNNEYR 247
                      + S +L+ E  A E +    +V +VE  +  NH+DI++EYHDRG   YR
Sbjct: 182 ----------GLASSKLNLENPAREAKNVNNMVHNVEIPFLFNHYDINVEYHDRGEGNYR 231

Query: 248 IVGVTVNPISMKRDSAICDTNLGKLALSEVSDTDVIFTYSVTFEKSDTVWATRWDKYLHI 307
           +VGVTV+P S   D  IC    G L L E  D +V F+YSV F  S+TVWATRWDKYLH+
Sbjct: 232 VVGVTVDPKSSTGD--ICTKKSGGLILLETEDNEVQFSYSVRFIPSETVWATRWDKYLHV 289

Query: 308 YDPTIQWFSLINFTXXXXXXXXXXXHFLTKALKNDFVRYNEFNLNDSFDEDSGWKLAHGD 367
           YDPTIQWFSLINF+           H L +ALK+DF RY EFNL+D+F +DSGWKL HGD
Sbjct: 290 YDPTIQWFSLINFSVVVILLSMVVIHSLMRALKSDFARYEEFNLDDTFQQDSGWKLGHGD 349

Query: 368 VFRIPTKSMLLSIFVGSGTQLFFMISSVLVLAALGFLSPSARGSLPTIMFILYAVFGFVG 427
           VFRIP KSMLLSI VGSGTQLF M++  +  AA+G LSPS+RGSLP+ MFILYA+FGF G
Sbjct: 350 VFRIPDKSMLLSILVGSGTQLFLMVAVSIFFAAIGILSPSSRGSLPSAMFILYALFGFCG 409

Query: 428 SYTSMGVYRFFNGPYWKANMILTPLIVPGGIFMFIISMNLFLVFVHSSDVVPIGTLSLMV 487
           SY SMGVY+FFNGPYWKANMILTP++VPG +F+ I+ +N FL+F  SS  +P   L  ++
Sbjct: 410 SYVSMGVYKFFNGPYWKANMILTPILVPGLLFISIVGLNFFLLFSRSSGTIPPTALIFVI 469

Query: 488 LLWIVLSLPLSFAGSLISFKRCTWYDHPTKTNEVLRQIPFQPWYLKTVPATLIGGIFPFG 547
           +LW ++S+PLS AGSLI+ K+C W +HPTKTNE+ RQIPFQPWYLKTVPATLI G+FPFG
Sbjct: 470 VLWFIISIPLSLAGSLIANKKCNWGEHPTKTNEIARQIPFQPWYLKTVPATLIAGLFPFG 529

Query: 548 SIAVELYFIYSSLWFNKIFYMFGFLLVSFLLLTMTTSLVTIIVTYHSLCLENWRWQWRSF 607
           SIAVELYFIYSSLWFNKIFYMFGFL VSFLLLT+TT+LVTI++TY+SL LENWRWQWRSF
Sbjct: 530 SIAVELYFIYSSLWFNKIFYMFGFLFVSFLLLTLTTTLVTILITYYSLNLENWRWQWRSF 589

Query: 608 IIGGIGCSIYIFIHSILFTEFKLGGFITIVLYVGYSALIAILCAMVTGAIGFISNMFFVK 667
           I+GG+GC+ YIF+HSI+FT+FKLGGF TIVLYVGYS +I+ LCA+VTGAIGFIS+M FVK
Sbjct: 590 IVGGVGCAFYIFVHSIIFTKFKLGGFTTIVLYVGYSLIISALCAVVTGAIGFISSMLFVK 649

Query: 668 KIYSSIKVE 676
           KIYSS+KV+
Sbjct: 650 KIYSSVKVD 658

>Suva_2.267 Chr2 complement(463458..465476) [2019 bp, 672 aa] {ON}
           YDR107C (REAL)
          Length = 672

 Score =  876 bits (2263), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 422/664 (63%), Positives = 520/664 (78%), Gaps = 6/664 (0%)

Query: 15  LSVTNGFYLPGVAPTTYHELDSIPLLVNHLTPSMFFKHKDSDGNELSSDKENFLYSYDYY 74
           +++   F LPGV+PTTY   D IPLLVN LTPS++F+HKD +G ++SSDKE+FLYSYDYY
Sbjct: 13  IALAKAFSLPGVSPTTYRANDEIPLLVNRLTPSIYFQHKDENGKDVSSDKEHFLYSYDYY 72

Query: 75  YSKLHFCKPLDREIKKQPESLGSILFGDRIYNSPFELKMLVDENCKELCSTNIPGDDAKF 134
             K HFCKP    ++KQPESLGS++FGDRIYNSPF+LKML D+ C  LC + IPG DAKF
Sbjct: 73  NDKFHFCKP--EHVEKQPESLGSVIFGDRIYNSPFQLKMLEDKECVALCKSTIPGKDAKF 130

Query: 135 INDLIKSGFLQNWLIDGLPAARQLYDQTTKSSFYGSGFELGSVEMIQVVDEAPSHTTPKQ 194
           IN LIK+GF QNWL+DGLPAAR +YD  TK+++YG+GFELG  ++ Q V      +T ++
Sbjct: 131 INTLIKNGFFQNWLVDGLPAARNVYDSRTKTNYYGTGFELGFTDVKQTVGGKTIPSTMEE 190

Query: 195 PIVEDVLS-QELDEEQATEKRANQMLVSSVERTYFANHFDIHIEYHDRGNNEYRIVGVTV 253
              ED  +   LD       + N  LV ++E T+F NHF+I +EYHDRGN  YR+VGVTV
Sbjct: 191 LDSEDSKTGATLDARDPKNIKPN--LVQTIELTHFVNHFNIQVEYHDRGNGNYRVVGVTV 248

Query: 254 NPISMKRDS-AICDTNLGKLALSEVSDTDVIFTYSVTFEKSDTVWATRWDKYLHIYDPTI 312
           NP+S++R S   C T    L L E  D DV FTYSV F  SDTVWATRWDKYLH+YDP I
Sbjct: 249 NPLSIERSSPGACSTTGEPLTLVEDKDNDVYFTYSVKFIASDTVWATRWDKYLHVYDPQI 308

Query: 313 QWFSLINFTXXXXXXXXXXXHFLTKALKNDFVRYNEFNLNDSFDEDSGWKLAHGDVFRIP 372
           QWFSLINF+           H + +A+++DF RYNE NL++ F ED+GWKL HGDVFRIP
Sbjct: 309 QWFSLINFSIIVILLSSVVIHSILRAVRSDFARYNELNLDNEFHEDAGWKLGHGDVFRIP 368

Query: 373 TKSMLLSIFVGSGTQLFFMISSVLVLAALGFLSPSARGSLPTIMFILYAVFGFVGSYTSM 432
            KSM+LS+ VGSG QLF MI   +  AALG +SP++RGSLPT+MF+LYA+FGFVGSYTSM
Sbjct: 369 PKSMVLSVLVGSGIQLFLMIICSIFFAALGLVSPASRGSLPTVMFVLYALFGFVGSYTSM 428

Query: 433 GVYRFFNGPYWKANMILTPLIVPGGIFMFIISMNLFLVFVHSSDVVPIGTLSLMVLLWIV 492
           GVY+FF+GPYWKAN+I+TP+++PG IF+ I++MN FL+F HSS V+P  TL  ++ LW  
Sbjct: 429 GVYKFFHGPYWKANLIITPILLPGAIFLLIVAMNFFLLFAHSSGVIPARTLFFIIFLWFS 488

Query: 493 LSLPLSFAGSLISFKRCTWYDHPTKTNEVLRQIPFQPWYLKTVPATLIGGIFPFGSIAVE 552
           +S+PLSFAGS I+ KRC W +HPTKTN++ RQ P QPWYL+T+ ATLI GIF FGSIAVE
Sbjct: 489 VSIPLSFAGSYIAHKRCKWDEHPTKTNQIARQSPRQPWYLRTIQATLIAGIFSFGSIAVE 548

Query: 553 LYFIYSSLWFNKIFYMFGFLLVSFLLLTMTTSLVTIIVTYHSLCLENWRWQWRSFIIGGI 612
           LYFIYSSLWFNKIFYMFGFLL SFLLLT+ TSLVT+ +TYHSLCLENW WQWRSFIIGG+
Sbjct: 549 LYFIYSSLWFNKIFYMFGFLLFSFLLLTLATSLVTVFITYHSLCLENWSWQWRSFIIGGL 608

Query: 613 GCSIYIFIHSILFTEFKLGGFITIVLYVGYSALIAILCAMVTGAIGFISNMFFVKKIYSS 672
           GCS+Y+FIH+ILFT+FKLGGF+T+VLYVGYS +I+ LC +VTGAIGF S+M F++KIYS 
Sbjct: 609 GCSVYMFIHAILFTKFKLGGFVTVVLYVGYSFIISALCCVVTGAIGFFSSMIFIRKIYSR 668

Query: 673 IKVE 676
           IKVE
Sbjct: 669 IKVE 672

>ZYRO0C01848g Chr3 (146621..148564) [1944 bp, 647 aa] {ON} similar
           to uniprot|P32802 Saccharomyces cerevisiae YLR083C EMP70
           Protein whose 24kDa cleavage product is found in
           endosome-enriched membrane fractions predicted to be a
           transmembrane protein
          Length = 647

 Score =  863 bits (2230), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 433/668 (64%), Positives = 527/668 (78%), Gaps = 30/668 (4%)

Query: 10  ICLITLSVTNGFYLPGVAPTTYHELDSIPLLVNHLTPSMFFKHKDSDGNELSSDKENFLY 69
           +CL+T S+   FYLPGVAPTTYH  D I LLVNHLTPSM F+H+D DGN +  DKE++LY
Sbjct: 9   VCLLT-SLVKAFYLPGVAPTTYHSNDEIQLLVNHLTPSMNFQHEDEDGNMVKGDKEHYLY 67

Query: 70  SYDYYYSKLHFCKPLDREIKKQPESLGSILFGDRIYNSPFELKMLVDENCKELCSTNIPG 129
           SYDYYYSK HFCKP    + +QP SLGS++FGDRI+NSPF+L ML ++ C  LCS+ IPG
Sbjct: 68  SYDYYYSKFHFCKP--ENVVRQPASLGSVIFGDRIFNSPFKLNMLEEKECVPLCSSRIPG 125

Query: 130 DDAKFINDLIKSGFLQNWLIDGLPAARQLYDQTTKSSFYGSGFELGSVEMIQVVDEAPSH 189
           +DAKF+N LIK+GF+QNWLIDGLPA R+++D  T S+FYG+GF+LG V+           
Sbjct: 126 EDAKFVNKLIKNGFMQNWLIDGLPAGREIHDSRTNSNFYGTGFQLGFVD----------- 174

Query: 190 TTPKQPIVEDVLSQELDEEQATEKRANQMLVSSVERTYFANHFDIHIEYHDRGNNEYRIV 249
                  V +  S   DEE+   K        ++E  Y ANH+DI+IEYHDRGN+ YR+V
Sbjct: 175 -------VTEGFSDSNDEEKKIMK--------TLEVPYLANHYDINIEYHDRGNDNYRVV 219

Query: 250 GVTVNPISMKRDSA-ICDTNLGKLALSEVSDTDVIFTYSVTFEKSDTVWATRWDKYLHIY 308
           GVTV+P+S+KR S+  C  N G L LSE  + +V FTYSV F KSDTVWATRWDKYLH+Y
Sbjct: 220 GVTVDPVSIKRSSSDSCQYNSGSLTLSETEENEVHFTYSVKFIKSDTVWATRWDKYLHVY 279

Query: 309 DPTIQWFSLINFTXXXXXXXXXXXHFLTKALKNDFVRYNEFNLNDSFDEDSGWKLAHGDV 368
           DPTIQWFSLIN +           H L +ALKND  RYNEFNL++ F EDSGWKL+HGDV
Sbjct: 280 DPTIQWFSLINCSVIVVALSSVVLHMLLRALKNDLSRYNEFNLDNEFHEDSGWKLSHGDV 339

Query: 369 FRIPTKSMLLSIFVGSGTQLFFMISSVLVLAALGFLSPSARGSLPTIMFILYAVFGFVGS 428
           FRIP +S+LLSI VGSG QLF MI+  ++ AALGFLSPS+RGSLPT+MF+LYA+FGFVGS
Sbjct: 340 FRIPPRSLLLSILVGSGVQLFLMIACSIIFAALGFLSPSSRGSLPTVMFLLYALFGFVGS 399

Query: 429 YTSMGVYRFFNGPYWKANMILTPLIVPGGIFMFIISMNLFLVFVHSSDVVPIGTLSLMVL 488
           YTSM +Y+FF GP WK N++LTP++VPGGIF+ II +N FLVFV SS  +P GTL  ++L
Sbjct: 400 YTSMAIYKFFKGPLWKVNLLLTPVLVPGGIFVTIILLNFFLVFVRSSGAIPAGTLFTIIL 459

Query: 489 LWIVLSLPLSFAGSLISFKRCTWYDHPTKTNEVLRQIPFQPWYLKTVPATLIGGIFPFGS 548
           LW V S+PLSFAGSLI+ KRC   +HPTKTN++ RQIP QPWYLKT+P +LI G+FPF S
Sbjct: 460 LWFVFSIPLSFAGSLIAHKRCRLDNHPTKTNQIARQIPIQPWYLKTIPVSLIAGVFPFAS 519

Query: 549 IAVELYFIYSSLWFNKIFYMFGFLLVSFLLLTMTTSLVTIIVTYHSLCLENWRWQWRSFI 608
           IAVELYFIY+SLWFNKIFYMFGFLL SFLLLT TT+LVTI+ TYHSLCLENW+WQWRSFI
Sbjct: 520 IAVELYFIYTSLWFNKIFYMFGFLLFSFLLLTFTTALVTILTTYHSLCLENWKWQWRSFI 579

Query: 609 IGGIGCSIYIFIHSILFTEFKLGGFITIVLYVGYSALIAILCAMVTGAIGFISNMFFVKK 668
           IGG GC+IY+FIHSILFT+FKLGGF T+VLY+GYS LI++LC +VTG+IGFIS+MFF++K
Sbjct: 580 IGGCGCAIYVFIHSILFTKFKLGGFTTVVLYLGYSGLISVLCCIVTGSIGFISSMFFIRK 639

Query: 669 IYSSIKVE 676
           IYSS+KV+
Sbjct: 640 IYSSVKVD 647

>KNAG0G01990 Chr7 complement(441326..443329) [2004 bp, 667 aa] {ON}
           Anc_8.254 YLR083C
          Length = 667

 Score =  863 bits (2231), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 433/659 (65%), Positives = 529/659 (80%), Gaps = 12/659 (1%)

Query: 19  NGFYLPGVAPTTYHELDSIPLLVNHLTPSMFFKHKDSDGNELSSDKENFLYSYDYYYSKL 78
           N FYLPGVAPTTY   D IPLLVNHL+PSM+++H+  DG  +  DK  +LYSYDYYY + 
Sbjct: 20  NAFYLPGVAPTTYKANDEIPLLVNHLSPSMYWQHETEDGENMKGDKSRYLYSYDYYYDRF 79

Query: 79  HFCKPLDREIKKQPESLGSILFGDRIYNSPFELKMLVDENCKELCSTNIPGDDAKFINDL 138
           HFC+P   +I K+PESLGSI+FGDRIYNSP+++KML ++ C  LC+T IPG DA+FIN L
Sbjct: 80  HFCQP--EKIVKEPESLGSIIFGDRIYNSPYQIKMLEEKTCVPLCNTIIPGKDAEFINKL 137

Query: 139 IKSGFLQNWLIDGLPAARQLYDQTTKSSFYGSGFELGSVEMIQVVDEAPSHTTPKQPIVE 198
           IK+GF QNWLIDGLPAAR ++D++T S FYG+GFELGSVE++Q V +A +H  PK+   +
Sbjct: 138 IKNGFFQNWLIDGLPAARVVHDKSTNSDFYGNGFELGSVEVVQAVAQAKTH--PKE---D 192

Query: 199 DVLSQELDEEQATEKRANQMLVSSVERTYFANHFDIHIEYHDRGNNEYRIVGVTVNPISM 258
           D  S +L    +T    N  ++ +VE  YFANH DI +EYHDRG    R+VGVTV+PIS+
Sbjct: 193 DSGSAKL----STRDAKNVQMLKNVELPYFANHHDITVEYHDRGEGNLRVVGVTVDPISI 248

Query: 259 KRDS-AICDTNLGKLALSEVSDTDVIFTYSVTFEKSDTVWATRWDKYLHIYDPTIQWFSL 317
           KR S   C T+   L L E +D +V FTYSV F  SDTVWATRWDKYLH YDPTIQWFSL
Sbjct: 249 KRSSPGTCQTSGDPLMLDEKNDNEVYFTYSVRFVASDTVWATRWDKYLHTYDPTIQWFSL 308

Query: 318 INFTXXXXXXXXXXXHFLTKALKNDFVRYNEFNLNDSFDEDSGWKLAHGDVFRIPTKSML 377
           +NF+           H L KAL++DF RYNE NL++ F EDSGWKL HGDVFRIP+KSML
Sbjct: 309 VNFSIVVVLLSSVVIHMLLKALRSDFARYNELNLDNEFQEDSGWKLTHGDVFRIPSKSML 368

Query: 378 LSIFVGSGTQLFFMISSVLVLAALGFLSPSARGSLPTIMFILYAVFGFVGSYTSMGVYRF 437
           LSI VGSG QLF MIS  +  AALGFLSPS+RGSL T+MF+LYA+FGFVGSYTSMGVY+F
Sbjct: 369 LSILVGSGIQLFLMISVSIFFAALGFLSPSSRGSLGTVMFMLYALFGFVGSYTSMGVYKF 428

Query: 438 FNGPYWKANMILTPLIVPGGIFMFIISMNLFLVFVHSSDVVPIGTLSLMVLLWIVLSLPL 497
           F GPYWKANMILTPL+VPG + + I+ +N+FL+  HSS  +P  TL  +VLLW V+S+P 
Sbjct: 429 FRGPYWKANMILTPLLVPGCLLLSIVGLNMFLLGAHSSGTIPAKTLFFIVLLWFVISVPS 488

Query: 498 SFAGSLISFKRCTWYDHPTKTNEVLRQIPFQPWYLKTVPATLIGGIFPFGSIAVELYFIY 557
           + AGSLI+ K+C+W +HPTKTN+V RQ+PFQPWYLKTV AT I GIFPFGSIAVELYFIY
Sbjct: 489 ALAGSLIAHKKCSWDEHPTKTNQVARQVPFQPWYLKTVAATFIAGIFPFGSIAVELYFIY 548

Query: 558 SSLWFNKIFYMFGFLLVSFLLLTMTTSLVTIIVTYHSLCLENWRWQWRSFIIGGIGCSIY 617
           +SLW+NKIFYMFGFL VSFLLLT+TT LVTI++TYHSL LENW+WQWRSFI+GG+GC+IY
Sbjct: 549 TSLWYNKIFYMFGFLFVSFLLLTLTTVLVTILITYHSLSLENWQWQWRSFIVGGVGCAIY 608

Query: 618 IFIHSILFTEFKLGGFITIVLYVGYSALIAILCAMVTGAIGFISNMFFVKKIYSSIKVE 676
           +F+HSILFT+ KLGGF+TIVLYVGYSA+I++LC +VTG+IGF+S+MFFV++IYSSIKVE
Sbjct: 609 MFVHSILFTKLKLGGFVTIVLYVGYSAVISLLCCLVTGSIGFLSSMFFVRRIYSSIKVE 667

>KLLA0F18931g Chr6 complement(1734636..1736633) [1998 bp, 665 aa]
           {ON} similar to uniprot|P32802 Saccharomyces cerevisiae
           YLR083C EMP70 Protein whose 24kDa cleavage product is
           found in endosome-enriched membrane fractions predicted
           to be a transmembrane protein
          Length = 665

 Score =  860 bits (2222), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 404/666 (60%), Positives = 507/666 (76%), Gaps = 15/666 (2%)

Query: 12  LITLSVTNGFYLPGVAPTTYHELDSIPLLVNHLTPSMFFKHKDSDGNELSSDKENFLYSY 71
           LI   +   FYLPGVAPTTYHE D +PLLVNHLTPS F+KH D+D ++ + DKE FLYSY
Sbjct: 14  LIGSLLVEAFYLPGVAPTTYHEGDDLPLLVNHLTPSQFYKHYDTDQHD-TGDKEGFLYSY 72

Query: 72  DYYYSKLHFCKPLDREIKKQPESLGSILFGDRIYNSPFELKMLVDENCKELCSTNIPGDD 131
           DYYY K HFC+P   E+KKQPESLGSI+FGDRIYNSPF+L++L +  C+ LC + IPG D
Sbjct: 73  DYYYKKFHFCQP--AELKKQPESLGSIIFGDRIYNSPFKLQLLKNVECQSLCKSVIPGKD 130

Query: 132 AKFINDLIKSGFLQNWLIDGLPAARQLYDQTTKSSFYGSGFELGSVEMIQVVDEAPSHTT 191
           AKFIN LI +GF QNW+IDGLPAAR++ D  T   FYG+GFELG V+++       S   
Sbjct: 131 AKFINKLILNGFFQNWIIDGLPAARKMEDTKTNKIFYGNGFELGLVDVL-------SDYE 183

Query: 192 PKQPIVEDVLSQELDEEQATEKRANQMLVSSVERTYFANHFDIHIEYHDRGNNEYRIVGV 251
           P    + D L  +L+ ++      +++     E  YF NH+DI IEYHDRG N YRIVGV
Sbjct: 184 PDTRSLHDELELQLNAKKNVLSPGDKV----TEIPYFVNHYDIQIEYHDRGENNYRIVGV 239

Query: 252 TVNPISMKRDSA-ICDTNLGKLALSEVSDTDVIFTYSVTFEKSDTVWATRWDKYLHIYDP 310
           TVNP S+KRDS   C++    L LSE  D +V FTYSV F KSDTVWATRWDKYLH+YDP
Sbjct: 240 TVNPASIKRDSPDSCESTGKSLVLSETEDNEVYFTYSVKFIKSDTVWATRWDKYLHVYDP 299

Query: 311 TIQWFSLINFTXXXXXXXXXXXHFLTKALKNDFVRYNEFNLNDSFDEDSGWKLAHGDVFR 370
            IQWFSLINF+           H L  ALKND  RYNE NL+  F+E++GWKL HGDVFR
Sbjct: 300 KIQWFSLINFSTIVVLLSSVMLHSLYSALKNDLARYNELNLDTDFEEETGWKLIHGDVFR 359

Query: 371 IPTKSMLLSIFVGSGTQLFFMISSVLVLAALGFLSPSARGSLPTIMFILYAVFGFVGSYT 430
            P K++LLS+ VGSG QL  M+++ ++ A LGFLSPS+RGSL T+MF+LYA+FG  GS+T
Sbjct: 360 SPNKALLLSVLVGSGGQLALMLTTTILFACLGFLSPSSRGSLSTVMFLLYAIFGSFGSFT 419

Query: 431 SMGVYRFFNGPYWKANMILTPLIVPGGIFMFIISMNLFLVFVHSSDVVPIGTLSLMVLLW 490
           SM  Y+FFNG  W+ N++LTPL+VPG I   ++ +N FL+FVHSS  +P  T+ ++VLLW
Sbjct: 420 SMATYKFFNGKAWRLNLVLTPLLVPGSILTVVLGLNFFLIFVHSSGAIPFQTMLVLVLLW 479

