Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0E04360singletonON2022029481e-131
TBLA0E04350singletonON2301624101e-49
TBLA0E01640singletonON2291581914e-17
SAKL0H20614gsingletonON2361041521e-11
YNR075W (COS10)singletonON3741031392e-09
SAKL0D01254gsingletonON1951021317e-09
Kwal_26.7243singletonON3661511339e-09
SAKL0D15312gsingletonON1991421193e-07
Suva_14.7singletonON140951163e-07
ZYRO0B00154gsingletonON360881196e-07
KNAG0C05530singletonON2291171178e-07
ZYRO0C00242gsingletonON356731161e-06
Skud_3.88singletonON2341371152e-06
KLTH0D00374gsingletonON3731341162e-06
NCAS0H00970singletonON257791142e-06
Smik_3.91na 1ON2391461133e-06
Kwal_26.7673singletonON367621143e-06
Suva_12.273singletonON379501143e-06
Kwal_27.10096singletonON3401131143e-06
Suva_1.100singletonON3231631143e-06
KLLA0C19063gsingletonON209741123e-06
Skud_19.5singletonON2361411124e-06
TDEL0B03200singletonON361801134e-06
YGL263W (COS12)singletonON3801481125e-06
SAKL0H20636gsingletonON225661115e-06
ZYRO0D00352gsingletonON3561041125e-06
SAKL0D15290gsingletonON2041591097e-06
YHL044WsingletonON235831107e-06
SAKL0C10956gsingletonON171901088e-06
ZYRO0D00242gsingletonON351451091e-05
Smik_3.4singletonON415501091e-05
Suva_14.9singletonOFF1371271051e-05
ZYRO0A13948gsingletonON328451082e-05
TDEL0A01190singletonON3691311063e-05
Smik_16.462singletonON383791063e-05
Smik_18.2singletonON2311241044e-05
KNAG0G03450singletonON165731025e-05
YCR007Cna 1ON2391191035e-05
Kwal_49.19404singletonON200581026e-05
Kwal_56.22593singletonON200581026e-05
SAKL0C10978gsingletonON258931028e-05
Smik_9.248singletonON13246989e-05
Skud_1.87na 2ON223641011e-04
Skud_69.1singletonON236811011e-04
Skud_55.1singletonON289501011e-04
YAR033W (MST28)na 3ON234133992e-04
TDEL0F02400singletonON375101993e-04
Smik_11.1singletonOFF16559963e-04
KLTH0B06710gsingletonON39055993e-04
KLTH0G19580gsingletonON381133993e-04
Skud_13.255singletonON24888983e-04
YNL336W (COS1)singletonON381128983e-04
YGL053W (PRM8)singletonON237115973e-04
Smik_18.5singletonON41688983e-04
Suva_16.529singletonOFF169103954e-04
NDAI0G02270singletonON240102964e-04
Skud_41.1singletonON23258964e-04
ZYRO0E00440gsingletonON35172974e-04
TDEL0A06960singletonON38169975e-04
Skud_11.1singletonON29849966e-04
ZYRO0C18590gsingletonON34296966e-04
Skud_107.1singletonOFF19646946e-04
YFL062W (COS4)singletonON379123967e-04
ZYRO0F18700gsingletonON34272958e-04
YBR302C (COS2)singletonON37981959e-04
YML132W (COS3)na 4ON37981959e-04
YAR023Cna 5ON17958930.001
SAKL0C10868gsingletonON25797940.001
Smik_9.252singletonON39164940.001
YAR028Wna 6ON23489930.001
ZYRO0A00220gsingletonON35684940.001
Kwal_26.9047singletonON11977890.001
KLTH0B10296gsingletonON9243880.001
NCAS0I00840singletonON23544920.001
ZYRO0D00154gsingletonON356112930.001
NCAS0C03030singletonON25284920.001
YGR295C (COS6)singletonON381167930.001
ZYRO0A13816gsingletonON22482920.002
KAFR0H03780singletonON239133910.002
YDL248W (COS7)singletonON383108920.002
TDEL0D00660singletonON36480920.002
YAR031W (PRM9)na 2ON29882910.002
Skud_13.8na 4ON23390910.002
YGL051W (MST27)singletonON23458900.002
Smik_16.6singletonON20450900.003
KLTH0B10252gsingletonON22378900.003
Skud_3.71na 1ON23558900.003
ZYRO0E00330gsingletonON35758900.003
Skud_1.88na 3ON20460890.004
Suva_8.398singletonON29882900.004
KAFR0C00130singletonON211117870.007
Smik_1.90na 7ON23856870.008
Skud_64.1singletonON32750870.008
YKL219W (COS9)singletonON40750870.008
YJR161C (COS5)singletonON38350870.008
NDAI0G01470singletonON239152860.009
Smik_1.105na 3ON20062860.009
KLTH0D00242gsingletonON22667860.009
Skud_53.1singletonON29244860.010
KAFR0B03990singletonON226125850.011
NDAI0G02310singletonON29466860.011
Smik_4.183singletonOFF10539810.013
Skud_8.1na 8ON384104850.014
Skud_1.80na 7ON24372850.014
Suva_1.79na 9ON24858850.014
Suva_3.29singletonOFF16952830.016
Smik_9.244singletonON151103820.019
Skud_66.1singletonOFF18360800.045
YAR027W (UIP3)na 7ON23560800.053
YHL048W (COS8)singletonON38182800.062
YIR043CsingletonOFF23060790.063
ZYRO0E00132gsingletonON28951790.095
NDAI0F04400singletonON21569780.10
Suva_2.719singletonOFF10160740.13
YHL042Wna 8ON15059750.14
TDEL0A01180singletonON22341760.16
TBLA0B05730singletonON21148760.19
YHL043W (ECM34)singletonON17037740.23
Suva_13.219singletonON16953740.23
Suva_2.722singletonOFF14363730.25
NDAI0F04550singletonON26465750.28
KLTH0C00264gsingletonON13854730.29
Suva_9.16singletonON9244700.33
Skud_1.86na 10ON175102730.36
KLLA0A11957gsingletonON20835730.42
Skud_1.82na 6ON236112730.48
TDEL0D00130singletonON153123700.63
TDEL0H038307.68ON158241720.77
KLTH0B10274gsingletonON16072700.78
Smik_1.89na 5ON19164700.94
TDEL0A06970singletonON20056701.0
ZYRO0D04158g7.68ON158741701.4
NCAS0A10610singletonON30053681.9
Smik_13.228singletonON23958672.3
Suva_16.16singletonOFF13448652.4
TBLA0B10010singletonON17633662.7
KLTH0B10230gsingletonON20440663.1
Smik_17.8singletonOFF12237643.1
Suva_16.527singletonOFF6830614.3
SAKL0H05522gsingletonON13938635.6
Kpol_1036.100singletonON83337655.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0E04360