Query: 491 IVLSLPLSFAGSLISFKRCTWYDHPTKTNEVLRQIPFQPWYLKTVPATLIGGIFPFGSIA 550
            V+S+PLS  GS+I++K+C W +HPTKTN++ RQIPFQPWYLKT+P  L+ GIFPFGSIA
Sbjct: 480 FVISIPLSAIGSVIAWKKCNWNEHPTKTNQIARQIPFQPWYLKTIPVALLAGIFPFGSIA 539

Query: 551 VELYFIYSSLWFNKIFYMFGFLLVSFLLLTMTTSLVTIIVTYHSLCLENWRWQWRSFIIG 610
           VELYFIYSSLWFNKI+YMFGFL  SF+LL +TTSL+T+++TYHSLC+ENW+WQWRSF+IG
Sbjct: 540 VELYFIYSSLWFNKIYYMFGFLFFSFILLALTTSLITVLLTYHSLCMENWKWQWRSFVIG 599

Query: 611 GIGCSIYIFIHSILFTEFKLGGFITIVLYVGYSALIAILCAMVTGAIGFISNMFFVKKIY 670
           G GC+ Y+F HSILFT+F+LGG  TIVLY+GYS LI+ LC +VTGAIGF+S++  V+KIY
Sbjct: 600 GCGCAFYVFCHSILFTKFRLGGLTTIVLYLGYSILISGLCCLVTGAIGFLSSLILVRKIY 659

Query: 671 SSIKVE 676
           S +KV+
Sbjct: 660 SCVKVD 665

>Smik_4.353 Chr4 complement(630320..632392) [2073 bp, 690 aa] {ON}
           YDR107C (REAL)
          Length = 690

 Score =  861 bits (2224), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 418/664 (62%), Positives = 520/664 (78%), Gaps = 6/664 (0%)

Query: 15  LSVTNGFYLPGVAPTTYHELDSIPLLVNHLTPSMFFKHKDSDGNELSSDKENFLYSYDYY 74
           + +T  F LPG++PTTYH+ D IPLLVN LTPS++F+H+D +G ++SSDKE++LYSYDYY
Sbjct: 31  IGLTKAFSLPGLSPTTYHKNDEIPLLVNRLTPSIYFQHQDENGKDISSDKEHYLYSYDYY 90

Query: 75  YSKLHFCKPLDREIKKQPESLGSILFGDRIYNSPFELKMLVDENCKELCSTNIPGDDAKF 134
             + HFC+P    +++QPESLGSI+FGDRIYNSPF+L+ML  + C  LC   IPG DAKF
Sbjct: 91  NERFHFCRP--EHVERQPESLGSIIFGDRIYNSPFQLRMLETKECVALCENTIPGKDAKF 148

Query: 135 INDLIKSGFLQNWLIDGLPAARQLYDQTTKSSFYGSGFELGSVEMIQVVDEAPSHTTPKQ 194
           IN LIKSGF QNWL+DGLPAAR+++D  TK+++YG+GFELG   +   +D     +T ++
Sbjct: 149 INKLIKSGFFQNWLVDGLPAARKVWDSRTKTNYYGTGFELGITAVKNTIDGKVIPSTMEE 208

Query: 195 PIVEDV-LSQELDEEQATEKRANQMLVSSVERTYFANHFDIHIEYHDRGNNEYRIVGVTV 253
              E       LD  +    + N  LV +VE  YF NHFDI +E+HDRG++ YR+VGVTV
Sbjct: 209 LDSETSNTGAALDAREPKNIKPN--LVKTVELPYFVNHFDIEVEFHDRGDDNYRVVGVTV 266

Query: 254 NPISMKRDSA-ICDTNLGKLALSEVSDTDVIFTYSVTFEKSDTVWATRWDKYLHIYDPTI 312
           NP+S++R S   C      L L E  D ++ FTYSV F  SDTVWATRWDKYLHIYDP I
Sbjct: 267 NPMSIERSSPDSCSKATKPLILDEEGDNEIYFTYSVKFVASDTVWATRWDKYLHIYDPQI 326

Query: 313 QWFSLINFTXXXXXXXXXXXHFLTKALKNDFVRYNEFNLNDSFDEDSGWKLAHGDVFRIP 372
           QWFSLINF+           H L +AL +D  RYNE NL++ F EDSGWKL HGDVFR P
Sbjct: 327 QWFSLINFSVIIVLLSSVVMHSLLRALNSDLSRYNELNLDNEFHEDSGWKLGHGDVFRTP 386

Query: 373 TKSMLLSIFVGSGTQLFFMISSVLVLAALGFLSPSARGSLPTIMFILYAVFGFVGSYTSM 432
           TKSMLLS+ VGSG QLF MI   + LAALG +SP +RGSLPT+MF+ YA+FGFVGSYTSM
Sbjct: 387 TKSMLLSVLVGSGVQLFLMIICSIFLAALGLVSPVSRGSLPTVMFVFYALFGFVGSYTSM 446

Query: 433 GVYRFFNGPYWKANMILTPLIVPGGIFMFIISMNLFLVFVHSSDVVPIGTLSLMVLLWIV 492
           GVY+FF+GPYWKAN+ILTP+++PGGIF+ I++MN FL+F HSS V+P  TL  ++ LW  
Sbjct: 447 GVYKFFHGPYWKANLILTPILLPGGIFVLIVAMNFFLLFAHSSGVIPASTLFFIIFLWFA 506

Query: 493 LSLPLSFAGSLISFKRCTWYDHPTKTNEVLRQIPFQPWYLKTVPATLIGGIFPFGSIAVE 552
           +S+PLSFAGS+I+ K C W +HPTKTN++ RQ+P+QPWYL+T+ ATLI GIF FGSIAVE
Sbjct: 507 VSIPLSFAGSMIAHKWCNWDEHPTKTNQIARQVPYQPWYLRTIQATLIAGIFCFGSIAVE 566

Query: 553 LYFIYSSLWFNKIFYMFGFLLVSFLLLTMTTSLVTIIVTYHSLCLENWRWQWRSFIIGGI 612
           LYFIYSSLWFNKIFYMFGFLL SFLLLT+TTSLVT+++TYHSLCLENW+WQWRSFIIGG+
Sbjct: 567 LYFIYSSLWFNKIFYMFGFLLFSFLLLTLTTSLVTVLITYHSLCLENWQWQWRSFIIGGL 626

Query: 613 GCSIYIFIHSILFTEFKLGGFITIVLYVGYSALIAILCAMVTGAIGFISNMFFVKKIYSS 672
           GCS+Y+FIHSILFT+FKLGGFITIVLY GYS +I+ LC +VTGAIGF S M F++KIYS+
Sbjct: 627 GCSVYMFIHSILFTKFKLGGFITIVLYFGYSFIISALCCVVTGAIGFFSCMLFIRKIYSA 686

Query: 673 IKVE 676
           +K+E
Sbjct: 687 VKIE 690

>TBLA0H01450 Chr8 complement(321416..323437) [2022 bp, 673 aa] {ON}
           Anc_8.254 YLR083C
          Length = 673

 Score =  859 bits (2220), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 403/680 (59%), Positives = 518/680 (76%), Gaps = 11/680 (1%)

Query: 1   MTKLITAVSICLITLSV--TNGFYLPGVAPTTYHELDSIPLLVNHLTPSMFFKHKDSDGN 58
           M  L+T++ +CLI+  +  +N FY+PG++  TYH  D I L VN LTPSM+F+H D +G 
Sbjct: 1   MNSLLTSI-LCLISFHIIFSNAFYIPGISANTYHPGDPIELEVNRLTPSMYFEHTDENGQ 59

Query: 59  ELSSDKENFLYSYDYYYSKLHFCKPLDREIKKQPESLGSILFGDRIYNSPFELKMLVDEN 118
            +++DKE+FLYSYDYYY K HFC+P   +++++ ESLGS+LFGDRIYNSPFEL ML  + 
Sbjct: 60  SVANDKEHFLYSYDYYYDKFHFCRP--EKVERKSESLGSVLFGDRIYNSPFELYMLEPKE 117

Query: 119 CKELCSTNIPGDDAKFINDLIKSGFLQNWLIDGLPAARQLYDQTTKSSFYGSGFELGSVE 178
           C  LC T IP DDAKFIN LIK+GF  NWLIDGLP+AR++YD  T+S FY SGF LGSV 
Sbjct: 118 CVPLCKTTIPADDAKFINKLIKNGFFYNWLIDGLPSARKIYDSKTESIFYSSGFPLGSVS 177

Query: 179 MIQVVDEAPSHTTPKQPIVEDVLSQELDEEQATE-KRANQMLVSSVERTYFANHFDIHIE 237
               V+     +    P V  ++++ +   +  E K     L+++ E  YFANHF+IHIE
Sbjct: 178 ----VEHMSGGSKVTIPGVSKLVNEAVKAYKKREAKNVPAGLITAEEVEYFANHFNIHIE 233

Query: 238 YHDRGNNEYRIVGVTVNPISMKRDS-AICDTNLGKLALSEVSDTDVIFTYSVTFEKSDTV 296
           YHDRGNN YR+VGVTV+PIS+KRD    C     +L L+E ++  V+FTYSV F KS+T 
Sbjct: 234 YHDRGNNNYRVVGVTVDPISIKRDDFESCTPTGNQLHLNENAENQVLFTYSVDFIKSETA 293

Query: 297 WATRWDKYLHIYDPTIQWFSLINFTXXXXXXXXXXXHFLTKALKNDFVRYNEFNLNDSFD 356
           WATRWDKYLH YDP+IQWFSLINFT           H L +ALK D  RY + NL++SF 
Sbjct: 294 WATRWDKYLHTYDPSIQWFSLINFTIVVVLLSTIVIHALLRALKKDISRYTDLNLDNSFT 353

Query: 357 EDSGWKLAHGDVFRIPTKSMLLSIFVGSGTQLFFMISSVLVLAALGFLSPSARGSLPTIM 416
           EDSGWKL HGDVFR+P K+M+LSI+VGSG QLF MI   L +AALGF+SPS RG+LPT M
Sbjct: 354 EDSGWKLTHGDVFRMPRKAMVLSIYVGSGVQLFLMILCCLTVAALGFMSPSYRGALPTCM 413

Query: 417 FILYAVFGFVGSYTSMGVYRFFNGPYWKANMILTPLIVPGGIFMFIISMNLFLVFVHSSD 476
           F+LYA+FGFVGSYTSMGVY+FF+GPYWKANMILTPL+VPG + + II +N FL+ VHSS 
Sbjct: 414 FVLYAIFGFVGSYTSMGVYKFFHGPYWKANMILTPLLVPGSMLLLIIFLNFFLLGVHSSG 473

Query: 477 VVPIGTLSLMVLLWIVLSLPLSFAGSLISFKRCTWYDHPTKTNEVLRQIPFQPWYLKTVP 536
            +P  T+ LM+ LW+++S+PLSF GS ++FK+C W D+PT  NE+ R+IP QPWY++++P
Sbjct: 474 TIPASTIILMICLWLLVSVPLSFLGSFVAFKKCNWNDNPTTVNEIPREIPIQPWYMRSIP 533

Query: 537 ATLIGGIFPFGSIAVELYFIYSSLWFNKIFYMFGFLLVSFLLLTMTTSLVTIIVTYHSLC 596
             L+ GI PFG+IAVELYFIYSSLW+NKIFYMFGFLLVSF+L+  T+ LV+IIV YHSLC
Sbjct: 534 VVLLSGIVPFGAIAVELYFIYSSLWYNKIFYMFGFLLVSFILMIFTSVLVSIIVVYHSLC 593

Query: 597 LENWRWQWRSFIIGGIGCSIYIFIHSILFTEFKLGGFITIVLYVGYSALIAILCAMVTGA 656
           LENWRWQWRSF+ GG+GC+ YIF++SI FT FK  GF++I+LY+GYS+LI ++  ++TGA
Sbjct: 594 LENWRWQWRSFVAGGLGCAFYIFLYSIAFTRFKFTGFVSILLYMGYSSLICVVSCLITGA 653

Query: 657 IGFISNMFFVKKIYSSIKVE 676
           + F+ NMFFVK+I++SIKV 
Sbjct: 654 VSFMCNMFFVKRIFTSIKVH 673

>Skud_4.368 Chr4 complement(640627..642645) [2019 bp, 672 aa] {ON}
           YDR107C (REAL)
          Length = 672

 Score =  854 bits (2206), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 411/664 (61%), Positives = 515/664 (77%), Gaps = 6/664 (0%)

Query: 15  LSVTNGFYLPGVAPTTYHELDSIPLLVNHLTPSMFFKHKDSDGNELSSDKENFLYSYDYY 74
           + V   F LPG++PTTYH  D IPLLVN LTPS++F+H+D +GN++SSDKE+FLYSYDYY
Sbjct: 13  IPVAKAFSLPGLSPTTYHSNDEIPLLVNRLTPSIYFQHQDENGNDISSDKEHFLYSYDYY 72

Query: 75  YSKLHFCKPLDREIKKQPESLGSILFGDRIYNSPFELKMLVDENCKELCSTNIPGDDAKF 134
             + HFC+P    ++KQPESLGS++FGDRIYNSPF+L+ML ++ C  LC   IPG DA+F
Sbjct: 73  NERFHFCRP--EHVEKQPESLGSVIFGDRIYNSPFQLRMLEEKECVALCKGTIPGRDAEF 130

Query: 135 INDLIKSGFLQNWLIDGLPAARQLYDQTTKSSFYGSGFELGSVEMIQVV-DEAPSHTTPK 193
           IN LI SGF QNWL+DGLPAAR +YD  TK+++YG+GFELG  ++IQ V DE   +T  +
Sbjct: 131 INRLIISGFFQNWLVDGLPAARSVYDSRTKTNYYGTGFELGFTDVIQTVGDETVPNTMEE 190

Query: 194 QPIVEDVLSQELDEEQATEKRANQMLVSSVERTYFANHFDIHIEYHDRGNNEYRIVGVTV 253
             +        L        R N   V +VE  YF NHF+I +E+H+RGN+ YRIVGVTV
Sbjct: 191 ADMDASNAGATLHIRSPKNIRPNP--VKTVELPYFVNHFEIVVEFHERGNDSYRIVGVTV 248

Query: 254 NPISMKRDS-AICDTNLGKLALSEVSDTDVIFTYSVTFEKSDTVWATRWDKYLHIYDPTI 312
           NP+S++R S   C      L L E  D +V FTYSV F  S TVWATRWDKYLHIYDP I
Sbjct: 249 NPVSIERSSPGSCSRTRKPLTLHEDRDNEVYFTYSVKFVASATVWATRWDKYLHIYDPQI 308

Query: 313 QWFSLINFTXXXXXXXXXXXHFLTKALKNDFVRYNEFNLNDSFDEDSGWKLAHGDVFRIP 372
           QWFSLI F+           H L +ALK+D  RYNE NLN+ F ED+GWKL+HGDVFR P
Sbjct: 309 QWFSLIGFSVIVILLSSAVIHSLLRALKSDLTRYNELNLNNEFHEDAGWKLSHGDVFRTP 368

Query: 373 TKSMLLSIFVGSGTQLFFMISSVLVLAALGFLSPSARGSLPTIMFILYAVFGFVGSYTSM 432
            KSMLLS+ VGSG QLF MI   +  AA G +SP +RGSL T+MF+LYA+FGFVGSYTSM
Sbjct: 369 PKSMLLSVLVGSGIQLFLMIICSIFFAAFGLVSPISRGSLQTVMFLLYALFGFVGSYTSM 428

Query: 433 GVYRFFNGPYWKANMILTPLIVPGGIFMFIISMNLFLVFVHSSDVVPIGTLSLMVLLWIV 492
           GVY+FF+GPYWKAN+I+TP+++PG I + I++MN+FL+F HSS V+P  +L  ++ LW V
Sbjct: 429 GVYKFFHGPYWKANLIITPILLPGAILLLIVAMNIFLLFAHSSGVIPAKSLFFIIFLWFV 488

Query: 493 LSLPLSFAGSLISFKRCTWYDHPTKTNEVLRQIPFQPWYLKTVPATLIGGIFPFGSIAVE 552
           +S+PLSF GS+++ KRC+W +HPTKTN++ RQIP QPWYL+T  AT++ GIF FGSIAVE
Sbjct: 489 VSIPLSFVGSVLAHKRCSWNEHPTKTNQIARQIPHQPWYLRTTQATMVAGIFSFGSIAVE 548

Query: 553 LYFIYSSLWFNKIFYMFGFLLVSFLLLTMTTSLVTIIVTYHSLCLENWRWQWRSFIIGGI 612
           LYFIYSSLWFNKIFYMFGFLL SFLLLT+TTSL+T+++TYHSLCLENW WQWRSFIIGG+
Sbjct: 549 LYFIYSSLWFNKIFYMFGFLLFSFLLLTLTTSLITVLITYHSLCLENWLWQWRSFIIGGL 608

Query: 613 GCSIYIFIHSILFTEFKLGGFITIVLYVGYSALIAILCAMVTGAIGFISNMFFVKKIYSS 672
           GCSIY+FIHSILFT+FKLGGFIT+VLY+GYS ++++LC +VTGAIGF S+M F++KIY +
Sbjct: 609 GCSIYMFIHSILFTKFKLGGFITVVLYLGYSFIMSVLCCVVTGAIGFFSSMIFIRKIYYA 668

Query: 673 IKVE 676
           +KVE
Sbjct: 669 VKVE 672

>Kwal_56.23577 s56 complement(605281..607332) [2052 bp, 683 aa] {ON}
           YLR083C (EMP70) - endosomal membrane protein [contig
           176] FULL
          Length = 683

 Score =  838 bits (2165), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 414/675 (61%), Positives = 519/675 (76%), Gaps = 20/675 (2%)

Query: 16  SVTNGFYLPGVAPTTYHELDSIPLLVNHLTPSMFFKHKDSDGNELSSDKENFLYSYDYYY 75
           S   GFYLPGVAPTTYHE DSIPLLVNHLTPSM+FKH D DG + + D+E+FLYSYDYYY
Sbjct: 15  SRVEGFYLPGVAPTTYHEGDSIPLLVNHLTPSMYFKHVDDDGKD-TGDRESFLYSYDYYY 73

Query: 76  SKLHFCKPLDREIKKQPESLGSILFGDRIYNSPFELKMLVDENCKELCSTNIPGDDAKFI 135
            K HFCKP   +++KQ ESLGSI+FGDRIYNSPF+L+ML D+ C+ LCS+ IP +DAKFI
Sbjct: 74  DKFHFCKP--EKLEKQRESLGSIIFGDRIYNSPFKLEMLKDKECEALCSSKIPANDAKFI 131

Query: 136 NDLIKSGFLQNWLIDGLPAARQLYDQTTKSSFYGSGFELGSVEM----IQVVDEAPSHTT 191
           N LI +GF QNWL+DGLPAAR+  D+ TKS FY  GFELG +++    +++  +      
Sbjct: 132 NKLIANGFFQNWLVDGLPAARKTTDERTKSEFYTPGFELGFIDVGGAKLRMDGQGEEDAH 191

Query: 192 PK---QPIVEDVLSQELDE--EQATEKRAN----QMLVSSVERTYFANHFDIHIEYHDRG 242
           PK   +P+ +D     LD   +   EKR      + LV  +E  YFANHF+I ++YHDRG
Sbjct: 192 PKGATKPVAQD---DYLDRPSKSKNEKRKKIVDPKELVKQLETAYFANHFNIEVQYHDRG 248

Query: 243 NNEYRIVGVTVNPISMKRDSA-ICDTNLGKLALSEVSDTDVIFTYSVTFEKSDTVWATRW 301
           N +YR+VGV VNP S+KRDS+  C      L LSE  +T V F+YSV F  SDTVWATRW
Sbjct: 249 NGDYRVVGVIVNPQSIKRDSSNSCAATGELLKLSEEEETTVHFSYSVKFTPSDTVWATRW 308

Query: 302 DKYLHIYDPTIQWFSLINFTXXXXXXXXXXXHFLTKALKNDFVRYNEFNLNDSFDEDSGW 361
           DKYLH+YDP IQW+SLINF+           H L + L++D  RYN+ NL+D F E++GW
Sbjct: 309 DKYLHVYDPKIQWYSLINFSIVVIVLSSVVIHSLYRTLRDDLSRYNQLNLDDDFQEETGW 368

Query: 362 KLAHGDVFRIPTKSMLLSIFVGSGTQLFFMISSVLVLAALGFLSPSARGSLPTIMFILYA 421
           KL HGDVFR PTKS+LLS+ VGSGTQLF M +  +  A LG LSPS+RGSL T+MFILYA
Sbjct: 369 KLVHGDVFRTPTKSLLLSVLVGSGTQLFVMAACTIAFALLGLLSPSSRGSLTTVMFILYA 428

Query: 422 VFGFVGSYTSMGVYRFFNGPYWKANMILTPLIVPGGIFMFIISMNLFLVFVHSSDVVPIG 481
           +FG +GSYTSM  Y+FF G YWK NMILTP++VPG +F  ++ +N FL+ V S+  +P G
Sbjct: 429 LFGSLGSYTSMATYKFFGGEYWKVNMILTPILVPGLLFCVVLGLNFFLIMVESAGAIPFG 488

Query: 482 TLSLMVLLWIVLSLPLSFAGSLISFKRCTWYDHPTKTNEVLRQIPFQPWYLKTVPATLIG 541
           T+  +VLLW V S+PLS AGSLI+ K+C W +HPTKT ++ RQIPFQPWYLKT PA LI 
Sbjct: 489 TMCAIVLLWFVFSIPLSLAGSLIAKKKCRWNEHPTKTRQIPRQIPFQPWYLKTAPAALIA 548

Query: 542 GIFPFGSIAVELYFIYSSLWFNKIFYMFGFLLVSFLLLTMTTSLVTIIVTYHSLCLENWR 601
           GIFPFGSIAVELYF+YSSLWFNKIFYMFGFL VSFLLLT+TT+LVT+++TY+SLCLENW+
Sbjct: 549 GIFPFGSIAVELYFVYSSLWFNKIFYMFGFLFVSFLLLTLTTALVTVLLTYYSLCLENWK 608

Query: 602 WQWRSFIIGGIGCSIYIFIHSILFTEFKLGGFITIVLYVGYSALIAILCAMVTGAIGFIS 661
           WQWR F IGG GC++Y+F+H+ILFT+FKLGGF+TIVLYVGYS +I++L  ++TGA+GF+S
Sbjct: 609 WQWRGFWIGGAGCALYVFLHAILFTKFKLGGFVTIVLYVGYSLVISLLTCLITGAVGFMS 668

Query: 662 NMFFVKKIYSSIKVE 676
           +++FV++IYSSIKV+
Sbjct: 669 SLWFVRRIYSSIKVD 683

>SAKL0H17248g Chr8 (1530599..1532581) [1983 bp, 660 aa] {ON} similar
           to uniprot|P32802 Saccharomyces cerevisiae YLR083C EMP70
           Protein whose 24kDa cleavage product is found in
           endosome-enriched membrane fractions predicted to be a
           transmembrane protein
          Length = 660

 Score =  822 bits (2122), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 401/662 (60%), Positives = 506/662 (76%), Gaps = 13/662 (1%)

Query: 16  SVTNGFYLPGVAPTTYHELDSIPLLVNHLTPSMFFKHKDSDGNELSSDKENFLYSYDYYY 75
            + + FYLPGVAPTTYH+ D IPLLVNHLTPS +F+H D +G+ +S DKE FLYSYDYYY
Sbjct: 11  QIASAFYLPGVAPTTYHKGDEIPLLVNHLTPSTYFQHADQEGHTMSGDKERFLYSYDYYY 70

Query: 76  SKLHFCKPLDREIKKQPESLGSILFGDRIYNSPFELKMLVDENCKELCSTNIPGDDAKFI 135
            K HFC+P    + KQPESLGSI+FGDRIYNSPFEL ML ++ C  LC + IP DDAKFI
Sbjct: 71  DKFHFCRP--ENLIKQPESLGSIIFGDRIYNSPFELNMLENKTCVPLCKSEIPKDDAKFI 128

Query: 136 NDLIKSGFLQNWLIDGLPAARQLYDQTTKSSFYGSGFELGSVEMIQVVDEAPSHTTPKQP 195
           N LI++GF  NWL+DGLPAAR+++D  T S FYG+GFELG V+++  +++  +    +  
Sbjct: 129 NKLIRNGFFHNWLVDGLPAAREMHDGRTNSYFYGNGFELGFVDVVDTIEDPDTKKVSESD 188

Query: 196 IVEDVLSQELDEEQATEKRANQMLVSSVERTYFANHFDIHIEYHDRGNNEYRIVGVTVNP 255
            +E       D ++  ++R+ ++     E +YF NHFDI IEYHDRG + YR+VGV+V P
Sbjct: 189 YIEIA-----DADKELKERSAKL----TELSYFINHFDIKIEYHDRGEDNYRVVGVSVIP 239

Query: 256 ISMKRDSA-ICDTNLGKLALSEVSDTDVIFTYSVTFEKSDTVWATRWDKYLHIYDPTIQW 314
            S+KRDS+  CDT    L LSE +D  V FTYSV+F  S T+WATRWDKYLH+YDP IQW
Sbjct: 240 ASIKRDSSDSCDTEGEPLVLSEDADNTVHFTYSVSFVPSQTLWATRWDKYLHVYDPQIQW 299

Query: 315 FSLINFTXXXXXXXXXXXHFLTKALKNDFVRYNEFNLNDSFDEDSGWKLAHGDVFRIPTK 374
           FSLI+F+           H L +ALKND  RYNE NL+D F E++GWKL HGDVFR P +
Sbjct: 300 FSLISFSLIVILLSSVMVHSLFRALKNDLSRYNELNLDDEFQEETGWKLVHGDVFRTPER 359

Query: 375 SMLLSIFVGSGTQLFFMISSVLVLAALGFLSPSARGSLPTIMFILYAVFGFVGSYTSMGV 434
           +MLLS+ VGSG QLF M    ++ A LG LSPS+RGSL T+MFILYA+FG  GSYTSM V
Sbjct: 360 TMLLSVLVGSGAQLFLMAGFTILFALLGLLSPSSRGSLTTVMFILYALFGSFGSYTSMAV 419

Query: 435 YRFFNGPYWKANMILTPLIVPGGIFMFIISMNLFLVFVHSSDVVPIGTLSLMVLLWIVLS 494
           Y+FFNG  WK NMILTP+++P  IF+ ++ +N FLVFVHSS  +P GT+  +V+LW V S
Sbjct: 420 YKFFNGQNWKLNMILTPILIPSMIFISMLGLNTFLVFVHSSGAIPFGTMLAIVVLWFVFS 479

Query: 495 LPLSFAGSLISFKRCTWYDHPTKTNEVLRQIPFQPWYLKTVPATLIGGIFPFGSIAVELY 554
           +PLS AGS+IS K+  W D PT TN++ RQIPFQPWYLKTVPA+LI G FPFGSI VELY
Sbjct: 480 IPLSVAGSIISRKKSQW-DRPTNTNQIARQIPFQPWYLKTVPASLIAGTFPFGSIVVELY 538

Query: 555 FIYSSLWFNKIFYMFGFLLVSFLLLTMTTSLVTIIVTYHSLCLENWRWQWRSFIIGGIGC 614
           FIYSSLWFNKIFYMFGFL  SFLLLT+TT+LVT+++TY+SLC+ENW+WQWR F IGG GC
Sbjct: 539 FIYSSLWFNKIFYMFGFLFFSFLLLTLTTTLVTVLLTYYSLCMENWKWQWRGFWIGGAGC 598

Query: 615 SIYIFIHSILFTEFKLGGFITIVLYVGYSALIAILCAMVTGAIGFISNMFFVKKIYSSIK 674
           + Y+F+H+ILFT+FKLGG  T+VLY+GYS +I+ LC ++TGA+GF+S+++FV+KIY SIK
Sbjct: 599 AFYVFVHAILFTKFKLGGLTTVVLYLGYSVVISGLCCLITGAVGFLSSLWFVRKIYGSIK 658

Query: 675 VE 676
           V+
Sbjct: 659 VD 660

>TPHA0A01840 Chr1 (371758..373815) [2058 bp, 685 aa] {ON} Anc_8.254
           YLR083C
          Length = 685

 Score =  817 bits (2111), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 413/679 (60%), Positives = 512/679 (75%), Gaps = 22/679 (3%)

Query: 15  LSVTNGFYLPGVAPTTYHELDSIPLLVNHLTPSMFFKHKDSDGNELSSDKENFLYSYDYY 74
           +S  N FYLPGVAP+TY+E D +PLLVNHLTPS+ ++ KD  G ++ S +E  LYS+DYY
Sbjct: 12  VSFCNAFYLPGVAPSTYNEGDELPLLVNHLTPSLNYQKKDDLGKKVES-REKMLYSFDYY 70

Query: 75  YSKLHFCKPLDREIKKQPESLGSILFGDRIYNSPFELKMLVDENCKELCSTNIPGDDAKF 134
           + KLHFCKP   +I KQP+SLGSILFGDRIYNSPF +KML  EN  +LCS  IPG DAKF
Sbjct: 71  FPKLHFCKP--EKIVKQPDSLGSILFGDRIYNSPFSIKMLKPENNVKLCSITIPGSDAKF 128

Query: 135 INDLIKSGFLQNWLIDGLPAARQLYDQTTKSSFYGSGFELGSVEMIQVVDE--APSHTTP 192
           IN LIK+GF QNWLIDGLPAAR++YD  T + FY  GF LG VE+ + V     P     
Sbjct: 129 INKLIKNGFFQNWLIDGLPAARKIYDSNTHTEFYDVGFPLGFVEIKKNVGGLGIPMDAKT 188

Query: 193 KQP---------------IVEDVLSQELDEEQATEKRANQMLVSSVERTYFANHFDIHIE 237
           K                   +    ++ ++++  E +    LV +VE  Y ANH+ I++E
Sbjct: 189 KDSGKKNSNSDKKKDSKKKDDSQKKEDSNKKEKREPKRISKLVHNVEFPYLANHYVINVE 248

Query: 238 YHDRGNNEYRIVGVTVNPISMKRDSAICDTNLGKLALSEVSDTDVIFTYSVTFEKSDTVW 297
            HDRG   YR+VGVTV+P S   DSA  +    KL L E  D +V F+YSV F +S+TVW
Sbjct: 249 VHDRGEGNYRVVGVTVDPYSTT-DSANPEKG-NKLFLDEKKDNEVTFSYSVNFIESETVW 306

Query: 298 ATRWDKYLHIYDPTIQWFSLINFTXXXXXXXXXXXHFLTKALKNDFVRYNEFNLNDSFDE 357
           ATRWDKYLH Y+PTIQWFSL+NF+           + L KALK+DF RY EFNL++SF+E
Sbjct: 307 ATRWDKYLHTYNPTIQWFSLVNFSIIVLLLSALVTYSLLKALKSDFARYEEFNLDNSFNE 366

Query: 358 DSGWKLAHGDVFRIPTKSMLLSIFVGSGTQLFFMISSVLVLAALGFLSPSARGSLPTIMF 417
           DSGWKL HGDVFRIP++SMLLSI VGSG QLF MI S + LAA+G +SPS+RGSLP+ MF
Sbjct: 367 DSGWKLGHGDVFRIPSQSMLLSILVGSGAQLFLMIISSIFLAAIGIISPSSRGSLPSAMF 426

Query: 418 ILYAVFGFVGSYTSMGVYRFFNGPYWKANMILTPLIVPGGIFMFIISMNLFLVFVHSSDV 477
             YA+FGF GSY SM VY+FF GPYWKANMILTPL+VPG I + I+ +N FL+FVHSS  
Sbjct: 427 TFYALFGFWGSYISMSVYKFFKGPYWKANMILTPLLVPGFILVSILGLNFFLLFVHSSGT 486

Query: 478 VPIGTLSLMVLLWIVLSLPLSFAGSLISFKRCTWYDHPTKTNEVLRQIPFQPWYLKTVPA 537
           +P+  L L+V++W V+SLPLSF GSL++ KR  W +HPTKTN++ RQIPFQ WYLKT+PA
Sbjct: 487 IPMTALLLIVVIWFVISLPLSFLGSLLANKRSNWGEHPTKTNQIARQIPFQSWYLKTIPA 546

Query: 538 TLIGGIFPFGSIAVELYFIYSSLWFNKIFYMFGFLLVSFLLLTMTTSLVTIIVTYHSLCL 597
            LI GIFPFG+IAVELYFIY+SLWFNKIFYMFGFL VSFLLLT+TTSLVT+++TY SLC+
Sbjct: 547 ILIAGIFPFGAIAVELYFIYTSLWFNKIFYMFGFLFVSFLLLTLTTSLVTVLITYQSLCM 606

Query: 598 ENWRWQWRSFIIGGIGCSIYIFIHSILFTEFKLGGFITIVLYVGYSALIAILCAMVTGAI 657
           ENW WQWRSF IGG+GCS+YIFIHSILFT+FKLGGF T++LY+GY+ L++IL  +VTGA+
Sbjct: 607 ENWNWQWRSFTIGGVGCSLYIFIHSILFTKFKLGGFTTMILYIGYTLLLSILSCIVTGAV 666

Query: 658 GFISNMFFVKKIYSSIKVE 676
           GFIS+M FV+KIYS+++V+
Sbjct: 667 GFISSMIFVRKIYSNVRVD 685

>KLTH0G13882g Chr7 (1204180..1206243) [2064 bp, 687 aa] {ON} similar
           to uniprot|P32802 Saccharomyces cerevisiae YLR083C EMP70
           Protein whose 24kDa cleavage product is found in
           endosome-enriched membrane fractions predicted to be a
           transmembrane protein
          Length = 687

 Score =  809 bits (2089), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 404/677 (59%), Positives = 512/677 (75%), Gaps = 19/677 (2%)

Query: 16  SVTNGFYLPGVAPTTYHELDSIPLLVNHLTPSMFFKHKDSDGNELSSDKENFLYSYDYYY 75
           S  +GFYLPGVAPTTYHE D+IPLLVNHLTP+M+++H D DGN+L  DKE+ LYSYDYYY
Sbjct: 14  SQVSGFYLPGVAPTTYHEGDAIPLLVNHLTPTMYYQHADEDGNDLG-DKESLLYSYDYYY 72

Query: 76  SKLHFCKPLDREIKKQPESLGSILFGDRIYNSPFELKMLVDENCKELCSTNIPGDDAKFI 135
            K HFC+P   +++KQ ESLGSI+FGDRIYNSPF+++ML ++ C  LCS +IP DDAKFI
Sbjct: 73  PKFHFCRP--EKLEKQRESLGSIIFGDRIYNSPFQIEMLKNKECASLCSESIPADDAKFI 130

Query: 136 NDLIKSGFLQNWLIDGLPAARQLYDQTTKSSFYGSGFELGSVEM------------IQVV 183
           N LI +GF QNWL+DGLPAAR+  D  TKS FY  GFELG V +             Q  
Sbjct: 131 NKLITNGFFQNWLVDGLPAARKTTDVRTKSEFYTPGFELGYVGIGGSELRMNGQGGSQDG 190

Query: 184 DEAPSHTTPKQPIVEDVLSQELDEEQATEKRA---NQMLVSSVERTYFANHFDIHIEYHD 240
           D++ SH + K+    D L     +    +++     + LV  +E  YFANHF+I ++YHD
Sbjct: 191 DDSGSHGSTKEVSESDYLDAPPAKRSLAKRKQVSNTKELVKQLETPYFANHFEIEVQYHD 250

Query: 241 RGNNEYRIVGVTVNPISMKRDSA-ICDTNLGKLALSEVSDTDVIFTYSVTFEKSDTVWAT 299
           RGN  YR+VGV VNP S+KR+S   CD     L LSE   T+V F+YSV F  S+TVWAT
Sbjct: 251 RGNGNYRVVGVIVNPYSIKRESPDTCDKTGELLKLSETEATEVHFSYSVKFTPSETVWAT 310

Query: 300 RWDKYLHIYDPTIQWFSLINFTXXXXXXXXXXXHFLTKALKNDFVRYNEFNLNDSFDEDS 359
           RWDKYLH+YDP IQWFSLINF+           H L   L +D  RYN+ NL+D F E++
Sbjct: 311 RWDKYLHVYDPKIQWFSLINFSLVVVFLSTVMIHRLYVTLTDDLSRYNQINLDDDFQEET 370

Query: 360 GWKLAHGDVFRIPTKSMLLSIFVGSGTQLFFMISSVLVLAALGFLSPSARGSLPTIMFIL 419
           GWKL HGDVFR P +S++LS+ VGSG QLF M +  +  A LG LSPS+RGSL T+MFIL
Sbjct: 371 GWKLIHGDVFRTPERSLILSVLVGSGAQLFLMAACTIGFALLGLLSPSSRGSLTTVMFIL 430

Query: 420 YAVFGFVGSYTSMGVYRFFNGPYWKANMILTPLIVPGGIFMFIISMNLFLVFVHSSDVVP 479
           YA+FG  GSYTSM  Y+FF GPYWK NM+LTP++VPG +F  ++++N FLV V S+  +P
Sbjct: 431 YALFGSFGSYTSMATYKFFGGPYWKVNMLLTPILVPGLLFCVMLALNFFLVVVESAGAIP 490

Query: 480 IGTLSLMVLLWIVLSLPLSFAGSLISFKRCTWYDHPTKTNEVLRQIPFQPWYLKTVPATL 539
            GT+ ++VLLW + S+PLS AGSLI+ K+C W +HPTKT ++ RQIPFQPWYLKTVPA+L
Sbjct: 491 FGTMCVIVLLWFLFSIPLSVAGSLIARKKCKWDEHPTKTKQIPRQIPFQPWYLKTVPASL 550

Query: 540 IGGIFPFGSIAVELYFIYSSLWFNKIFYMFGFLLVSFLLLTMTTSLVTIIVTYHSLCLEN 599
           I GIFPFGSIAVELYFIYSSLWFNKIFYMFGFL VSFLLLT+TTSL+T+++TY+SLCLEN
Sbjct: 551 IAGIFPFGSIAVELYFIYSSLWFNKIFYMFGFLFVSFLLLTLTTSLITVLLTYYSLCLEN 610

Query: 600 WRWQWRSFIIGGIGCSIYIFIHSILFTEFKLGGFITIVLYVGYSALIAILCAMVTGAIGF 659
           W+WQWR F IGG GC++Y+FIH+ILFT+F+LGGF TIVLYVGYS ++++L  ++TG +GF
Sbjct: 611 WKWQWRGFWIGGAGCALYMFIHAILFTKFRLGGFTTIVLYVGYSLVMSLLSCLITGTVGF 670

Query: 660 ISNMFFVKKIYSSIKVE 676
           +S+++FV++IYSS+KV+
Sbjct: 671 LSSLWFVRRIYSSVKVD 687

>NCAS0B03890 Chr2 (693950..695941) [1992 bp, 663 aa] {ON} Anc_8.254
          Length = 663

 Score =  794 bits (2050), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 384/666 (57%), Positives = 484/666 (72%), Gaps = 12/666 (1%)

Query: 12  LITLSVTNGFYLPGVAPTTYHELDSIPLLVNHLTPSMFFKHKDSDGNELSSDKENFLYSY 71
           L  LSV   F LPG+ P TY + D IPLLVNHLTPSM F HK+ +G ++S+ K+  ++SY
Sbjct: 9   LFCLSVVEAFNLPGLGPVTYQKGDDIPLLVNHLTPSMHFHHKNEEGKDISTAKKYVVHSY 68

Query: 72  DYYYSKLHFCKPLDREIKKQPESLGSILFGDRIYNSPFELKMLVDENCKELCSTNIPGDD 131
           DYYY K HFC+P+   I+K   S+GSILFGDRIYNSPF+L ML ++ C  LC + IPG D
Sbjct: 69  DYYYEKFHFCQPV--HIEKAGSSIGSILFGDRIYNSPFQLNMLENKTCVPLCESIIPGKD 126

Query: 132 AKFINDLIKSGFLQNWLIDGLPAARQLYDQTTKSSFYGSGFELGSVEMIQVVDEAPSHTT 191
           A+FIN LIK+G+ QNW IDGLPAAR++YD+ TKSSFYG+GFELG VE+ Q         T
Sbjct: 127 AEFINKLIKNGYYQNWFIDGLPAAREVYDKRTKSSFYGNGFELGLVEIRQ---------T 177

Query: 192 PKQPIVEDVLSQELDEEQATEKRANQMLVSSVERTYFANHFDIHIEYHDRGNNEYRIVGV 251
               ++ D +    D  +   K   Q L+  VE  YF NHFDI IEYH+RGN  YR+VG 
Sbjct: 178 TGDKLLPDSVHDISDLAKRDAKNLVQNLIKEVEVPYFVNHFDIVIEYHERGNGNYRVVGA 237

Query: 252 TVNPISMKRDSAICDTNLGK-LALSEVSDTDVIFTYSVTFEKSDTVWATRWDKYLHIYDP 310
           TVNP+S+ R SA   T  GK L L+E  D +V  TYSVTF  S T W TRWDKYLH+YDP
Sbjct: 238 TVNPVSIARKSAGDCTPTGKSLTLNEEEDNNVHSTYSVTFVPSKTSWVTRWDKYLHVYDP 297

Query: 311 TIQWFSLINFTXXXXXXXXXXXHFLTKALKNDFVRYNEFNLNDSFDEDSGWKLAHGDVFR 370
            IQWFSLINF+           + L KALK+DF RYN  NL+D   E+SGWKL HG VFR
Sbjct: 298 KIQWFSLINFSLIVILLSVILINSLLKALKSDFARYNNINLDDDVKEESGWKLVHGYVFR 357

Query: 371 IPTKSMLLSIFVGSGTQLFFMISSVLVLAALGFLSPSARGSLPTIMFILYAVFGFVGSYT 430
           IP   M+LSI VGSG QLF +I   + LAA+  LSP  RG+LPT M ILY +FGF+ SY 
Sbjct: 358 IPKNPMILSILVGSGFQLFLVIVCTVFLAAIDILSPIYRGALPTAMIILYILFGFISSYV 417

Query: 431 SMGVYRFFNGPYWKANMILTPLIVPGGIFMFIISMNLFLVFVHSSDVVPIGTLSLMVLLW 490
           SMGVY+FF GPYWK NM+LTP++VPG I +  +++NLFL+F  SS VVP  T+  ++LLW
Sbjct: 418 SMGVYKFFKGPYWKVNMLLTPILVPGLIIITFLALNLFLMFSESSSVVPAKTIMTLILLW 477

Query: 491 IVLSLPLSFAGSLISFKRCTWYDHPTKTNEVLRQIPFQPWYLKTVPATLIGGIFPFGSIA 550
             +S+PLS AGSL++ K+C W +HPT TN++ + IP Q WYLKT+PA+LIGG+F FGSI+
Sbjct: 478 FAVSIPLSVAGSLMAQKKCHWDEHPTVTNQIAKVIPPQKWYLKTIPASLIGGLFSFGSIS 537

Query: 551 VELYFIYSSLWFNKIFYMFGFLLVSFLLLTMTTSLVTIIVTYHSLCLENWRWQWRSFIIG 610
           V+LYFIY+SLWFN IFYM+GFLL S  L TMT +LVTI+ TYHSLC ENW+WQWR F IG
Sbjct: 538 VQLYFIYTSLWFNNIFYMYGFLLFSICLFTMTITLVTILFTYHSLCQENWKWQWRGFFIG 597

Query: 611 GIGCSIYIFIHSILFTEFKLGGFITIVLYVGYSALIAILCAMVTGAIGFISNMFFVKKIY 670
           G+GCSIY+ +HS+ F E KLGGF  I+LY+GYS+++  L  +VTG++GF+S+MFF+K+I+
Sbjct: 598 GLGCSIYVLLHSLFFIELKLGGFTNILLYMGYSSVVTALIFLVTGSVGFLSSMFFIKRIF 657

Query: 671 SSIKVE 676
           SS+KV+
Sbjct: 658 SSVKVD 663

>TDEL0F03810 Chr6 complement(696251..698221) [1971 bp, 656 aa] {ON}
           Anc_8.254 YLR083C
          Length = 656

 Score =  785 bits (2027), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/661 (56%), Positives = 480/661 (72%), Gaps = 17/661 (2%)

Query: 16  SVTNGFYLPGVAPTTYHELDSIPLLVNHLTPSMFFKHKDSDGNELSSDKENFLYSYDYYY 75
           +V+   +LPG++PT Y     I L VNHLTPS  F+HKD DGN + SDKE++LYSYDYY 
Sbjct: 13  AVSRASFLPGISPTNYDAKSEIALYVNHLTPSRHFQHKDKDGNNIKSDKEHYLYSYDYYN 72

Query: 76  SKLHFCKPLDREIKKQPESLGSILFGDRIYNSPFELKMLVDENCKELCSTNIPGDDAKFI 135
           SKLHFCKP    + +Q ESLGS+LFGDR+YNSPF+L ML D++C  LC + IPG+DA FI
Sbjct: 73  SKLHFCKP--ENVIEQAESLGSVLFGDRLYNSPFKLNMLEDKSCVSLCKSVIPGEDAAFI 130

Query: 136 NDLIKSGFLQNWLIDGLPAARQLYDQTTKSSFYGSGFELGSVEMIQVVDEAPSHTTPKQP 195
           N LIK+GFL NWL+DGLPA   + ++   S+   +GF LGSVE++Q V    +  TP+  
Sbjct: 131 NKLIKNGFLHNWLVDGLPAGTLINNERESSAHITNGFPLGSVEIMQGVHNG-AMATPR-- 187

Query: 196 IVEDVLSQELDEEQATEKRANQMLVSSVERTYFANHFDIHIEYHDRGNNEYRIVGVTVNP 255
                      EE       + ++V+ +E  +  NH+DI I+YH+    +YRIVGV V P
Sbjct: 188 -----------EETGISAHGSNVVVN-LELPHLNNHYDITIQYHEPEAGKYRIVGVEVEP 235

Query: 256 ISMKRDSAICDTNLGKLALSEVSDTDVIFTYSVTFEKSDTVWATRWDKYLHIYDPTIQWF 315
            S+K+ S  C+    +++LSE  D +V++TYSV + +    WATRWD Y   YD T+QWF
Sbjct: 236 KSIKQTSNSCEFTGEQISLSEDQDNEVLYTYSVRYVRFSHTWATRWDNYRFSYDTTVQWF 295

Query: 316 SLINFTXXXXXXXXXXXHFLTKALKNDFVRYNEFNLNDSFDEDSGWKLAHGDVFRIPTKS 375
           SLI+             H L +ALK+DF RYNE NL+D F E+SGWKL+HGDVFR+P KS
Sbjct: 296 SLISCVIVVIGLSSVVLHMLLRALKSDFARYNELNLDDEFHEESGWKLSHGDVFRMPNKS 355

Query: 376 MLLSIFVGSGTQLFFMISSVLVLAALGFLSPSARGSLPTIMFILYAVFGFVGSYTSMGVY 435
           +LLS+ VGSG QL  +    +V+AA+ F +  +R  LPTI F+LYA+FGFVGSY SMGVY
Sbjct: 356 LLLSVLVGSGVQLLLLAVGGIVIAAIAFNNAGSREVLPTIFFVLYALFGFVGSYASMGVY 415

Query: 436 RFFNGPYWKANMILTPLIVPGGIFMFIISMNLFLVFVHSSDVVPIGTLSLMVLLWIVLSL 495
           RFF GPY K NMILTP ++PG I + IIS+N FL+  HSSD +P   L  +VLLW+++S+
Sbjct: 416 RFFKGPYPKVNMILTPFLIPGLILLTIISLNFFLLIAHSSDAIPFSALFAVVLLWLIISV 475

Query: 496 PLSFAGSLISFKRCTWYDHPTKTNEVLRQIPFQPWYLKTVPATLIGGIFPFGSIAVELYF 555
           PLS AGSL + K C+W  HPTKTN++ RQIPFQPWYLKT+PA L+ GIFPF SIAVELYF
Sbjct: 476 PLSLAGSLTAIKTCSWDQHPTKTNQIARQIPFQPWYLKTLPAALVAGIFPFASIAVELYF 535

Query: 556 IYSSLWFNKIFYMFGFLLVSFLLLTMTTSLVTIIVTYHSLCLENWRWQWRSFIIGGIGCS 615
           IY+SLWF++ FYMFGF +VS  LL +TT+LVT+++TYHSLCLENW+WQWRSFI+GG+G +
Sbjct: 536 IYNSLWFHQFFYMFGFSMVSLFLLVLTTALVTVMITYHSLCLENWQWQWRSFIVGGLGSA 595

Query: 616 IYIFIHSILFTEFKLGGFITIVLYVGYSALIAILCAMVTGAIGFISNMFFVKKIYSSIKV 675
           +YIFIHSI FTEFKL GF TIVLYVGYS LI+ILC + TGA+GF S+MF V+KI+SS+KV
Sbjct: 596 VYIFIHSIFFTEFKLRGFTTIVLYVGYSMLISILCCLTTGAVGFFSSMFLVRKIFSSVKV 655

Query: 676 E 676
           +
Sbjct: 656 D 656

>AGR097W Chr7 (920133..922094) [1962 bp, 653 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR083C (EMP70) and
           YDR107C
          Length = 653

 Score =  721 bits (1861), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 378/663 (57%), Positives = 479/663 (72%), Gaps = 21/663 (3%)

Query: 15  LSVTNGFYLPGVAPTTYHELDSIPLLVNHLTPSMFFKHKDSDGNELSSDKENFLYSYDYY 74
           L +  GFYLPG APTTY   D+IPLLVNH+TP++F    D  G +   DKE +LY+YDYY
Sbjct: 11  LGLAQGFYLPGSAPTTYRRGDAIPLLVNHITPTVF--SDDRAGTDGQRDKERYLYAYDYY 68

Query: 75  YSKLHFCKPLDREIKKQPESLGSILFGDRIYNSPFELKMLVDENCKELCSTNIPGDDAKF 134
           Y +LH C+P   +I+K  ESLGSI+FGDR++NSPFELKML +++C  LC   +P +DAKF
Sbjct: 69  YPRLHMCRP--DKIEKVSESLGSIIFGDRLHNSPFELKMLEEKSCVALCEKTVPAEDAKF 126

Query: 135 INDLIKSGFLQNWLIDGLPAARQLYDQTTKSSFYGSGFELGSVEMIQVVDEAPSHTTPKQ 194
           IN LI+SGF  NWL+DGLPA R+++D  T + FYG+GFELG V                 
Sbjct: 127 INQLIRSGFFHNWLVDGLPAGREMHDARTNTVFYGTGFELGRVIRG-------------- 172

Query: 195 PIVEDVLSQELDEEQATEKRANQMLVSSVERTYFANHFDIHIEYHDRGNNEYRIVGVTVN 254
              ED   +E  E +   +R  Q   S V   YF NHF+I ++YH R  +E R+VGV+V 
Sbjct: 173 --TEDRNQEEPGEIELQTRRVLQPGESVVAVPYFINHFEITVDYHKRAEDELRVVGVSVL 230

Query: 255 PISMKRDSA-ICDTNLGKLALSEVSDTDVIFTYSVTFEKSDTVWATRWDKYLHIYDPTIQ 313
           P S++      C  +   L LSE +DT V FTYSV F +SD  WATRW KYLH+YDP +Q
Sbjct: 231 PRSLQNPVGDKCANSGNGLVLSETADTKVTFTYSVRFHESDVSWATRWGKYLHVYDPKVQ 290

Query: 314 WFSLINFTXXXXXXXXXXXHFLTKALKNDFVRYNEFNLNDSFDEDSGWKLAHGDVFRIPT 373
           W+SLINF+           H L +ALK D  RYN+FNL++ F ED GWKL H DVFR P+
Sbjct: 291 WYSLINFSLVVLLLSSIMVHSLFRALKTDLDRYNDFNLDNEFQEDYGWKLLHSDVFRSPS 350

Query: 374 KSMLLSIFVGSGTQLFFMISSVLVLAALGFLSPSARGSLPTIMFILYAVFGFVGSYTSMG 433
           K++LLS+FVGSG QLF M +  L +A LGFLSPS+RGSL TIMF+LYA+FG  GSY SM 
Sbjct: 351 KTLLLSVFVGSGGQLFLMSACTLFIAMLGFLSPSSRGSLGTIMFVLYAIFGGFGSYLSMS 410

Query: 434 VYRFFNGPYWKANMILTPLIVPGGIFMFIISMNLFLVFVHSSDVVPIGTLSLMVLLWIVL 493
            Y+ F G  WK NM+LTPL+VPG IF  ++ MN FLV V SS  +P GT+  +V+LW VL
Sbjct: 411 TYKMFGGEKWKVNMVLTPLLVPGIIFATMLLMNFFLVMVQSSGAMPFGTMLAIVVLWFVL 470

Query: 494 SLPLSFAGSLISFKRCTWYDHPTKTNEVLRQIPFQPWYLKTVPATLIGGIFPFGSIAVEL 553
           S+P+S  GSL + K+ TW  HPTKT+++ +QIP QPWYL+T PA  I G+FPFG+IAVEL
Sbjct: 471 SIPISIMGSLFARKKNTWDQHPTKTSQIAKQIPPQPWYLRTWPAAYIAGLFPFGAIAVEL 530

Query: 554 YFIYSSLWFNKIFYMFGFLLVSFLLLTMTTSLVTIIVTYHSLCLENWRWQWRSFIIGGIG 613
           YFIY+S+WFN +FYMFGFL  +FLLLT+TT+LVTI++TY+SLC+ENW WQWRSFIIGGIG
Sbjct: 531 YFIYTSIWFNTMFYMFGFLFFTFLLLTLTTALVTILLTYYSLCMENWSWQWRSFIIGGIG 590

Query: 614 CSIYIFIHSILFTEFKLGGFITIVLYVGYSALIAILCAMVTGAIGFISNMFFVKKIYSSI 673
           CS Y+FI+SILFT+F+LGGF+TIVLYVGYS LI+ L  +VTG IGF+S+++FV+KIYSSI
Sbjct: 591 CSTYVFINSILFTKFRLGGFVTIVLYVGYSLLISFLFCLVTGTIGFVSSLWFVRKIYSSI 650

Query: 674 KVE 676
           KV+
Sbjct: 651 KVD 653

>NDAI0J01420 Chr10 (326749..328608) [1860 bp, 619 aa] {ON} Anc_8.254
          Length = 619

 Score =  718 bits (1853), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/630 (54%), Positives = 451/630 (71%), Gaps = 12/630 (1%)

Query: 48  MFFKHKDSDGNELSSDKENFLYSYDYYYSKLHFCKPLDREIKKQPESLGSILFGDRIYNS 107
           M + HK+ +G ++S+D +  +YSYDYYY KLHFCKP    ++K   S+GS+LFGDR+YNS
Sbjct: 1   MHYHHKNQEGQDISTDDKRTIYSYDYYYEKLHFCKP--EHVEKAGVSIGSVLFGDRLYNS 58

Query: 108 PFELKMLVDENCKELCSTNIPGDDAKFINDLIKSGFLQNWLIDGLPAARQLYDQTTKSSF 167
           PF+L ML ++ C+ LC++ I G DAKFIN LIK+G+ QNWLIDGLPAAR++YD  TKS+F
Sbjct: 59  PFQLNMLKNKTCERLCNSTIIGRDAKFINKLIKNGYYQNWLIDGLPAAREVYDTRTKSNF 118

Query: 168 YGSGFELGSVEMIQVVDEAPSHTTPKQPIVEDVLSQELDEEQATEKRANQMLVSSVERTY 227
           YG+GFELG VE+ Q   E          ++ +      D  +   K   Q L+  +E  Y
Sbjct: 119 YGNGFELGLVEIRQTTGEK---------LLPNSADTFRDLHKRDAKNIVQNLMQDIEVPY 169

Query: 228 FANHFDIHIEYHDRGNNEYRIVGVTVNPISMKRD-SAICDTNLGKLALSEVSDTDVIFTY 286
           F NHFDI IEYHDRGN+ YR+VGVTVNP+S+ R     C      L+LSE     + FTY
Sbjct: 170 FVNHFDIRIEYHDRGNDNYRVVGVTVNPVSIDRSPDGGCKPTGKALSLSESEVNYIHFTY 229

Query: 287 SVTFEKSDTVWATRWDKYLHIYDPTIQWFSLINFTXXXXXXXXXXXHFLTKALKNDFVRY 346
           SV F  S+T W TRWDKYLH+YDPTIQW S++NF+             L +ALK+DF RY
Sbjct: 230 SVEFIPSETAWVTRWDKYLHVYDPTIQWVSIVNFSIVVIILSCAVARSLLQALKSDFSRY 289

Query: 347 NEFNLNDSFDEDSGWKLAHGDVFRIPTKSMLLSIFVGSGTQLFFMISSVLVLAALGFLSP 406
            E NL+++  ED+ WKL HGDVFR P   MLLSI VGSG QLF MI   + L A+G ++P
Sbjct: 290 GELNLDETIKEDASWKLGHGDVFRAPDHPMLLSILVGSGVQLFLMIICTIFLPAVGLITP 349

Query: 407 SARGSLPTIMFILYAVFGFVGSYTSMGVYRFFNGPYWKANMILTPLIVPGGIFMFIISMN 466
            +RG+LPT+MF+LY  F F+ S+ SMGVY+FFNG  W  N ILTP +VPG + + II +N
Sbjct: 350 GSRGTLPTVMFLLYLGFSFISSFVSMGVYKFFNGQKWHINCILTPFLVPGLLLLVIIGLN 409

Query: 467 LFLVFVHSSDVVPIGTLSLMVLLWIVLSLPLSFAGSLISFKRCTWYDHPTKTNEVLRQIP 526
           +FL+FVHSS V+P+ T + ++LLW  + +PLS  GSL++ K C W  HPTKTN V + IP
Sbjct: 410 IFLIFVHSSGVIPLATFTSLILLWFFIGVPLSITGSLMARKTCHWDIHPTKTNTVSKVIP 469

Query: 527 FQPWYLKTVPATLIGGIFPFGSIAVELYFIYSSLWFNKIFYMFGFLLVSFLLLTMTTSLV 586
            Q WYL+T+PA+LIGG+F FGS++VELYF+Y+SLWFNKIFYM+GFL  S +L T+T SLV
Sbjct: 470 PQKWYLQTIPASLIGGLFSFGSLSVELYFVYTSLWFNKIFYMYGFLFGSAILFTLTVSLV 529

Query: 587 TIIVTYHSLCLENWRWQWRSFIIGGIGCSIYIFIHSILFTEFKLGGFITIVLYVGYSALI 646
           T++ TY+SL  ENW+WQWRSF+I G+GCS Y+F+HS+LFTE KLGGF   +LY+GYS +I
Sbjct: 530 TVLFTYYSLSAENWQWQWRSFLIAGLGCSFYVFLHSLLFTEVKLGGFTNALLYMGYSFVI 589

Query: 647 AILCAMVTGAIGFISNMFFVKKIYSSIKVE 676
             L  +VTGA+GF+S+M FV+ IYS++KV+
Sbjct: 590 TSLAFVVTGALGFLSSMLFVRTIYSAVKVD 619

>Ecym_4317 Chr4 (685854..687671) [1818 bp, 605 aa] {ON} similar to
           Ashbya gossypii AGR097W
          Length = 605

 Score =  600 bits (1546), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/666 (46%), Positives = 439/666 (65%), Gaps = 69/666 (10%)

Query: 12  LITLSVTNGFYLPGVAPTTYHELDSIPLLVNHLTPSMFFKHKDSDGNELSSDKENFLYSY 71
           L+   V+ GFY PGV+P TYH  D IPLLVN+L+                    +FL++ 
Sbjct: 8   LLCAGVSYGFYFPGVSPVTYHIGDEIPLLVNYLS-------------------SDFLWNI 48

Query: 72  DYYYSKLHFCKPLDREIKKQPESLGSILFGDRIYNSPFELKMLVDENCKELCSTNIPGDD 131
           DYY   +  CKP    IK+Q ESLGS++FGDR+YNSPF++ ML +  C +LC T I   D
Sbjct: 49  DYYSDSIGLCKP--NTIKEQSESLGSVIFGDRLYNSPFKVSMLKNSECVKLCDTTI---D 103

Query: 132 AKFINDLIKSGFLQNWLIDGLPAARQLYDQTTKSSFYGSGFELGSVEMIQVVDEAPSHTT 191
               N      +  NWL+DGLP      D T+ ++ Y +  EL                 
Sbjct: 104 TALWNTFFGYRYSYNWLVDGLPVLG--IDGTSDANGYHNNSEL----------------- 144

Query: 192 PKQPIVEDVLSQELDEEQATEKRANQMLVSSVERTYFANHFDIHIEYHDRGNNEYRIVGV 251
                    +  + DE++                 Y  NHFDI+I Y+DRG  EYR+V  
Sbjct: 145 --------FMGYQADEQK-----------------YIYNHFDIYIHYNDRGKGEYRVVFA 179

Query: 252 TVNPISMKR-DSAICDTNLGKLALSEVSDTDVIFTYSVTFEKSDTVWATRWDKYLHIYDP 310
              PIS+ R  S +C  +   + +   +  ++ FTYSV F+KSD  W+TRWD+YLH+YD 
Sbjct: 180 EAKPISLPRTGSELCSKDAKPVPIGSGNHENITFTYSVIFKKSDISWSTRWDQYLHVYDF 239

Query: 311 TIQWFSLINFTXXXXXXXXXXXHFLTKALKNDFVRYNEFNLNDSFDEDSGWKLAHGDVFR 370
            IQ   LI+F+           H L + LK D   Y+EFNL+D F +D  WK+ HG+VFR
Sbjct: 240 DIQLAELISFSLVVLLLSSVLVHSLFRVLKRDIAAYSEFNLDDEFQQDYCWKIIHGEVFR 299

Query: 371 IPTKSMLLSIFVGSGTQLFFMISSVLVLAALGFLSPSARGSLPTIMFILYAVFGFVGSYT 430
            P+K++LLS+FVGSG+QLFFM    ++L + GFLSPSARGSL T+MF+LYA+FG VGSYT
Sbjct: 300 SPSKALLLSVFVGSGSQLFFMALCTVLLGSCGFLSPSARGSLGTVMFVLYALFGGVGSYT 359

Query: 431 SMGVYRFFNGPYWKANMILTPLIVPGGIFMFIISMNLFLVFVHSSDVVPIGTLSLMVLLW 490
           SM +Y+FF G  WK N+ILTPL++P  +F+  + +N FL++  SS  +P GT+  +++LW
Sbjct: 360 SMSIYKFFGGQNWKLNLILTPLLIPVFLFVTTVLLNFFLIYAKSSGAMPFGTMVTIIILW 419

Query: 491 IVLSLPLSFAGSLISFKRCTWYDHPTKTNEVLRQIPFQPWYLKTVPATLIGGIFPFGSIA 550
            +LS+P+S  GSL+S+K   W +HP KTN++ RQ+P QPWY+KT  AT + G+FPFG++A
Sbjct: 420 FILSVPVSIIGSLLSWKLNRWDEHPAKTNQIARQVPSQPWYIKTWVATFLAGMFPFGAMA 479

Query: 551 VELYFIYSSLWFNKIFYMFGFLLVSFLLLTMTTSLVTIIVTYHSLCLENWRWQWRSFIIG 610
           VELY+IY+S+W   IF+M+GFL V+F+LLT+TTSLVTI++TY+SLC+ENW+WQWRSFIIG
Sbjct: 480 VELYYIYASIWGEIIFFMYGFLFVAFILLTLTTSLVTILLTYYSLCMENWKWQWRSFIIG 539

Query: 611 GIGCSIYIFIHSILFTEFKLGGFITIVLYVGYSALIAILCAMVTGAIGFISNMFFVKKIY 670
           G+GCS+Y+F+HS+ F +FK  GF+++VLY+GYSA+++I+C +VTG+IGF++N++FV+KIY
Sbjct: 540 GVGCSVYVFLHSLFFIKFKFPGFVSMVLYLGYSAMVSIVCCLVTGSIGFLANLWFVRKIY 599

Query: 671 SSIKVE 676
           S+IKV+
Sbjct: 600 SNIKVD 605

>NCAS0A14520 Chr1 complement(2860704..2862716) [2013 bp, 670 aa]
           {ON} Anc_7.411 YER113C
          Length = 670

 Score =  167 bits (422), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 180/698 (25%), Positives = 286/698 (40%), Gaps = 128/698 (18%)

Query: 26  VAPTTYHELDSIPLLVNHLTPSMFFKHKDSDGNELSSDKENFLYSYDYYYSKLHFCKPLD 85
           + P  Y + D + L+VN +         +SD  +L            Y Y  L F  P  
Sbjct: 42  LRPNYYSKGDPVELIVNKV---------ESDLTQLP-----------YAYYDLPFTCPPT 81

Query: 86  REIKKQPESLGSILFGDRIYNSPFELKMLVDENCKELCSTNIPGDDAKFINDLIKSGFLQ 145
              K    SL  I+ GDR + S + L    D+ C  LC+     +  K   +L+K+G++ 
Sbjct: 82  MHKKPLHLSLNEIIRGDRKWQSDYILNFGEDDQCHILCTRKTTKEGMKEAQELVKNGYVV 141

Query: 146 NWLIDG-LPAARQLYDQTTKSSFYGSGFELGSVEMIQVVDEAPSHTTPKQPIVEDVLSQE 204
            WLID  LPA       T    +Y SGF LG V                           
Sbjct: 142 QWLIDDELPAVTTFISTTDHKKYYASGFPLGFV--------------------------- 174

Query: 205 LDEEQATEKRANQMLVSSVERTYFANHFDIHIEYHDRGNNEYRIVGVTVNP---ISMKRD 261
            D E                +TY   H  I I Y+    N++ I G  + P   +     
Sbjct: 175 -DPETG--------------KTYLNTHVMIVIRYNTVDTNKHTIFGFELYPKSTVDFHCP 219

Query: 262 SAICDTNLGKLALSEVSD--TDVIFTYSVTFEKSDTV-WATRWDKYLHIYD------PTI 312
            A  D    +L + E  D  T + FTYSV + +   V W  RWD YL+  +         
Sbjct: 220 GASKDYEQYELVVPENDDDLTFIPFTYSVYWREEYLVDWEHRWDLYLNAGELSNDKSKQF 279

Query: 313 QWFSLINFTXXXXXXXXXXXHFLTKALKNDFVRYNEFNLND-SFDEDSGWKLAHGDVFRI 371
            W SL N              FL  ++    + Y  F ++  SF + S  +   G ++ +
Sbjct: 280 HWISLAN---------SFGIVFLISSI-TAVILYRTFKISRRSFSDISKEEDDKGSIYVV 329

Query: 372 PTKSML---------LSIFVGSGTQLFFMISSVLVLAALGFLSPSARGSLPTIMFILYAV 422
             K +L         L IFV  G Q  F +   L+++       + R S+ T+  + +  
Sbjct: 330 ARKWLLNEQTPLANVLIIFVSMGVQFLFTVLGSLIISCSLKKLHNVRDSVLTMGLLCFVT 389

Query: 423 FGFVGSYTSMGVYRFFN----------GPYWKANMILTPLIVPGGIFMFIISMNLFLVFV 472
             F+ S+T   + +               Y+    +L   ++P  + +  + +N  +   
Sbjct: 390 GAFMASFTGAHLLKSREEMCSESQMKPTRYYPVFALLCGSLLPSFVMLVALLLNSIVWAH 449

Query: 473 HSSDVVPIGTLSLMVLLWIVLSLPLSFAGSLISFKRCTWYDHPTKTNE---------VLR 523
            S+  +P GT+  ++ ++ V+ +PLS  G  I+ K       P+ +           V +
Sbjct: 450 DSTHALPFGTVLFLISVYFVVCIPLSLLGGYIAVKSTN--SKPSFSFSIGNYSDRIFVYK 507

Query: 524 QIPFQPWYLKTVP----ATLIGGIFPFGSIAVELYFIYSSLWFNK--IFYMFGFLLVSFL 577
            I   P  L   P    A L GG+FPF  I VEL ++Y SLW  K   +Y +GFLL + L
Sbjct: 508 TITMSPSVLINRPLSSLAILAGGLFPFIIIYVELQYVYKSLWLEKTTFYYFYGFLLANIL 567

Query: 578 LLTMTTSLVTIIVTY---HSLCLENWRWQWRSFIIGGIGCSIYIFIHSILFTEFKLG--G 632
           LL +    ++II T+   +S    +  W+W SF IG   C+ Y+ ++S+ +  F L   G
Sbjct: 568 LLCIVICEISIIGTFILLNSADKNSNNWRWTSFQIGA-SCAFYMEVYSLYYVFFILNIRG 626

Query: 633 FITIVLYVGYSALIAILCAMVTGAIGFISNMFFVKKIY 670
           F +I + V Y  L  I+C   TG+I  +++ +FV+KIY
Sbjct: 627 FSSIFISVCYGTLFNIMCGCATGSIACLTSHWFVQKIY 664

>ZYRO0B03784g Chr2 complement(314902..316878) [1977 bp, 658 aa] {ON}
           similar to uniprot|P40071 Saccharomyces cerevisiae
           YER113C Hypothetical ORF
          Length = 658

 Score =  161 bits (407), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 161/644 (25%), Positives = 274/644 (42%), Gaps = 106/644 (16%)

Query: 75  YSKLHFCKPLDREIKKQPESLGSILFGDRIYNSPFELKMLVDENCKELCSTNIPGDDAKF 134
           Y  L F  P   E K    SL  I+ GDR + S ++L +  D  C+ LC+     +  + 
Sbjct: 70  YYDLPFTCPPTPEKKPLHLSLNEIIKGDRKWESDYKLVVGQDNPCEILCARKTTREGLQT 129

Query: 135 INDLIKSGFLQNWLIDG-LPAARQLYDQTTKSSFYGSGFELGSVEMIQVVDEAPSHTTPK 193
             DLIKSG++  W+ID  LPAA      T    +Y  GF LGSV+             P+
Sbjct: 130 AKDLIKSGYMVQWMIDDDLPAATTYISTTDNLKYYAPGFPLGSVD-------------PR 176

Query: 194 QPIVEDVLSQELDEEQATEKRANQMLVSSVERTYFANHFDIHIEYHDRGNNEYRIVGVTV 253
                                          R +F NH  + I Y+   +++  IVG   
Sbjct: 177 S-----------------------------SRVFFNNHVMLVIRYNLVDSDKVTIVGFEA 207

Query: 254 NPISMKRDSAICDTNLGKLALSEVSD---TDVIF---TYSVTF-EKSDTVWATRWDKYLH 306
            P S+      C          E++D    ++++   TYSV + E ++  W+ RW  Y++
Sbjct: 208 YPKSVSDYH--CPGASKDFKPFEITDPPLEEIVYIPVTYSVYWREDAEIDWSDRWSLYIN 265

Query: 307 IYD------PTIQWFSLINFTXXXXXXXXXXXHFLTKALKNDFVRYNEFNLNDSFDEDSG 360
                     T  W +L N               L    +N     NE  L    +EDS 
Sbjct: 266 RAQLADSSSSTFHWMALANSVGIVLFVTFIVIVNLIMIFRNP----NE-QLESKENEDSS 320

Query: 361 WKLAHGDVFRIPTKSML---------LSIFVGSGTQLFFMISSVLVLAALGFLSPSARGS 411
                 D+F +    +          L + V  G Q+ FMI   L ++       + + S
Sbjct: 321 ------DIFNVANNWLRARQGFQLNRLIVCVSMGIQVMFMILGPLAISLSLTRLHNIKNS 374

Query: 412 LPTIMFILYAVFGFVGSYT--------SMGVYRFFNGPYWKANMILTPLIVPGGIFMFII 463
           + TI  + +    F+ S+         ++  Y F+N  +     +L    +PG I +  +
Sbjct: 375 VLTIAALCFVAGAFMASFVGTWLKMDQNISAYTFYNPVF----AVLCGSALPGSIMVLTL 430

Query: 464 SMNLFLVFVHSSDVVPIGTLSLMVLLWIVLSLPLSFAGSLISFK--RCTWYDHPTKT--- 518
           S+N  +    S+  +P GT+ + V  + V+ + +S  G  ++ +  R   +D P  T   
Sbjct: 431 SLNCIIWIWDSTKALPFGTMVVFVSWYFVVCIVVSLLGGAVAAQMHRSVRHDAPPATTAS 490

Query: 519 -NEVLRQIPFQPWYLKTVPATLIGGIFPFGSIAVELYFIYSSLWFNK--IFYMFGFLLVS 575
             +VLR+       L    A LI G  PF  I VEL ++Y S+W  K  ++Y++ FL  +
Sbjct: 491 DRKVLRRSRAISGKLVVFLAGLISGFLPFVIIYVELEYLYKSVWLEKTTLYYLYSFLFAN 550

Query: 576 FLLLTMTTSLVT-----IIVTYHSLCLENWRWQWRSFIIGGIGCSIYIFIHSILFTEF-- 628
            LLL +    ++     +++  +   + +  W+WR F+I   GCS Y+ I+S+ +  F  
Sbjct: 551 VLLLCIVVCEISLLGCLVLMKLNHKFINDQNWRWRCFVIS-TGCSWYMEIYSLYYIFFII 609

Query: 629 KLGGFITIVLYVGYSALIAILCAMVTGAIGFISNMFFVKKIYSS 672
            + G   + + V YS +  +LC + TG++G++++ +FVKKI+ +
Sbjct: 610 HMTGDSAVFISVCYSFIFNVLCGLATGSLGYLTSSWFVKKIHRT 653

>SAKL0F12914g Chr6 complement(1013914..1016037) [2124 bp, 707 aa]
           {ON} similar to uniprot|P40071 Saccharomyces cerevisiae
           YER113C Hypothetical ORF
          Length = 707

 Score =  159 bits (403), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 184/737 (24%), Positives = 292/737 (39%), Gaps = 171/737 (23%)

Query: 26  VAPTTYHELDSIPLLVNHLTPSMFFKHKDSDGNELSSDKENFLYSYDYYYSKLHFCKPLD 85
           + P  Y E D + ++VN +                    E+ L  + Y Y +L F  P  
Sbjct: 56  IRPNVYEENDPVEIIVNKI--------------------ESDLTQFPYAYYELPFTCPPT 95

Query: 86  REIKKQPESLGSILFGDRIYNSPFELKMLVDENCKELCSTNIPGDDAKFINDLIKSGFLQ 145
              K    SL  I+ GDR + S + L    DE+C  LC      D  +  ++LIK G++ 
Sbjct: 96  NVKKPLHLSLNEIIRGDRKWQSDYLLHFKKDEHCLRLCDRKTSPDALRKAHELIKQGYVV 155

Query: 146 NWLIDG-LPAARQLYDQTTKSSFYGSGFELGSVEMIQVVDEAPSHTTPKQPIVEDVLSQE 204
            WLID  LPAA           +Y SGF LG                             
Sbjct: 156 QWLIDDELPAATTFISTKDHKKYYASGFPLGF---------------------------- 187

Query: 205 LDEEQATEKRANQMLVSSVERTYFANHFDIHIEYHDRGNNEYRIVGVTVNPISMKRDSAI 264
           +D++                +TY  NH  + I YH    N++ IVG+ V P S+      
Sbjct: 188 MDKDTG--------------KTYLNNHVMLVIRYHTVDINKFTIVGLEVYPKSVSDYH-- 231

Query: 265 CDTNLGKLALSEVSDTD-----VIFTYSVTF-EKSDTVWATRWDKYLHIYD------PTI 312
           C          EV+  +     + FTYS+ + E+ +  W  RW+ +++  +         
Sbjct: 232 CPGASKNFDHYEVNTEETETTYIPFTYSIYWREEFNVDWTNRWNFFINSGEISQEKSSQF 291

Query: 313 QWFSLINFTXXXXXXXXXXXHFLTKALKNDFVRYNEFNLNDSFDEDSGWKLAHGDVFRIP 372
            W SL N               L K++  D     E     +    S W + H  +    
Sbjct: 292 HWISLANSVVIVTLMTLVVALILAKSVSTD-----ETVSTSTSQVASQWVVQHSYLLN-- 344

Query: 373 TKSMLLSIFVGSGTQLFFMISSVLVLAALGFLSPSARGSLPTIMFILYAVFGFVGSYTSM 432
                L++F   G Q  F I   L+++       + R S+ T+  + +      G+YTS 
Sbjct: 345 ----HLNVFTAMGVQFLFTILGSLIISCSMNKLHNIRNSVLTMALMCF----ISGAYTSS 396

Query: 433 GVYRFFNGPYWKANMILTPLI-------VPGGIFMFIISMNLFLVFVHSSDVVPIGTLSL 485
                F G    AN   T  I       +PG     ++ +N  +    S+  +P GT+ L
Sbjct: 397 -----FVGALLSANHNTTIKISIACGSALPGFTLCVVLILNCIIWAKDSTHALPFGTIVL 451

Query: 486 MVLLWIVLSLPLSFAGSL---ISFKRCT-----------------WYDHPTKTNEV-LRQ 524
           ++ ++ ++ +PLS  G +    + ++C                  + D P   N+V L +
Sbjct: 452 LITVYFIVCIPLSILGGVSATYTRRKCLSLDPRSIINRFFLLNIHYDDQPVVENKVHLPR 511

Query: 525 IPFQ---PWYLKT-VPATLIGGIFPFGSIAVELYFIYSSLWFNK--IFYMFGFLLVSFLL 578
           I      P  L+  V  T+I GI PF  I VEL F+Y SLW  K   +Y++GFLL + +L
Sbjct: 512 ISGNSKLPLMLRQPVLLTVISGIVPFIVIYVELLFVYKSLWLEKTTFYYLYGFLLANIVL 571

Query: 579 LTMTTSLVTIIVTY---------------------HSLCLENWR---------------- 601
           L +    ++II  Y                     HS  L+  R                
Sbjct: 572 LCVVVCEISIIGCYLTLIHVSPDEFIPIATPEQAMHSPMLKQVRVQAMNFVCAIGLAMTQ 631

Query: 602 WQWRSFIIGGIGCSIYIFIHSILF--TEFKLGGFITIVLYVGYSALIAILCAMVTGAIGF 659
           W+W+SF IGG   + Y+  +S+ +  T  K+  F +I+L+  YSAL   LC    GA+G+
Sbjct: 632 WRWKSFQIGG-SVAWYLEAYSLYYFLTVLKIRDFSSILLFFCYSALFNFLCWCSFGALGY 690

Query: 660 ISNMFFVKKIYSSIKVE 676
           +S  +FV +I+++ K E
Sbjct: 691 LSCCWFVNRIHTNSKKE 707

>KNAG0C03430 Chr3 (674411..676453) [2043 bp, 680 aa] {ON} Anc_7.411
           YER113C
          Length = 680

 Score =  157 bits (398), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 172/713 (24%), Positives = 297/713 (41%), Gaps = 135/713 (18%)

Query: 26  VAPTTYHELDSIPLLVNHLTPSMFFKHKDSDGNELSSDKENFLYSYDYYYSKLHFCKPLD 85
           + PT Y   D + ++VN +         +SD  +L            Y Y  L F  P  
Sbjct: 33  LTPTIYRHGDPVEIIVNKI---------ESDATQLP-----------YGYYDLPFTCPPT 72

Query: 86  REIKKQPESLGSILFGDRIYNSPFELKMLVDENCKELCSTNIPGDDAKFINDLIKSGFLQ 145
            + K    SL  ++ GDR + S +EL+   D  C  LC+     D  + ++  IK  ++ 
Sbjct: 73  VDKKPLHLSLNEVIRGDRKWQSNYELEFGKDTECTVLCARKTNPDGMRSLDKFIKQEYVV 132

Query: 146 NWLIDG-LPAARQLYDQTTKSSFYGSGFELGSVEMIQVVDEAPSHTTPKQPIVEDVLSQE 204
            W ID  LPAA        +  +YGSGF LG V                           
Sbjct: 133 QWFIDKELPAATTFISTVDQKKYYGSGFPLGFV--------------------------- 165

Query: 205 LDEEQATEKRANQMLVSSVERTYFANHFDIHIEYHDRGNNEYRIVGVTVNPISMKR---D 261
            DEE                + Y  NH  + I YH   +  + IVG  + P S+      
Sbjct: 166 -DEETG--------------KVYVNNHVMMVIRYHAIDDYNFTIVGFEIYPKSVSDYHCP 210

Query: 262 SAICDTNLGKLALSEVSDTD--VIFTYSVTF-EKSDTVWATRWDKYLHIYDPT------I 312
            A  D +  ++ + E+++ D  + FTYSV + E+ D  W  R++ +    + +       
Sbjct: 211 GASKDYDQYEVVVPEIANEDTFIPFTYSVYWREEFDVEWKDRYNLFFDSGELSGSVSRKF 270

Query: 313 QWFSLINFTXXXXXXXXXXXHFLTK--ALKNDFVRYNEFNLNDSFDEDSGWKLAHGDVFR 370
            W SL N                 K   + N      E      F     W   + D   
Sbjct: 271 HWISLANSASIAFLMTFIVSLIFIKITGIPNRLETKKESPKASIFVIARNW--FYDDR-- 326

Query: 371 IPTKSMLLSIFVGSGTQ-LFFMISSVLVLAALGFLSPSARGSLPTIMFILYAVFGFVGSY 429
            P    L    V  G   LF +I S+ +  +L  L  + R S+ T+  + + +  F+ S+
Sbjct: 327 -PVMPHLFICIVSMGVHFLFTVIGSLTISCSLNSLH-TIRNSVLTMALLFFVLGAFMASF 384

Query: 430 TSMGVYRFFNGPYWK--------ANMILTPLI----VPGGIFMFIISMNLFLVFVHSSDV 477
               +    N    +        +N++L  ++    +PG + +  I +N  +    S++V
Sbjct: 385 VGGTLLIENNKLIMRRGSLKNVFSNILLFSVVCGSLLPGMVILTAIILNCIIWLHTSTNV 444

Query: 478 VPIGTLSLMVLLWIVLSLPLS-FAGSLISFKRCTWYDH----------PTKTNEVL---- 522
           +P  T+  ++ ++ ++ +PLS   GS+ + K    Y             T+ N+++    
Sbjct: 445 LPFATIMKLLFIYFIVCIPLSVLGGSIAANKDSEEYSRLRSDSIKRISRTRANKIMDEDQ 504

Query: 523 -------RQIPFQ-PWYLK-------TVPATLIGGIFPFGSIAVELYFIYSSLWFNK--I 565
                  R++ ++  W LK       TV + L  GIFPF  I VEL F+Y S+W+ K   
Sbjct: 505 GTDVRTTRKLKYKVRWQLKKMMLDTVTVVSLLASGIFPFIMIYVELQFVYKSVWYEKTTF 564

Query: 566 FYMFGFLLVSFLLLTMTTSLVTIIVTYHSLCLENW----RWQWRSFIIGGIGCSIYIFIH 621
           +Y +GFLL + +LL +    + II +Y  + + +      W+W++F +    C+ Y+  +
Sbjct: 565 YYYYGFLLANIILLCLVICDIAIICSYLMMTVSSKDNSDSWKWKTFQLSS-SCAWYMEAY 623

Query: 622 SI--LFTEFKLGGFITIVLYVGYSALIAILCAMVTGAIGFISNMFFVKKIYSS 672
           SI  +F    +  F +I++ V YS L   LC +  G+IG++++++FVK++Y S
Sbjct: 624 SIYYVFKVLNMRDFSSILISVCYSLLFNALCGLAMGSIGYLASLWFVKRVYRS 676

>NDAI0A01510 Chr1 (335693..337732) [2040 bp, 679 aa] {ON} Anc_7.411
           YER113C
          Length = 679

 Score =  154 bits (388), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 177/680 (26%), Positives = 285/680 (41%), Gaps = 103/680 (15%)

Query: 44  LTPSMFFKHKDSDGNELSSDK-ENFLYSYDYYYSKLHFCKPLDREIKKQPESLGSILFGD 102
           L P+ +F+    D  EL  +K E+ L    Y Y  L F  P     K    SL  I+ GD
Sbjct: 41  LQPNFYFQ---GDEVELIVNKVESDLTQLPYAYYDLPFTCPPTMHKKPLHLSLNEIIRGD 97

Query: 103 RIYNSPFELKMLVDENCKELCSTNIPGDDAKFINDLIKSGFLQNWLIDG-LPAARQLYDQ 161
           R + S + LK   D+ C  LC+     +  K    L++ G++  WLID  LPAA      
Sbjct: 98  RKWQSDYILKFGQDDTCHILCTRKTTKEGLKNAKKLVEDGYVVQWLIDEELPAATTFIST 157

Query: 162 TTKSSFYGSGFELGSVEMIQVVDEAPSHTTPKQPIVEDVLSQELDEEQATEKRANQMLVS 221
             +  +Y SGF LG V+                                           
Sbjct: 158 IDQKKYYASGFPLGFVD------------------------------------------P 175

Query: 222 SVERTYFANHFDIHIEYHDRGNNEYRIVGVTVNPISMKR---DSAICDTNLGKLALSEVS 278
              + Y   H  + I Y+    N++ IVG  V P S+       A  +    ++ + E  
Sbjct: 176 DTGKVYLNTHVMLVIRYNTVDVNKHTIVGFEVYPKSVSDFHCPGASKNYEPYEIVIPEND 235

Query: 279 D--TDVIFTYSVTFEKSDTV-WATRWDKYLHI----YDPTIQ--WFSLINFTXXXXXXXX 329
           D  T + FTYSV + +   V W  RWD YL+      + T Q  W SL N          
Sbjct: 236 DDLTFIPFTYSVYWREEYLVDWDHRWDLYLNSGELSENKTTQFHWISLANSAGIVFLMSF 295

Query: 330 XXXHFLTKALKNDFVRYNEFNLNDSFDEDSG--WKLAHGDVF--RIPTKSMLLSIFVGSG 385
                L ++ K+   R    ++N S +  +G  +++A   +   R P  ++L+ +FV  G
Sbjct: 296 VVSVILLRSFKSS--RDISTDINKSEEHRNGLVYEVARNWIINERTPLANLLI-LFVSMG 352

Query: 386 TQ-LFFMISSVLVLAALGFLSPSARGSLPTIMFILYAVFGFVGSYTSMGVYRFFNGPYWK 444
            Q LF ++ S+ +  +L  L      S+ T+  + + +  F+ SY    + R  N    K
Sbjct: 353 VQFLFTVLGSLTISCSLNKLHDIG-DSVLTMAVLCFVLGAFMSSYIGSVLLRLKNKATMK 411

Query: 445 AN----------MILTPLIVPGGIFMFIISMNLFLVFVHSSDVVPIGTLSLMVLLWIVLS 494
                        IL    +PG + +  + +N  +    S+  +P  T+ + + ++ ++ 
Sbjct: 412 KQPIKKGFHLFFAILCGSFLPGIVMIVTLLLNSIVWAHDSTHALPFKTVVMFITVYFIVC 471

Query: 495 LPLSFAGSLI---SFKRCTWYD---HPTKTNEVLRQIPFQPWY-----------LKTVPA 537
           +PLS  G  +   S  + +  D   H ++    L     +P             +K    
Sbjct: 472 IPLSILGGYMANSSKTKGSLTDPKFHTSRPELELFANKLKPKKHIFLFGARLKSIKIALP 531

Query: 538 TLIGGIFPFGSIAVELYFIYSSLWFNK--IFYMFGFLLVSFLLLTMTTSLVTIIVTY--- 592
            L+ GIFPF  I VEL ++Y S+W  K   +Y +GFL  + LLL +    + II TY   
Sbjct: 532 ILLSGIFPFVIIYVELQYVYKSVWLEKTAFYYFYGFLFANILLLCIVVGEIAIIGTYTML 591

Query: 593 HSLCLENWRWQWRSFIIGGIGCSIYIFIHSILFTEFKLG--GFITIVLYVGYSALIAILC 650
           H     N  W+W SF +G   C+ Y+ ++S+ +  F L   GF +I + V Y AL   LC
Sbjct: 592 HMADRNNTDWRWISFFMGS-SCAWYMELYSLYYVFFILNIRGFSSIFISVCYGALFNTLC 650

Query: 651 AMVTGAIGFISNMFFVKKIY 670
               G+I  +++ FFV+K+Y
Sbjct: 651 GCAMGSIASLTSHFFVEKLY 670

>KLLA0E20835g Chr5 complement(1857426..1859456) [2031 bp, 676 aa]
           {ON} similar to uniprot|P40071 Saccharomyces cerevisiae
           YER113C Hypothetical ORF
          Length = 676

 Score =  147 bits (372), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 171/666 (25%), Positives = 278/666 (41%), Gaps = 123/666 (18%)

Query: 58  NELSSDKENFLYSYDYYYSKLHFCKPLDREIKKQPESLGSILFGDRIYNSPFELKMLVDE 117
           N++ SD  +F  SY YY   LHF  P  +++K  P +   IL+G++ + S ++L    DE
Sbjct: 73  NKVESDLTHF--SYGYY--DLHFTCPPSQDMKPLPLTFSDILYGNKKWQSDYQLTFGKDE 128

Query: 118 NCKELCSTNIPGDDAKFINDLIKSGFLQNWLIDG-LPAARQLYDQTTKSSFYGSGFELGS 176
           +C  LC     G+  K   +LIK  ++  WL D  LP A    +   K  +Y SGF LG 
Sbjct: 129 DCVRLCDRKTNGEGKKQAYELIKQNYVVQWLADDDLPGATTYLNTKDKKKYYSSGFPLGQ 188

Query: 177 VEMIQVVDEAPSHTTPKQPIVEDVLSQELDEEQATEKRANQMLVSSVERTYFANHFDIHI 236
            +                         E DE                   Y  NH  I I
Sbjct: 189 YD------------------------PETDE------------------AYINNHVMIVI 206

Query: 237 EYH--DRGNNEYRIVGVTVNPISMKRD---SAICDTNLGKLALSEVSDTDVIFTYSVTFE 291
            YH  D+G N   IVG  V P S+       A  D    K+  +      + FTY+V + 
Sbjct: 207 RYHTIDQGKNT--IVGFEVYPKSVSDHHCPGASKDYTPYKIDPTNEDIEFISFTYAVYWR 264

Query: 292 KSDTV-WATRWDKYLH---IYDPTIQWFSLINFTXXXXXXXXXXXHFLTKALKNDFVRYN 347
           +   V W  RW+ +++   + + T   F  I F              +        ++  
Sbjct: 265 EDFKVDWKNRWNFFINGGELKESTSNQFHWITFANGIIVTSCLLLIVIA------ILKRQ 318

Query: 348 EFNLNDSFDEDSGWKLAHGDVFRIPTKSMLLSIFVGSGTQLFFMISSVLVLAALGFLSPS 407
           E + + +    + W  A   +F        L++ V  G    F     L+++     +  
Sbjct: 319 ETDGSITTQLAAEWSKARVPLF------FQLNLLVSMGIHFLFTTLGTLIISCSLNHTHR 372

Query: 408 ARGSLPTIMFILYAVFGFV-GSYTSMGVYRFFNGPYWK---ANMILTPLIVPGGIFMFII 463
              S+ T      AVF F+ GS+TS  +     G   +    N I+    +PG   + ++
Sbjct: 373 IGSSVLTC-----AVFLFISGSFTSSFIGALLEGQMSQHKLVNSIIFGSTLPGITLVIVL 427

Query: 464 SMNLFLVFVHSSDVVPIGTLSLMVLLWIVLSLPLSFAGS---------------LISFKR 508
            +N  L   ++++ +P GT++L+   + ++ +P+S  G                L SF  
Sbjct: 428 LLNYILKANNAANTLPHGTVALLFGAYFIVCVPISIIGGKCADRFLKVNSTNTLLNSFAL 487

Query: 509 CTWYDHPTKT--NEVLRQIPFQPWYLKT-VPATLIGGIFPFGSIAVELYFIYSSLWFNK- 564
                H T+    E    IPF    LK  +  TL  G+ PF  I VEL F Y SLW  K 
Sbjct: 488 AEVNKHDTRPLYVESKNSIPF---VLKNPIAITLTFGLIPFALIYVELLFAYKSLWLQKT 544

Query: 565 -IFYMFGFLLVSFLLLTMTTSLVTIIVTYHSLCLEN------W------------RWQWR 605
            ++Y++GFLL + +++ +   L++II  Y  L   N      W             W+W+
Sbjct: 545 TLYYLYGFLLSNIVIVCICICLLSIIGCYIHLNYGNDSLNFKWDNVIGRVLEACHSWRWK 604

Query: 606 SFIIGGIGCSIYIFIHSILFTEF--KLGGFITIVLYVGYSALIAILCAMVTGAIGFISNM 663
           +F +GG   + Y+  +SIL+  F  +   FI+  L+V YS L  ILC    G++ ++S++
Sbjct: 605 AFHMGG-AVAWYMEAYSILYLIFVARYRDFISSFLFVCYSTLFNILCWTAFGSLSYLSSL 663

Query: 664 FFVKKI 669
           +F+ K+
Sbjct: 664 WFIGKL 669

>TDEL0C02710 Chr3 complement(474759..476795) [2037 bp, 678 aa] {ON}
           Anc_7.411 YER113C
          Length = 678

 Score =  145 bits (367), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 170/699 (24%), Positives = 286/699 (40%), Gaps = 118/699 (16%)

Query: 26  VAPTTYHELDSIPLLVNHLTPSMFFKHKDSDGNELSSDKENFLYSYDYYYSKLHFCKPLD 85
           + P  Y   D + LLVN +                    E+ L  + Y Y  L F  P  
Sbjct: 41  LQPNVYRWGDHVELLVNKV--------------------ESDLTQFPYGYYDLPFTCPPT 80

Query: 86  REIKKQPESLGSILFGDRIYNSPFELKMLVDENCKELCSTNIPGDDAKFINDLIKSGFLQ 145
            + K    SL  I+ GDR + S ++LK   D +C+ LC+        +   +L++ G++ 
Sbjct: 81  EDKKPLHLSLNEIIRGDRKWESDYKLKFGQDASCEALCARKTKPAGMRRAQELVRQGYVV 140

Query: 146 NWLIDG-LPAARQLYDQTTKSSFYGSGFELGSVEMIQVVDEAPSHTTPKQPIVEDVLSQE 204
            WLID  LPAA           +Y SGF LG V+                          
Sbjct: 141 QWLIDQELPAATTFISTIDHKKYYVSGFPLGFVD-------------------------- 174

Query: 205 LDEEQATEKRANQMLVSSVERTYFANHFDIHIEYHDRGNNEYRIVGVTVNPISMKRDSAI 264
                              E+TY   H  + I Y+      + IVG  V P S+  D   
Sbjct: 175 ----------------PDTEKTYLNTHVMMVIRYNAIDPETFTIVGFEVYPKSVS-DYHC 217

Query: 265 CDTNLG----KLALSEVSD--TDVIFTYSVTFEKSDTV-WATRWDKYLHIYDPT------ 311
              + G    +L + E  D  T + FTYSV + +   V W+ RW+ +L+  + +      
Sbjct: 218 PGASKGYEQYELIVPENEDELTYIPFTYSVYWREEFKVDWSHRWNFFLNSGEMSEASSRR 277

Query: 312 IQWFSLINFTXXXXXXXXXXXHFLTKALKNDFVRYNE---FNLNDSFDEDSGWKLAHGDV 368
             W +L N               L + ++      +E   F  +++ + DS + +A   +
Sbjct: 278 FHWMTLGNSVGISFLLMLIVIANLYRIVRVGHEAGSEEFQFTFDENEEADSIYGVAKTWL 337

Query: 369 FRIPTKSM---LLSIFVGSGTQ-LFFMISSVLVLAALGFLSPSARGSLPTIMFIL----Y 420
            +  + S+   +L+IFV  G Q LF +I S+    +L  L       L    F L    Y
Sbjct: 338 AQTDSSSISFKILTIFVSIGVQFLFTIIGSLAFSCSLNKLHNIRNSVLSVASFFLCHWSY 397

Query: 421 AVFGFVGSYTSMGVYRFFNGPYWKANM--ILTPLIVPGGIFMFIISMNLFLVFVHSSDVV 478
               FVG++  +      +G   +     IL    +PG + +    +N  +    SS  +
Sbjct: 398 LWHLFVGTWLHIDHRTTNDGSAGRCRTFSILCGSALPGLVMISTQMLNWIVWANESSHAL 457

Query: 479 PIGTLSLMVLLWIVLSLPLSFAGSLISFK--RCTWYDHPTKTNEVLRQIPFQPWYLKTVP 536
           P  T+ L V ++ V+ +PLS  G  +S +  R    + P  ++   R I  +P    T  
Sbjct: 458 PFRTIVLFVSIYFVICIPLSLLGEEVSHRVHRKQAQNFPILSSLGARSI--KPCRAPTTL 515

Query: 537 AT--------------LIGGIFPFGSIAVELYFIYSSLWFNK--IFYMFGFLLVSFLLLT 580
           A                I G  PF  I VEL +IY S+W  K   +Y++GFLL + +LL 
Sbjct: 516 APRKISERLTFDFATFAICGFLPFAVIYVELQYIYKSVWLEKTDFYYLYGFLLANIILLC 575

Query: 581 MTTSLVTIIVTY-----HSLCLENWRWQWRSFIIGGIGCSIYIFIHSI--LFTEFKLGGF 633
           +    V+ +  Y     H        W+W+ F++G   C+ Y+ ++S+  +F   K+ GF
Sbjct: 576 IVVCEVSFLGCYVMMRKHKRVATFDSWRWKCFMMG-TSCAWYMELYSLYYIFHTLKMTGF 634

Query: 634 ITIVLYVGYSALIAILCAMVTGAIGFISNMFFVKKIYSS 672
            +I + V YS +  I+C    G++G++++ + V +++ +
Sbjct: 635 PSIFISVSYSLIFNIMCGCGMGSLGYLTSCWLVNRVFCT 673

>YER113C Chr5 complement(387932..390052) [2121 bp, 706 aa] {ON}
           TMN3Protein with a role in cellular adhesion and
           filamentous growth; similar to Emp70p and Tmn2p; member
           of Transmembrane Nine family with 9 transmembrane
           segments; localizes to Golgi; induced by
           8-methoxypsoralen plus UVA irradiation
          Length = 706

 Score =  142 bits (359), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 175/741 (23%), Positives = 307/741 (41%), Gaps = 123/741 (16%)

Query: 4   LITAVSICLITLSVTNGFYLPGVAPTTYHELDSI------PLLVNHLTPSMFFKHKDSDG 57
           +IT ++I ++ L + N FY    + T  H  + +       L    +TP+ +   +  D 
Sbjct: 9   VITLMAIVVVMLILRNQFY---SSRTRGHGQEPVISSSQKNLYDGWITPNFY---RKGDP 62

Query: 58  NELSSDK-ENFLYSYDYYYSKLHFCKPLDREIKKQPESLGSILFGDRIYNSPFELKMLVD 116
            EL  +K E+ L    Y Y  L F  P     K    SL  I+ GDR + S ++LK   D
Sbjct: 63  LELIVNKVESDLTQLPYAYYDLPFTCPPTMHKKPLHLSLNEIIRGDRKWESDYKLKFGED 122

Query: 117 ENCKELCSTNIPGDDAKFINDLIKSGFLQNWLIDG-LPAARQLYDQTTKSSFYGSGFELG 175
             C+ LC+     +  + ++ L++ G++  WLID  LPAA      T    +Y SGF LG
Sbjct: 123 NPCETLCARKTTKEGMQTLDKLVREGYVVQWLIDDELPAATTFISTTDHKKYYASGFPLG 182

Query: 176 SVEMIQVVDEAPSHTTPKQPIVEDVLSQELDEEQATEKRANQMLVSSVERTYFANHFDIH 235
            ++                                             ++TY  NH  + 
Sbjct: 183 FID------------------------------------------PDTDKTYLHNHVMLV 200

Query: 236 IEYHDRGNNEYRIVGVTVNPISMKR---DSAICDTNLGKLALSEVSD--TDVIFTYSVTF 290
           I +H   N++  IVG  V P S+       A  +    ++ + E  +  T + FTYSV +
Sbjct: 201 IRFHASDNDKNTIVGFEVYPRSVSDYHCPGASKNYEQYEIVIPEDENELTYLPFTYSVYW 260

Query: 291 -EKSDTVWATRWDKYLHIYD----PTIQ--WFSLINFTXXXXXXXXXXXHFLTKALKND- 342
            E+ +  W  RWD +L+  +     +IQ  W SL N                 + +  D 
Sbjct: 261 REEFEVDWNHRWDYFLNAGELSDEQSIQFHWMSLANSVGIVLSISFITLIIYVRVMYTDK 320

Query: 343 --------FVRYNEFNLNDSFDEDSGWKLAHGDVFRIPTKS--------MLLSIFVGSGT 386
                    +        D  D+D   K +   V +   ++         +L + V  G 
Sbjct: 321 SNSKSPKYMINIEGIETEDDLDDDKYGKYSVYTVAKDWIQNGRPNLFGLKVLILLVSFGV 380

Query: 387 QLFFMISSVLVLAALGFLSPSARGSLPTIMFILYAVFGFVGSYTSMGVYRFFNGPYWKAN 446
           Q  F I   L ++       + R S+ T+  + + +  F+ S+    +         KAN
Sbjct: 381 QFLFTIIGSLTISCSMNKLHNVRNSVLTMAILFFVLGAFMASFVGTRLSMVTKTKRTKAN 440

Query: 447 MI-----------LTPL--IVPGGIFMFIISMNLFL----VFVH-SSDVVPIGTLSLMVL 488
            +            +P+  I+ G     I+ ++ FL    V+ H S+  +P  T+   + 
Sbjct: 441 YLDDNRYLKDYKKFSPIFTILCGSSLPGIVMVSTFLLNSIVWAHDSTSALPFKTIVFFMS 500

Query: 489 LWIVLSLPLSFAGSLISFK---RCTWYDHPTK--TNEVLRQIPFQPWYLKTVPATLIG-- 541
           ++ ++ +PLS  G +++        W    TK  +N     +       K  P    G  
Sbjct: 501 IYFIVCIPLSLFGGIVANNIPLPQYWLSGITKDESNSDGNGLFVPKSRAKFNPLVYCGIY 560

Query: 542 --GIFPFGSIAVELYFIYSSLWFNK--IFYMFGFLLVSFLLLTMTTSLVTIIVTY--HSL 595
             GIFP   I VE+ ++Y SLW  K   +Y +GFL +S +LL + T  ++II +Y     
Sbjct: 561 LCGIFPLLVIYVEMQYVYKSLWLEKTTFYYFYGFLFLSIILLCVLTMEISIIGSYLLMRF 620

Query: 596 CLENW----RWQWRSFIIGGIGCSIYIFIHSI--LFTEFKLGGFITIVLYVGYSALIAIL 649
           C E+      W+W+ F +G  G  +Y+ ++S+  +F    + GF +I++ + YS +  ++
Sbjct: 621 CFEDKVVRNNWRWKCFEMGFSG-GVYMELYSLYYIFAVLNIHGFSSILISICYSLIFNVM 679

Query: 650 CAMVTGAIGFISNMFFVKKIY 670
           C++  GA+ +++  +F+ KIY
Sbjct: 680 CSLGLGALSYLTASWFINKIY 700

>CAGL0G03487g Chr7 complement(337133..339247) [2115 bp, 704 aa] {ON}
           similar to uniprot|P40071 Saccharomyces cerevisiae
           YER113c
          Length = 704

 Score =  141 bits (356), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 169/689 (24%), Positives = 285/689 (41%), Gaps = 116/689 (16%)

Query: 52  HKDSDGNELSSDK-ENFLYSYDYYYSKLHFCKPLDREIKKQPESLGSILFGDRIYNSPFE 110
           +K  D  EL  +K E+ L    Y Y  L F  P  +E K    SL  I  GDR + S ++
Sbjct: 56  YKIGDHVELIVNKVESDLTQLPYAYYDLPFICPPTKEKKPLHLSLDEIFRGDRKWQSDYK 115

Query: 111 LKMLVDENCKELCSTNIPGDDAKFINDLIKSGFLQNWLID-GLPAARQLYDQTTKSSFYG 169
           L   +D  C+ LC+     +      +L++ G++  WLID  LPAA      T  + +Y 
Sbjct: 116 LSFGIDSPCEILCARKTKKEGMIKAKELVQQGYVTQWLIDESLPAATTFISSTNHNKYYA 175

Query: 170 SGFELGSVEMIQVVDEAPSHTTPKQPIVEDVLSQELDEEQATEKRANQMLVSSVERTYFA 229
           +GF +G V+                                              +T+  
Sbjct: 176 AGFPVGYVD------------------------------------------DRTGKTFLN 193

Query: 230 NHFDIHIEYHDRGNNEYRIVGVTVNPISMKR---DSAICDTNLGKLALSEVSD--TDVIF 284
           NH  + I YH     E+ IVG  V P S+       A  + +  ++ + E  D  T + F
Sbjct: 194 NHVMLVIRYHPVSEEEFTIVGFEVYPKSVSDYHCPGANKNHDKYEIIVPEKDDELTFIPF 253

Query: 285 TYSVTF-EKSDTVWATRWDKYLHIYDPT------IQWFSLINFTXXXXXXXXXXXHFLTK 337
           TYSV + E+ +  W  RW+ +L+  + +        W S +N               L K
Sbjct: 254 TYSVYWREEFEVDWNHRWNYFLNNGELSNSKANQFHWMSFLNSVGIASMTTTIVSIILLK 313

Query: 338 ALK---------NDFVRYNEFNLNDSFDEDSGWKLAHGD----VFRIPTKSMLLSIFVGS 384
                       N      + N +D+ D+ SG    +      V +IP    L+ +    
Sbjct: 314 IFSKKERESRNINTSTNLGQDNEDDNDDKISGSVFVNAKTWITVGKIPYWKALICL-TSM 372

Query: 385 GTQLFFMISSVLVLAALGFLSPSARGSLPTIMFILY----AVFGFVGSYTSMGVYRFFNG 440
           G Q  F I   L+++       + R ++ T+  I +    A+ G++GS   +  Y+   G
Sbjct: 373 GIQFSFTILGSLIISCSLSKLHNIRFTVLTMSLICFICGAAISGYIGSRLYIE-YQILKG 431

Query: 441 PYWKANMILTPLI---------VPGGIFMFIISMNLFLVFVHSSDVVPIGTLSLMVLLWI 491
            Y +  +  T +          +PG + +   S+N  ++   S++ +P  T   +V ++ 
Sbjct: 432 -YLRNEVNRTKVYKFSVVCGSSLPGLLMVISFSLNCIILAHDSTNALPFKTEVFLVSIYF 490

Query: 492 VLSLPLSFAGSLISF----------KRCTWYDHPT----------KTNEVLRQIPFQPWY 531
           V  +PLS  G +++           KR T     T          K   + +++ F   +
Sbjct: 491 VTCIPLSLLGGVLALNCKVDSYNTLKRITSLRRNTISRKSRSDFTKKVSLYQRLVFDIKH 550

Query: 532 LK-TVPATLIGGIFPFGSIAVELYFIYSSLWFNK--IFYMFGFLLVSFLLLTMTTSLVTI 588
              T    L GG F F  I VEL ++Y S+W  K   +Y +GFLL + L+L++ T  + I
Sbjct: 551 DSFTTFGALAGGFFSFIIIWVELQYVYKSVWLEKTSFYYYYGFLLANILILSIVTIEIAI 610

Query: 589 IVTYHSLCLENWR-----WQWRSFIIGGIGCSIYIFIHSILFTEFKLG--GFITIVLYVG 641
           I  Y  L  +N R     W W+SF++G   C+ Y+ ++S+ +  F L   GF +I + V 
Sbjct: 611 IGCYVMLKAKNDRYLRHTWGWKSFLMGS-SCAWYMELYSLYYIFFVLNMQGFSSIFISVC 669

Query: 642 YSALIAILCAMVTGAIGFISNMFFVKKIY 670
           YS L   +C    G++ ++++   V +IY
Sbjct: 670 YSLLFNGMCGWALGSLSYLTSYMLVTQIY 698

>Smik_5.258 Chr5 complement(396781..398901) [2121 bp, 706 aa] {ON}
           YER113C (REAL)
          Length = 706

 Score =  140 bits (352), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 167/703 (23%), Positives = 288/703 (40%), Gaps = 130/703 (18%)

Query: 44  LTPSMFFKHKDSDGNELSSDK-ENFLYSYDYYYSKLHFCKPLDREIKKQPESLGSILFGD 102
           +TP+ +   K+ D  EL  +K E+ L    Y Y  L F  P          SL  I+ GD
Sbjct: 52  ITPNFY---KNGDPLELIVNKVESDLTQLPYAYYDLPFTCPPTMHKTPLHLSLNEIIRGD 108

Query: 103 RIYNSPFELKMLVDENCKELCSTNIPGDDAKFINDLIKSGFLQNWLIDG-LPAARQLYDQ 161
           R + S ++L    D  C+ LC+     +  + ++ LI+ G++  WLID  LPAA      
Sbjct: 109 RKWESDYKLTFGEDNPCEVLCARKTTKEGMQTLDKLIREGYVVQWLIDDELPAATTFIST 168

Query: 162 TTKSSFYGSGFELGSVEMIQVVDEAPSHTTPKQPIVEDVLSQELDEEQATEKRANQMLVS 221
           T    +Y SGF LG ++                                           
Sbjct: 169 TDHKKYYASGFPLGFMD------------------------------------------P 186

Query: 222 SVERTYFANHFDIHIEYHDRGNNEYRIVGVTVNPISMKR-----DSAICDTNLGKLALSE 276
              +TY  NH  + I +H   N +  IVG  V P S+        S   +     +   E
Sbjct: 187 DTGKTYLHNHVMLVIRFHSGDNGKNTIVGFEVYPRSVSDYHCPGASKTYEQYEITIPEDE 246

Query: 277 VSDTDVIFTYSVTF-EKSDTVWATRWDKYLHIYD------PTIQWFSLINFTXXXXXXXX 329
              T + FTYSV + E+ +  W  RWD +L+  +          W S  N          
Sbjct: 247 NELTYLPFTYSVYWREEFEVDWNHRWDYFLNSGELSDEQSSQFHWMSFANSVIIVLSISL 306

Query: 330 XXXHFLTKALKND--FVRYNEFNLN------------DSFDEDSGWKLAHG-------DV 368
                    +  D      N+F +N            D + ++S + +A         D+
Sbjct: 307 ITLIIYIGVMHTDKNNPHSNKFMINIEGIGAEDVLNNDKYSKNSVYMVAKDWIQNGKPDL 366

Query: 369 FRIPTKSMLLSIFVGSGTQLFFMISSVLVLAALGFLSPSARGSLPTIMFILYAVFGFVGS 428
           F +      L + V  G Q  F +   L ++       + R S+ T+  + + +  F+ S
Sbjct: 367 FSLKG----LIVLVSFGVQFLFTVIGSLTISCSMNKLHNVRNSVLTMAILCFVIGAFMAS 422

Query: 429 YTS-----MGVYRFFNGPYW------KANMILTPL--IVPGGIFMFIISMNLFL----VF 471
           +       +   R FN  Y+      K     +P+  I+ G     +I ++ FL    V+
Sbjct: 423 FVGTRLSIVSKTRRFNANYFGDNKNFKCREKFSPIFAIICGSSLPGMIMISTFLLNSIVW 482

Query: 472 VH-SSDVVPIGTLSLMVLLWIVLSLPLSFAGSLIS---------FKRCTWYDHPTKTNEV 521
            H S++ +P  T+   + ++ ++ +PLS  G +++             T  +  +K N++
Sbjct: 483 AHDSTNALPFKTIVFFISVYFIVCIPLSLFGGIVANNIPLPQYWLSGITIDESDSKNNKL 542

Query: 522 LRQIPFQPWYLKTVPATLIG----GIFPFGSIAVELYFIYSSLWFNK--IFYMFGFLLVS 575
              +P  P   K  P    G    G+FP   I VE+ ++Y SLW  K   +Y +GFL +S
Sbjct: 543 F--LPKSP--NKFNPLVNCGIYLCGVFPLLVIYVEMQYVYKSLWLEKTTFYYFYGFLFLS 598

Query: 576 FLLLTMTTSLVTIIVTY--HSLCLENW----RWQWRSFIIGGIGCSIYIFIHSI--LFTE 627
            +LL + T  +++I +Y     C E+      W+W+ F +G  G  +Y+ ++S+  +F  
Sbjct: 599 IILLCVLTMEISVIGSYLLMRFCFEDKVVRNNWRWKCFEMGFSG-GVYMELYSLYYIFAV 657

Query: 628 FKLGGFITIVLYVGYSALIAILCAMVTGAIGFISNMFFVKKIY 670
             + GF +I++ + YS L  I+C +  GA+ +++  +F+ KIY
Sbjct: 658 LNIHGFSSILISICYSLLFNIMCGLGLGALSYLTASWFINKIY 700

>Suva_5.234 Chr5 complement(363605..365725) [2121 bp, 706 aa] {ON}
           YER113C (REAL)
          Length = 706

 Score =  129 bits (323), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 166/724 (22%), Positives = 288/724 (39%), Gaps = 136/724 (18%)

Query: 19  NGFYLPGVAPTTYHELDSIPLLVNHLTPSMFFKHKDSDGNELSSDKENFLYSYDYYYSKL 78
           N +Y   + P  Y + D + L+VN +         +SD  +L            Y Y  L
Sbjct: 45  NTYYDGWITPNFYKKGDPLELIVNKV---------ESDLTQLP-----------YAYYDL 84

Query: 79  HFCKPLDREIKKQPESLGSILFGDRIYNSPFELKMLVDENCKELCSTNIPGDDAKFINDL 138
            F  P     K    SL  I+ GDR + S + L    D  C+ LC+     +  + ++ L
Sbjct: 85  PFTCPPTMHKKPLHLSLNEIIRGDRKWESDYILAFGEDNACQTLCARKTTKEGMQSLDKL 144

Query: 139 IKSGFLQNWLIDG-LPAARQLYDQTTKSSFYGSGFELGSVEMIQVVDEAPSHTTPKQPIV 197
           ++ G++  WLID  LPAA      T    +Y SGF LG V+                   
Sbjct: 145 VREGYVVQWLIDDKLPAATTFISTTDHKKYYASGFPLGFVD------------------- 185

Query: 198 EDVLSQELDEEQATEKRANQMLVSSVERTYFANHFDIHIEYHDRGNNEYRIVGVTVNPIS 257
                                      +TY  NH  + I +H   N++  IVG  V P S
Sbjct: 186 -----------------------PDTGKTYLHNHVMLVIRFHSGDNDQNTIVGFEVYPRS 222

Query: 258 MKR-DSAICDTNLGKLALSEVSDTDVI----FTYSVTF-EKSDTVWATRWDKYLHIYD-- 309
           +          N  +  +    D + +    FTYSV + E+ +  W  RWD +L+  +  
Sbjct: 223 VSDYHCPGASKNYEQYEIVVPEDENELTYLPFTYSVYWREEFEVDWNHRWDYFLNSGELS 282

Query: 310 ----PTIQWFSLINFTXXXXXXXXXXXHFLTKALKND---------FVRYNEFNLNDSFD 356
                   W S  N                 + +  D          +      + D+ D
Sbjct: 283 NEKSAQFHWMSFANSMGIVLSISFITAVIYIQVMHRDKKNTDSTKYLINIEGAEVEDNLD 342

Query: 357 EDSGWK----LAHGDVFRIPTKSM----LLSIFVGSGTQLFFMISSVLVLAALGFLSPSA 408
           +D   K    +   D  +    +M    +L + V  G Q  F +   L ++       + 
Sbjct: 343 DDKYGKNSVYMVTKDWIQNGRPNMFGLKVLIVLVSFGVQFLFTVIGSLTISCSMNKLHNV 402

Query: 409 RGSLPTIMFILYAVFGFVGSYT-----------SMGVYRFFNGPYWKANMILTPL--IVP 455
           R S+ T+  + + +  F+ S+            S+ +    +   +      +P+  I+ 
Sbjct: 403 RNSVITMAILCFVLGAFMASFVGTRLSIVTKRRSIEINYLDDSKNFNNCNKFSPVFAIIC 462

Query: 456 GGIFMFIISMNLFL----VFVH-SSDVVPIGTLSLMVLLWIVLSLPLS-FAGSL---ISF 506
           G     ++ ++ FL    V+ H S++ +P  T+   + ++ ++ +PLS F G++   I  
Sbjct: 463 GSSLPGLVMVSTFLLNSIVWAHDSTNALPFRTIVFFISVYFIVCIPLSLFGGTVANNIPL 522

Query: 507 KRCTWYDHPTKT----NEVLRQIPFQPWYLKTVPATLIG----GIFPFGSIAVELYFIYS 558
            R  W    TK     N     +P      K  P    G    G+FPF  I VEL ++Y 
Sbjct: 523 PR-HWLSGITKDETCGNSSRLFVPRSR--TKFNPLVYCGIYLCGLFPFLVIYVELQYVYK 579

Query: 559 SLWFNK--IFYMFGFLLVSFLLLTMTTSLVTIIVTYH--SLCLENW----RWQWRSFIIG 610
           S+W  K   +Y +GFLL++ +LL + T  ++II +Y     C E+      W+W+ F +G
Sbjct: 580 SVWLEKTTFYYFYGFLLLNIILLCVLTMEISIIGSYSLMRFCFEDKDVRNNWRWKCFEMG 639

Query: 611 GIGCSIYIFIHSI--LFTEFKLGGFITIVLYVGYSALIAILCAMVTGAIGFISNMFFVKK 668
             G  +Y+ ++S+  +F    + GF + ++ + YS L  I+C +  G + +++  +F+ K
Sbjct: 640 FSG-GVYMELYSLYYIFAVLNIHGFSSTLISICYSLLFNIMCGLGLGGLSYLTASWFINK 698

Query: 669 IYSS 672
           IY S
Sbjct: 699 IYHS 702

>KLTH0C06226g Chr3 (541022..543106) [2085 bp, 694 aa] {ON} similar
           to uniprot|P40071 Saccharomyces cerevisiae YER113C
           Hypothetical ORF
          Length = 694

 Score =  128 bits (322), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 171/704 (24%), Positives = 283/704 (40%), Gaps = 155/704 (22%)

Query: 52  HKDSDGNELSSDK-ENFLYSYDYYYSKLHFCKPLDREIKKQPESLGSILFGDRIYNSPFE 110
           +K  D  +L+ +K E+ + +  Y Y  L F  P     K    SL  ++ GDR + S + 
Sbjct: 49  YKRGDKVDLTVNKVESEITNLPYGYYDLRFVCPPSETKKPLHLSLDEVIRGDRKWESDYN 108

Query: 111 LKMLVDENCKELCSTNIPGDDAKFINDLIKSGFLQNWLIDG-LPAARQLYDQTTKSSFYG 169
           L+  V ++C+ LC      D  +  + LI+  ++ +WLIDG LPAA       +   FY 
Sbjct: 109 LEFGVGQDCERLCDRKTMPDGLRQADRLIRENYMVHWLIDGDLPAATTFASTRSGKKFYT 168

Query: 170 SGFELGSVEMIQVVDEAPSHTTPKQPIVEDVLSQELDEEQATEKRANQMLVSSVERTYFA 229
           +GF LG V+          H T                                ++T+  
Sbjct: 169 AGFPLGRVD----------HET--------------------------------DKTHLH 186

Query: 230 NHFDIHIEYHDRGNNEYRIVGVTVNPISMKRDSAICDTNLGKLALSEVSDTDVI---FTY 286
           NH  + I Y     N Y IVG  V P S+        +   +  +    +T+V    FTY
Sbjct: 187 NHLMLVIRYQAFDFNRYAIVGFEVYPRSVSDYQCPGASKSFEPYVINTEETEVTYIPFTY 246

Query: 287 SVTF-EKSDTVWATRWDKYLH----IYDPTIQ---WFSLINFTXXXXXXXXXXXHFLTKA 338
           SV + E+S+  W+ RW+ +      + +  +    W SL N                 K 
Sbjct: 247 SVYWREESNIDWSHRWNLFFDGGSMLPNGNVSFFYWISLANSAIVVALMTLFIALIFLKI 306

Query: 339 LKNDFVRYNEFNLNDSFDEDSGWKLAHGDVFRIPTKSMLLSIFVGSGTQ-LFFMISSVLV 397
             +DFV    F            + A   V+ +   ++  S+    G Q LF +I S  +
Sbjct: 307 RADDFVGTLAF------------EWASQPVYYLTQLNLAASM----GIQFLFSIIGSSTI 350

Query: 398 LAALGFLSPSARGSLPT--IMFILYAVFGFVGSYTSMGVYRFFNGPYWKANM---ILTPL 452
             +L  +       L T  I F+L       G+YTS  V      P  K N+   +L   
Sbjct: 351 SCSLCKVHNIRSWELSTAAICFVL-------GAYTSSLVGSLL-APGPKMNLGTSVLCGC 402

Query: 453 IVPGGIFMFIISMNLFLVFVHSSDVVPIGTLSLMVLLWIVLSLPLSFAGSLISFKRCTW- 511
            +P    + +   N  +    SS  +P GTL  ++  + V+ LPLSF G   + K  +  
Sbjct: 403 TLPALALVVVAVFNSVVWIKDSSAALPFGTLLALLTSYFVICLPLSFLGGFSARKLRSAP 462

Query: 512 -----YDHPTKTNEVLRQIPFQPWYL------KTVPA--------TLIGGIFPFGSIAVE 552
                Y+        L  I +  + L      K +PA        T++ G  PF     E
Sbjct: 463 ANGLNYEQSKVPFSFLLSIEYHEYNLLPAGQEKEIPAILSNPFLLTIVTGFPPFVVTCTE 522

Query: 553 LYFIYSSLWFNK--IFYMFGFLLVSFLLLTMTTSLVTIIVTY------------------ 592
           L F+Y SLW  K  ++ ++GFLLV+F+ L +T   V+++V Y                  
Sbjct: 523 LLFVYRSLWLQKTNLYSLYGFLLVNFIFLCITVCEVSLVVCYVLMIYTQPGSTDRQASNE 582

Query: 593 -----HSLC---------LEN--------WR-----WQWRSFIIGGIGCSIYIFIHSILF 625
                 S+C         L+N        W+     W+W++F + G   + Y  ++S+ +
Sbjct: 583 GPDIRWSICRSPMTIVKSLKNYMASTARRWKASFSSWRWKAF-MAGASVAWYFELYSLYY 641

Query: 626 TEF--KLGGFITIVLYVGYSALIAILCAMVTGAIGFISNMFFVK 667
             F   L  F +I+L+V Y++L  ++C    GA+G+++ ++F+ 
Sbjct: 642 LIFVLHLRDFSSILLFVCYTSLFNLMCWCAFGALGYLTCLWFLN 685

>Skud_5.266 Chr5 (431486..433609) [2124 bp, 707 aa] {ON} YER113C
           (REAL)
          Length = 707

 Score =  127 bits (320), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 166/729 (22%), Positives = 286/729 (39%), Gaps = 143/729 (19%)

Query: 16  SVTNGFYLPG-VAPTTYHELDSIPLLVNHLTPSMFFKHKDSDGNELSSDKENFLYSYDYY 74
           S  N  Y  G + P  Y + D + L+VN +         +SD  +L            Y 
Sbjct: 42  SSQNNLYYDGWITPNFYKKNDFLELIVNKV---------ESDLTQLP-----------YA 81

Query: 75  YSKLHFCKPLDREIKKQPESLGSILFGDRIYNSPFELKMLVDENCKELCSTNIPGDDAKF 134
           Y  L F  P     K    SL  I+ GDR + S ++L+   D  C+ LC+        + 
Sbjct: 82  YYDLPFTCPPTMHKKPLHLSLNEIIRGDRKWESDYKLRFGEDNACETLCARKTDKKGMQT 141

Query: 135 INDLIKSGFLQNWLIDG-LPAARQLYDQTTKSSFYGSGFELGSVEMIQVVDEAPSHTTPK 193
           ++ L++ G++  WLID  LPAA      T    +Y SGF LG V+               
Sbjct: 142 LDKLVREGYVVQWLIDDELPAATTFISTTDHKKYYASGFPLGFVD--------------- 186

Query: 194 QPIVEDVLSQELDEEQATEKRANQMLVSSVERTYFANHFDIHIEYHDRGNNEYRIVGVTV 253
                                         ++TY  NH  + I +H  G+++  +VG  V
Sbjct: 187 ---------------------------PDTDKTYLHNHVILVIRFHGGGDDKNTVVGFEV 219

Query: 254 NPISMKR-DSAICDTNLGKLALSEVSD----TDVIFTYSVTF-EKSDTVWATRWDKYLHI 307
            P S+          N  +  +    D    T + FTYSV + E+ +  W  RW+ +L+ 
Sbjct: 220 YPKSVSDYHCPGASKNYEQYEIVVPEDEHDLTYLPFTYSVYWREEFEVDWNHRWNYFLNA 279

Query: 308 YD------PTIQWFSLINFTXXXXXXXXXXXHFLTKALKND---------FVRYNEFNLN 352
            +          W SL N                 + ++ D          +        
Sbjct: 280 GELSDEQSAQFHWMSLANSLGIVLSISFITFVIYIRVMRTDKKNTDSHKYLINTEGIEAE 339

Query: 353 DSFDEDSGWKLAHGDVFRIPTKSM-----------LLSIFVGSGTQLFFMISSVLVLAAL 401
           DS D+D   K     V+ +    +           +L + V  G Q  F I   L ++  
Sbjct: 340 DSLDDD---KYGKNSVYMVTKDWIQNGKPDLFGLKVLIVLVSFGVQFLFTIIGSLTISCS 396

Query: 402 GFLSPSARGSLPTIMFILYAVFGFVGSY--TSMGV---YRFFNGPYWKAN---------- 446
                + R S+ T+  + + +  F+ S+  T +G+    R  N  Y   N          
Sbjct: 397 MNKLHNVRNSVLTMAILCFVLGAFMASFVGTRLGIVTKRRNINVNYLDHNKSFKNCREFS 456

Query: 447 ---MILTPLIVPGGIFMFIISMNLFLVFVHSSDVVPIGTLSLMVLLWIVLSLPLSFAGSL 503
               ++    +PG + +    +N  +    S++ +P  T+   + ++ V+ +PLS  G +
Sbjct: 457 PIFAVICGSSLPGMVMIGTFLLNSVVGAHDSTNALPFRTIVFFISIYFVVCIPLSLFGGI 516

Query: 504 ISFK---RCTWYDHPTKTN---------EVLRQIPFQPWYLKTVPATLIGGIFPFGSIAV 551
           ++        W    TK           +   +  F P     V    + GIFP   I V
Sbjct: 517 VANNIPLPKYWLSGITKDETDGNGSKLFKPKSRTRFNPLVHCGV---YLCGIFPLLVIYV 573

Query: 552 ELYFIYSSLWFNKI--FYMFGFLLVSFLLLTMTTSLVTIIVTY--HSLCLENWR----WQ 603
           E+ ++Y SLW  K   ++ +GFL +S +LL + T  ++II +Y     C ++      W+
Sbjct: 574 EMQYVYKSLWLEKTTFYFFYGFLFLSIILLCVLTMEISIIGSYLLMRFCFDDKEVRNNWR 633

Query: 604 WRSFIIGGIGCSIYIFIHSI--LFTEFKLGGFITIVLYVGYSALIAILCAMVTGAIGFIS 661
           WR F +G  G  +Y+ ++S+  +F    + GF +I++ + YS L  ILC +  GA+  ++
Sbjct: 634 WRCFEMGFSG-GVYMELYSLYYIFVVLNIHGFSSILISICYSLLFNILCGLGLGALSCLT 692

Query: 662 NMFFVKKIY 670
             +F+ +IY
Sbjct: 693 ASWFINRIY 701

>Kwal_27.10746 s27 (479237..481309) [2073 bp, 690 aa] {ON} YER113C -
           Hypothetical ORF [contig 33] FULL
          Length = 690

 Score =  125 bits (315), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 169/725 (23%), Positives = 273/725 (37%), Gaps = 166/725 (22%)

Query: 44  LTPSMFFKHKDSDG--NELSSDKENFLYSYDYYYSKLHFCKPLDREIKKQPE--SLGSIL 99
           + P+++ K    D   N++ S+   F Y Y   Y     C P D   KK+P   SL  I+
Sbjct: 40  IKPNVYKKGDKVDVIINKVVSETARFPYGY---YDLQFVCPPSD---KKKPLHLSLNEII 93

Query: 100 FGDRIYNSPFELKMLVDENCKELCSTNIPGDDAKFINDLIKSGFLQNWLIDG-LPAARQL 158
            GDR + S + L      +C  LC      +  K  + LI+ G++ +WLID  LPAA   
Sbjct: 94  RGDRKWESDYNLAFGERHDCLRLCDRKTKPEGLKQADALIRQGYVAHWLIDDDLPAATTF 153

Query: 159 YDQTTKSSFYGSGFELGSVEMIQVVDEAPSHTTPKQPIVEDVLSQELDEEQATEKRANQM 218
               +   FY +GF LG V+ +                                      
Sbjct: 154 AKTKSGKKFYTAGFPLGEVDAV-------------------------------------- 175

Query: 219 LVSSVERTYFANHFDIHIEYHDRGNNEYRIVGVTVNPISMKRDSAIC-----DTNLGKLA 273
                 +T   NH  + + Y     N++ I+G  V P S+    A C     D    ++ 
Sbjct: 176 ----TGKTRLYNHLMLVVRYQTVDVNKHTIIGFEVYPKSV--SDAHCPGANKDYQPYEIN 229

Query: 274 LSEVSDTDVIFTYSVTF-EKSDTVWATRWDKYLHIYDPT---------IQWFSLINFTXX 323
             E   T + FTYS+ + E+S+  W+ RW+ ++H  D T           W SL N    
Sbjct: 230 TEESEITYIPFTYSIYWREESNIDWSHRWNFFIH--DDTSSHSKRQSLFHWISLANSAIV 287

Query: 324 XXXXXXXXXHFLTKALKNDFVRYNEFNLNDSFDEDSGWKLAHGDVFRIPTKSMLLSIFVG 383
                        K +KND               D+    A   V         L++   
Sbjct: 288 VVLMSLFIATIFVK-IKND---------------DTVSSSAASWVSESTQLLSCLNLVTS 331

Query: 384 SGTQ-LFFMISSVLVLAALGFLSPSARGSLPTIM--FILYAVFGFVGSYTSMGVYRFFNG 440
            G Q LF ++ S++VL +L  L       L + +  F+  A    +         R   G
Sbjct: 332 MGVQFLFGVVGSLVVLCSLNKLHNIQSWVLSSALCSFVAGAYSSSLLGSLLASGPRVSLG 391

Query: 441 PYWKANMILTPLIVPGGIFMFIISMNLFLVFVHSSDVVPIGTLSLMVLLWIVLSLPLSFA 500
                  +++   +PG +   ++ +N  +    SS  +P GT+ + V  + ++S PLS  
Sbjct: 392 -----TSVISGSALPGLVLFTVLVLNGIVWLKDSSSAIPFGTVVVFVAGYFMISFPLSLL 446

Query: 501 G---------------------SLISFKRCTWYDHPTKTNEVLRQIPFQPWYLKTVPATL 539
           G                     S  SF     YD  +     L + PF       +  T+
Sbjct: 447 GGFSARKMKNAAKLAPANAISKSPFSFLLTLSYDTRSWPATALGK-PFPIALSNPILLTI 505

Query: 540 IGGIFPFGSIAVELYFIYSSLWFN--KIFYMFGFLLVSFLLLTMTTSLVTIIVTY----- 592
           + GI PF  I VEL+++Y S+W      +Y++GFLLV+F+ L +    V+++V Y     
Sbjct: 506 LAGIAPFVVICVELFYVYKSMWLQTTNFYYLYGFLLVNFMFLCIIVCEVSLLVCYVLMVH 565

Query: 593 ----------------------------------------HSLCLENWRWQWRSFIIGG- 611
                                                   H L      W+W+SF+ GG 
Sbjct: 566 NHSGQAPEIESDPYTKLSNSRRCSPITIVNKLKNVLASIAHHLKASFSSWRWKSFVAGGS 625

Query: 612 IGCSIYIFIHSILFTEFKLGGFITIVLYVGYSALIAILCAMVTGAIGFISNMFFVKKIYS 671
           +   + ++    L     L    +I+L+V Y+AL   +C    GA+G++S ++F+  I S
Sbjct: 626 VAWYLELYSLYYLIFVLHLRDLSSILLFVCYTALFNFMCWCAFGALGYLSCLWFLSHISS 685

Query: 672 SIKVE 676
           S K  
Sbjct: 686 SSKAH 690

>KAFR0K01950 Chr11 complement(401168..403162) [1995 bp, 664 aa] {ON}
           Anc_7.411 YER113C
          Length = 664

 Score =  125 bits (314), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 166/685 (24%), Positives = 282/685 (41%), Gaps = 117/685 (17%)

Query: 41  VNHLTPSMFFKHKDSD--GNELSSDKENFLYSYDYYYSKLHFCKPLDREIKKQPESLGSI 98
            N LTP+++ K  D +   N++ SD     Y Y   Y     C P ++  K    SL  I
Sbjct: 34  ANRLTPNIYRKGDDVELIVNKIESDLTKLPYGY---YDLPFICPPTNQR-KPLHMSLTEI 89

Query: 99  LFGDRIYNSPFELKMLVDENCKELCSTNIPGDDAKFINDLIKSGFLQNWLIDG-LPAARQ 157
           L GDR + S + L    D +C  LC+     +  +   +L+K  ++  W ID  LPA+  
Sbjct: 90  LRGDRKWQSDYSLTFGKDNDCAVLCARKTTPEGIQKAINLVKKDYIVQWSIDNDLPASTT 149

Query: 158 LYDQTTKSSFYGSGFELGSVEMIQVVDEAPSHTTPKQPIVEDVLSQELDEEQATEKRANQ 217
               +    +Y  GF LG V+                                       
Sbjct: 150 FISTSENRKYYIPGFSLGFVD--------------------------------------- 170

Query: 218 MLVSSVERTYFANHFDIHIEYHDRGNNEYRIVGVTVNPISMKR-DSAICDTNLGKLALSE 276
                 E  Y  NH  + I YH   +  + IVG+ V P S+          N  +  L  
Sbjct: 171 ---PDTETAYLNNHVMLVIRYHAIDDEHFTIVGLEVYPKSVSDYHCPGASRNYEQFELVA 227

Query: 277 VSDTDVI---FTYSVTF-EKSDTVWATRWDKYLH-------IYDPTIQWFSLINFTXXXX 325
             D +V    FTYSV + E+ D  W  R+  + +       I D   +W  L N +    
Sbjct: 228 NDDEEVTYIPFTYSVYWREEFDVEWKDRYSFFSNSGELSKEITD-KFRWILLANSSGLAL 286

Query: 326 XXXXXXXHFLTKALKNDFVRYNEFNLNDSFDEDSGWKLAHGDVFRIPTKSM--------- 376
                   F++  +   F+R ++ N N    E+S  +   G +  I  K +         
Sbjct: 287 --------FISMIVSVIFLRISKKNKN----ENSAIESKKGSMDVIARKWLRNDRTIHFN 334

Query: 377 LLSIFVGSGTQLFFMISSVLVLAALGFLSPSARGSLPTIMFILYAVFGFVGSYTSMGVYR 436
            L + V  G    F +   L ++       + R S+ T++ + + + GF+ S+    +  
Sbjct: 335 FLIVLVSFGVHFAFTLLGSLAISCSLQKFDNIRNSVLTLVLLFFVLGGFMASFVGTCLIM 394

Query: 437 FFNGPYWKANMI---LTPL-------IVPGGIFMFIISMNLFLVFVH-SSDVVPIGTLSL 485
             N   +K ++     +PL       ++P  I +  I +N  +V+ H SS  +P+ T+  
Sbjct: 395 QKNKTMYKGSLKRLHYSPLFAMCCGSLLPAVIMIITIFLN-NIVWAHGSSRALPLKTILF 453

Query: 486 MVLLWIVLSLPLSFAGSLISFKRCTWYDHPTKTNEVLRQIPFQPWYL-KTVPATL----- 539
           ++ ++ ++ +PLS  G   +   C        ++   +++      L +T+ +       
Sbjct: 454 LISIYFIVCIPLSLLGGSYASDICQKRTLRAFSSPAQQKLAVTNSNLARTIKSIFDDPFS 513

Query: 540 -----IGGIFPFGSIAVELYFIYSSLWFNK--IFYMFGFLLVSFLLLTMTTSLVTIIVTY 592
                IGG+FPF  I VEL  +Y  +W  K   +Y+  FL  + ++L +    + II  Y
Sbjct: 514 GLLASIGGLFPFFIIYVELQHVYKFVWLEKASFYYLRWFLFANIIILCIVVVEIAIISAY 573

Query: 593 ---HSL--CLENWRWQWRSFIIGGIGCSIYIFIHSILFTEFKLG--GFITIVLYVGYSAL 645
              HS    LEN  W+WRSF I    C+ Y+ ++S+ +  + L   GF +I+L V  SAL
Sbjct: 574 IMMHSSRSSLEN-SWRWRSFQISS-SCAWYMELYSLYYIFYVLNTTGFSSILLSVCSSAL 631

Query: 646 IAILCAMVTGAIGFISNMFFVKKIY 670
              LC    G+IG+++  +FV ++Y
Sbjct: 632 FNGLCGCALGSIGYLATCWFVGRVY 656

>Ecym_7143 Chr7 (290555..292585) [2031 bp, 676 aa] {ON} similar to
           Ashbya gossypii AGL295C
          Length = 676

 Score = 82.8 bits (203), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 151/708 (21%), Positives = 268/708 (37%), Gaps = 143/708 (20%)

Query: 26  VAPTTYHELDSIPLLVNHLTPSMFFKHKDSDGNELSSDKENFLYSYDYYYSKLHF-CKPL 84
           V P  Y + + + +L+N +              ELS         Y YY   L F C P 
Sbjct: 40  VRPRIYQDGEEVEMLLNQVV---------GKPGELS---------YGYY--DLQFTCTP- 78

Query: 85  DREIKKQPESLGSILFGDRIYNSPFELKMLVDENCKELCSTNIPGDDAKFINDLIKSGFL 144
            +  +    SL  +  GDR + S ++L    +  C  LC            + LI+  + 
Sbjct: 79  TKSRRMVHHSLYEVFSGDRKWQSDYKLYFNRENKCSTLCFRKTQPSGLIEADSLIRQNYT 138

Query: 145 QNWLIDG-LPAARQLYDQTTKSSFYGSGFELGSVEMIQVVDEAPSHTTPKQPIVEDVLSQ 203
              LID  +PA++          +Y  GF LG V+             P+  +       
Sbjct: 139 VQLLIDEIMPASKTYVSMRDNKRYYVPGFPLGFVD-------------PETDV------- 178

Query: 204 ELDEEQATEKRANQMLVSSVERTYFANHFDIHIEYHDRGNNEYRIVGVTVNPISMKRDSA 263
                                 TY  NHF + I Y+    N+Y IVG  V P S+  D  
Sbjct: 179 ----------------------TYLHNHFMLVIRYNAVDINKYTIVGFEVYPKSVSDDHC 216

Query: 264 ICDTNLGKLALSEVSDTDVIF---TYSVTFEKSDTV-WATRWDKYLHIYDPTIQ---WFS 316
              +   +      S+ DV+F   TYSV + +   V W  RW+ YL   D  +     F 
Sbjct: 217 PGSSKDYENYAVNPSEKDVVFIPITYSVYWREEFMVDWENRWNFYLSAGDLDVNKSLCFR 276

Query: 317 LINFTXXXXXXXXXXXHFLTKALKNDFVRYNEFNLNDSFDEDSGWKLAHGDVFRIPTKSM 376
            I  T            F+   L +  +  +   L       +   +A   V R     +
Sbjct: 277 GIKVTMV----------FIILTLMSLAIIVSRLGLGTGSMFITA--VASEWVRRGAPCLL 324

Query: 377 LLSIFVGSGTQLFFMI-SSVLVLAALGFLSPSARGSLPTIMFILYAVFGFVGSYTSMGVY 435
            L+ FV  G Q+ F   +++L++ ++G L  +    L  I  + Y    F+ ++  + + 
Sbjct: 325 FLNTFVSMGIQVIFAAPATLLLICSMGKLH-NISNFLVCIAALCYMTGIFMSAFGGILLS 383

Query: 436 RFF--NGPYWKANMILTPLIVPGGIFMFIISMNLFLVFVHSSDVVPIGTLSLMVLLWIVL 493
                N    +   +L    +P      ++  N     +     +P   ++L++ L+ ++
Sbjct: 384 GNLLDNKAQIRKYSVLYGSALPALTVAVLVLANSIAWIIERGKEMPFRDITLLLALYFMV 443

Query: 494 SLPLS------------------------FAGSLISFKRCTW-----YDHPTKTNEVLRQ 524
           SLPLS                        + G+ +S  + T+     YD          Q
Sbjct: 444 SLPLSLLGGTSASYKLKDQHFQLYSLSTKYTGTPVSPSKPTFWFNFEYDTRGTPACAHEQ 503

Query: 525 IPFQPWYLKTVPATLIGGIFPFGSIAVELYFIYSSLWFNK--IFYMFGFLLVSFLLLTMT 582
           IP   W  K    T I GI PF +I +++ FI+  LW +   +F ++  L++  +L ++ 
Sbjct: 504 IPM--WLSKPFLITSIIGIIPFLAIYLQMEFIWKPLWTHSKSLFQIYVSLIIGMILQSIL 561

Query: 583 TSLVTIIVTY--------HSLCLENW-----------RWQWRSFIIGGIGCSIYIFIHSI 623
              + I++ Y           C ++             W+W++F +GG   + Y   +S+
Sbjct: 562 VMEICILIMYVHMHHGDDSECCFDDTCVTGRISNAVSSWRWKAFYMGG-AAAWYWEAYSL 620

Query: 624 LFTEF--KLGGFITIVLYVGYSALIAILCAMVTGAIGFISNMFFVKKI 669
            +  F  +L  F +I+LY+ Y  L+ +      G+IG+++  +F+ K+
Sbjct: 621 YYMIFILRLRNFGSILLYLSYGTLLNVFYFYSFGSIGYLACCWFLNKL 668

>TBLA0I00330 Chr9 (52200..54341) [2142 bp, 713 aa] {ON} Anc_7.411
           YER113C
          Length = 713

 Score = 67.0 bits (162), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 106/471 (22%), Positives = 172/471 (36%), Gaps = 89/471 (18%)

Query: 74  YYSKLHFCKPLDREIKKQP--ESLGSILFGDRIYNSPFELKMLVDENCKELCSTNIPGDD 131
           YY     C P D    K+P   SL  +  GD +  S + L+   DE C  LCS       
Sbjct: 92  YYDLPFVCPPSD---TKRPIHNSLTELFNGDYLSESDYILEFAKDEPCHILCSRKTSKKG 148

Query: 132 AKFINDLIKSGFLQNWLIDG-LPAARQLYDQTTKSSFYGSGFELGSVEMIQVVDEAPSHT 190
            +   DLIK+ ++  W +D  LP              Y  GF LG  +            
Sbjct: 149 MQRAYDLIKNDYIVQWYVDNDLPVGTTYISNKVNKKQYLPGFSLGYFD------------ 196

Query: 191 TPKQPIVEDVLSQELDEEQATEKRANQMLVSSVERTYFANHFDIHIEYHDRGNNEYRIVG 250
                                    NQ       + Y   H    + YH   ++ + IVG
Sbjct: 197 -------------------------NQ-----TGQAYLNTHLMFVVRYHAVTSDTFTIVG 226

Query: 251 VTVNPISM---KRDSAICDTNLGKLALSEVSD--TDVIFTYSVTF-EKSDTVWATRWDKY 304
           + V P S+       A  D    ++ + E +D  T + F+YSV + E+ D  W  RWD +
Sbjct: 227 LEVYPRSIVDYNCPGASKDFIPLEVKVPENNDDPTYLPFSYSVYWREEFDLPWNQRWDLF 286

Query: 305 ------LHIYDPTIQWFSLINFTXXXXXXXXXXXHFLTKALKNDFVR--YNEFNLNDSFD 356
                 L   D +  W+SLIN              FL   +  + +R  YN+        
Sbjct: 287 KTADELLREKDLSFHWYSLIN----SNSITVGVITFLCLVISMNRMRILYNK-------- 334

Query: 357 EDSGWKLAHGDV-----FRIPTKSMLLSIFVGSGTQLFF-MISSVLVLAALGFLSPSARG 410
               WK     +      R P    + +I + SG Q FF +ISSVL+   +         
Sbjct: 335 ---SWKKRQLSITTTTTTRYPN---IFTICITSGIQFFFLLISSVLITFQISKFHQIKDT 388

Query: 411 SLPTIMFILYAVF--GFVGSYTSMG-VYRFFNGPYWKANMILTPLIVPGGIFMFIISMNL 467
            +  + FI + +    F+G+      +   F   Y+  N IL    +P  I + +  +N 
Sbjct: 389 IIVALFFIAFGIIVSVFIGTLIQRTFILTNFPDKYYLTNPILFGSTLPAFILLSMFIINS 448

Query: 468 FLVFVHSSDVVPIGTLSLMVLLWIVLSLPLSFAGSLISFKRCTWYDHPTKT 518
            +     +   P          + +LS+PLS    ++S +  ++  +P+++
Sbjct: 449 IIYLSEKNHAFPFKLSMYFFTSYFILSIPLSIISGVLSTRFISFPKYPSRS 499

>Kpol_1045.28 s1045 (64235..66280) [2046 bp, 681 aa] {ON}
           (64237..66282) [2046 nt, 682 aa]
          Length = 681

 Score = 66.6 bits (161), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 145/701 (20%), Positives = 262/701 (37%), Gaps = 122/701 (17%)

Query: 26  VAPTTYHELDSIPLLVNHLTPSMFFKHKDSDGNELSSDKENFLYSYDYYYSKLHFCKPLD 85
           + P  Y   D++ LLVN    +            L++D +       Y Y  L F  P  
Sbjct: 47  LQPNVYKVGDNVDLLVNKAIST------------LNADLK------PYIYHDLPFVCPPT 88

Query: 86  REIKKQPESLGSILFGDRIYNSPFELKMLVDENCKELCSTNIPGDDAKFINDLIKSGFLQ 145
              K       S+  GD +  S ++LK   D  C+ LC+     +      D+IK  +  
Sbjct: 89  SVRKPVHLEFDSLFRGDTLSESDYKLKFGDDYECEILCARKTNKNGVSKAIDMIKQDYQI 148

Query: 146 NWLIDG-LPAARQLYDQTTKSSFYGSGFELGSVEMIQVVDEAPSHTTPKQPIVEDVLSQE 204
            W ID  LP +       T+   Y  GF LG                             
Sbjct: 149 LWSIDDELPISMPYISTITQRKKYIPGFPLG----------------------------R 180

Query: 205 LDEEQATEKRANQMLVSSVERTYFANHFDIHIEYHDRGNNEYRIVGVTVNPISMKR---D 261
            D+++               + Y  NH  + I Y+   ++++ IVG  V   S+      
Sbjct: 181 FDKDK--------------NKVYLYNHSMLVIRYNAIDDDKFTIVGFEVYLRSVSDYHCP 226

Query: 262 SAICDTNLGKLALSEVSD--TDVIFTYSVTF-EKSDTVWATRW---DKYLHIYDPTIQWF 315
            A  +    +L + E  D  T + FTYSV + E+ D  W +RW   D  +   DP +   
Sbjct: 227 GASKNYEEYELVIPENDDDLTFIPFTYSVYWREEFDIDWTSRWNLFDNDIEEEDPKLINK 286

Query: 316 SLIN------FTXXXXXXXXXXXHFLTKALKNDFVRYNEFNLNDSFDEDSGWKLAHGDVF 369
           S+++       T             + K ++N     N+F           W  ++    
Sbjct: 287 SMLSNIMQPTRTGLFLLPLIIFSIIIVKVVENG--EKNKFTTEAQL-ASKCWIESNNINL 343

Query: 370 RIPTKSMLLSIFVGSGTQLFFMISSVLVLAALGFLSPSARGSLPTIMFILYA----VFGF 425
           +    + +L++ +  G Q  F +  +++L    +        +   +FI +        F
Sbjct: 344 KSSFSASILTLVISMGVQSIFSLIGIIILKLSIYKLHDISNIVLLNIFIWFIEGILASSF 403

Query: 426 VGSYTSMGVYRFFNGPYWKANMILTPLIVPGGIFMFIISMNLFLVFVHSSDVVPIGTLSL 485
           +G++  M +    +  Y     IL   ++P  + +F+  ++  +  + SS   P  TL++
Sbjct: 404 LGTWLRMNILNKKSINYNPKFSILCGSLLPFLLMIFVYPIHSIVWLIESSSRYPFKTLTM 463

Query: 486 MVLLWIVLSLPLSFAGSLISFKRCTWY---------DHPTKTNEVLRQIPFQPW------ 530
           M+  + ++ +P S  G  ++ K    Y         D+    N+  ++   Q        
Sbjct: 464 MISFFYIICVPFSIIGGGLAKKYRKHYKEMFGNITLDNENNDNDEKKRFKAQHRPSSINK 523

Query: 531 -YLKTVPATLIGGIFPFGSIAVELYFIYSSLWFN-----KIFYMFGFLLVSFLLLTMTTS 584
             L T+  +LI  I PF  I  ELY+I+++ W N     K F      L   ++   +TS
Sbjct: 524 NKLGTLVYSLITAIVPFFIIKSELYWIFTNKWLNYTTFIKSFIFLIIKLFIIIITVSSTS 583

Query: 585 LVTIIVT--YHSLCLENWR-----WQWRSFIIGGIGC------SIYIFIHSILFTEFKLG 631
           LV + V        +  WR      +W  F+     C      S+Y  I  I     ++ 
Sbjct: 584 LVGLFVNIMMTKKGISQWRDDPISLRWSCFLNSFNICYLTGLYSLYYIIEVI-----RIH 638

Query: 632 GFITIVLYVGYSALIAILCAMVTGAIGFISNMFFVKKIYSS 672
           GF   VL + Y+  + ++  +  GAI +++  + + K+Y +
Sbjct: 639 GFSMTVLTIFYTIALNVILGISCGAIAYMTCYWLIIKLYKN 679

>TPHA0K00730 Chr11 (150877..153078) [2202 bp, 733 aa] {ON} Anc_7.411
           YER113C
          Length = 733

 Score = 60.1 bits (144), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 71/290 (24%), Positives = 107/290 (36%), Gaps = 66/290 (22%)

Query: 26  VAPTTYHELDSIPLLVNHLTPSMFFKHKD--SDGNELSSDKENFLYSYDYYYSKLHFCKP 83
           V P TY   D + ++VN +      + KD   D NE  S K         Y+   + C P
Sbjct: 46  VHPNTYTFGDPVEVIVNKMV-----QEKDMLGDSNEGVSYK---------YHDLPYICPP 91

Query: 84  LDREIKKQPESLGSILFGDRIYNSPFELKMLVDENCKELCSTNIPGDDAKFINDLIKSGF 143
            + + K    SL  +  GD    S + LK  VD +C+ LC         +   ++I   +
Sbjct: 92  TNTK-KSIHNSLKELFNGDYNEQSDYILKFGVDNDCQALCLRKTYNAGIRKAKEMIDEDY 150

Query: 144 LQNWLIDG-LPAARQLYDQTTKSSFYGSGFELGSVEMIQVVDEAPSHTTPKQPIVEDVLS 202
           + NW ID  LPAA       T+   Y  GF LG                           
Sbjct: 151 IVNWFIDDYLPAATTYISSVTRKKKYFEGFSLGWK------------------------- 185

Query: 203 QELDEEQATEKRANQMLVSSVERTYFANHFDIHIEYHDRGNNEYRIVGVTVNPISMKR-D 261
              D E  +               Y  NH  + I Y+   +N++ IVG  V P S+    
Sbjct: 186 ---DPETGS--------------YYINNHVMLVIRYNAVDDNKFNIVGFEVYPKSIPDLQ 228

Query: 262 SAICDTNLGKLALSEVSDTD----VIFTYSVTF-EKSDTVWATRWDKYLH 306
                   G   L ++ + D    + F+YSV + E+ +  W TRW  ++ 
Sbjct: 229 CPGARRGHGHYELKDLENNDEFSLIPFSYSVYWREEFEYDWRTRWSLFVR 278

>AGL295C Chr7 complement(152197..154170) [1974 bp, 657 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER113C
          Length = 657

 Score = 56.6 bits (135), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 32/105 (30%), Positives = 51/105 (48%), Gaps = 2/105 (1%)

Query: 74  YYSKLHFCKPLDREIKKQPESLGSILFGDRIYNSPFELKMLVDENCKELCSTNIPGDDAK 133
           YY  L  C P   E +    SLG +   +  + S + L +  +  C+ LC   +  D  +
Sbjct: 64  YYETLFTCPP-PAEARAIYGSLGQVFRREMPWESNYVLHVRAETQCQPLCMRELRPDSHR 122

Query: 134 FINDLIKSGFLQNWLIDGLPAARQLYDQTTKSSFYGSGFELGSVE 178
            +  +I+ G    W +DGLPAA    D+ + S  Y +GF+LG V+
Sbjct: 123 RLIQMIRDGAQVRWTLDGLPAATTYPDRQS-SYRYEAGFKLGEVD 166

>NCAS0B07560 Chr2 complement(1426000..1427477,1427593..1427602)
           [1488 bp, 495 aa] {ON} Anc_1.303 YBR283C
          Length = 495

 Score = 36.2 bits (82), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 29/58 (50%), Gaps = 3/58 (5%)

Query: 509 CTWYDHPTKTNEVLRQIPFQPWYLKTVPATLIGGIF--PFGSIAVELYFIYSSLWFNK 564
           C    H    N +L  +P  P  L T P +LIGG+F  P   I   L+ + +S+WF K
Sbjct: 328 CKILGHYENVNNIL-AVPTFPLSLLTPPRSLIGGLFSQPLTFIVFTLFIVSTSVWFAK 384

>TBLA0A06670 Chr1 complement(1630701..1632023) [1323 bp, 440 aa]
           {ON} Anc_3.338 YPR054W
          Length = 440

 Score = 33.5 bits (75), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 26/46 (56%), Gaps = 8/46 (17%)

Query: 187 PSHTTPKQPIVEDVLSQ-ELDEEQATEKRANQMLVSSVERTYFANH 231
           PS T PK       LSQ EL ++Q T+KR  Q+L S +E+    +H
Sbjct: 13  PSKTVPK-------LSQKELKQQQVTDKRVQQLLQSQLEKLKLKSH 51

>Suva_16.44 Chr16 (64828..66477) [1650 bp, 549 aa] {ON} YPL260W
           (REAL)
          Length = 549

 Score = 32.7 bits (73), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 24/47 (51%), Gaps = 6/47 (12%)

Query: 8   VSICLITLSVTNGFYLPGVAPTTYHELDSIPLLVNHLTPSMFFKHKD 54
           +S+C +T+ + N       AP TY  L ++  L+ HL  S  F H D
Sbjct: 100 ISLCFLTVGLKNS------APATYASLSTVESLLEHLNESNVFTHHD 140

>NCAS0E02130 Chr5 (408158..409738) [1581 bp, 526 aa] {ON} Anc_7.125
           YPL260W
          Length = 526

 Score = 32.3 bits (72), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 25/47 (53%), Gaps = 6/47 (12%)

Query: 8   VSICLITLSVTNGFYLPGVAPTTYHELDSIPLLVNHLTPSMFFKHKD 54
           +S+C +T+ + N       AP TY  L ++  L+ HL+ S  F H D
Sbjct: 101 LSLCFLTVGLKNS------APATYASLSTVQSLLEHLSESNIFTHHD 141

>NDAI0E03670 Chr5 (792667..794235) [1569 bp, 522 aa] {ON} Anc_7.125
           YPL260W
          Length = 522

 Score = 32.3 bits (72), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 24/47 (51%), Gaps = 6/47 (12%)

Query: 8   VSICLITLSVTNGFYLPGVAPTTYHELDSIPLLVNHLTPSMFFKHKD 54
           +S+C +T+ + N       AP TY  L ++  L+ HL  S  F H D
Sbjct: 105 LSLCFLTVGLKNS------APATYASLSTVQSLLEHLNESNIFTHHD 145

>Smik_6.467 Chr6 complement(770217..771863) [1647 bp, 548 aa] {ON}
           YPL260W (REAL)
          Length = 548

 Score = 32.3 bits (72), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 24/47 (51%), Gaps = 6/47 (12%)

Query: 8   VSICLITLSVTNGFYLPGVAPTTYHELDSIPLLVNHLTPSMFFKHKD 54
           +S+C +T+ + N       AP TY  L ++  L+ HL  S  F H D
Sbjct: 100 LSLCFLTVGLKNS------APATYASLSTVESLLEHLNESNVFTHHD 140

>Smik_13.239 Chr13 complement(375639..376622) [984 bp, 327 aa] {ON}
           YMR060C (REAL)
          Length = 327

 Score = 32.0 bits (71), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 12/31 (38%), Positives = 20/31 (64%)

Query: 105 YNSPFELKMLVDENCKELCSTNIPGDDAKFI 135
           YN+P +L+    ENC+E+  + I  DD +F+
Sbjct: 155 YNTPLKLRSQARENCQEIIGSIILEDDEEFV 185

>YPL260W Chr16 (49303..50958) [1656 bp, 551 aa] {ON} Putative
           substrate of cAMP-dependent protein kinase (PKA); green
           fluorescent protein (GFP)-fusion protein localizes to
           the cytoplasm and nucleus; YPL260W is not an essential
           gene
          Length = 551

 Score = 32.3 bits (72), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 24/47 (51%), Gaps = 6/47 (12%)

Query: 8   VSICLITLSVTNGFYLPGVAPTTYHELDSIPLLVNHLTPSMFFKHKD 54
           +S+C +T+ + N       AP TY  L ++  L+ HL  S  F H D
Sbjct: 100 LSLCFLTVGLKNS------APATYASLSTVESLLEHLNESNVFTHHD 140

>CAGL0H09108g Chr8 (889038..890636) [1599 bp, 532 aa] {ON} highly
           similar to uniprot|Q08977 Saccharomyces cerevisiae
           YPL260w
          Length = 532

 Score = 32.0 bits (71), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 24/47 (51%), Gaps = 6/47 (12%)

Query: 8   VSICLITLSVTNGFYLPGVAPTTYHELDSIPLLVNHLTPSMFFKHKD 54
           +S+C +T+ + N       AP TY  L ++  L+ HL  S  F H D
Sbjct: 106 LSLCFLTVGLKNS------APATYASLSTVQCLLEHLCESNVFTHHD 146

>KLLA0E15291g Chr5 complement(1359509..1361590) [2082 bp, 693 aa]
           {ON} conserved hypothetical protein
          Length = 693

 Score = 32.3 bits (72), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 33/127 (25%), Positives = 56/127 (44%), Gaps = 30/127 (23%)

Query: 135 INDLIKSGFLQNWLIDG-----LPAARQLYDQTTKSSFYGSGFELGSVEMIQVVDEAPSH 189
           ++D  KS   +NW+I G        A  +  +  KS+ + S F+      I VVD  PSH
Sbjct: 430 LDDKYKSTIGENWIISGNIKQWTNPASSINHKELKSNIFDSTFD------INVVDRNPSH 483

Query: 190 TTPKQPIVEDVLSQELDEEQATEKRANQMLVSSVERTY-----FANHFDIHIEYHDRGNN 244
                      L Q ++   AT K     L+   ++ Y     + N F  ++ ++D GN+
Sbjct: 484 -----------LHQAVN---ATTKNEVASLLYLEDKPYVLSHTYHNEFVSNLTFYDDGND 529

Query: 245 EYRIVGV 251
           E+ +V +
Sbjct: 530 EHTVVNL 536

>Skud_16.18 Chr16 (28372..30024) [1653 bp, 550 aa] {ON} YPL260W
           (REAL)
          Length = 550

 Score = 32.0 bits (71), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 24/47 (51%), Gaps = 6/47 (12%)

Query: 8   VSICLITLSVTNGFYLPGVAPTTYHELDSIPLLVNHLTPSMFFKHKD 54
           +S+C +T+ + N       AP TY  L ++  L+ HL  S  F H D
Sbjct: 99  LSLCFLTVGLKNS------APATYASLSTVESLLEHLNESNVFTHHD 139

>Ecym_8352 Chr8 complement(703563..705302) [1740 bp, 579 aa] {ON}
           similar to Ashbya gossypii ADL019W
          Length = 579

 Score = 32.0 bits (71), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 25/47 (53%), Gaps = 6/47 (12%)

Query: 8   VSICLITLSVTNGFYLPGVAPTTYHELDSIPLLVNHLTPSMFFKHKD 54
           +S+C +T+ + N       AP TY  L ++  L++HL  S  + H D
Sbjct: 100 LSLCFLTVGLKNS------APATYASLSTVQSLLDHLNESNVYTHND 140

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.325    0.141    0.434 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 73,083,540
Number of extensions: 3345924
Number of successful extensions: 12035
Number of sequences better than 10.0: 76
Number of HSP's gapped: 12195
Number of HSP's successfully gapped: 108
Length of query: 676
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 560
Effective length of database: 40,180,143
Effective search space: 22500880080
Effective search space used: 22500880080
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 69 (31.2 bits)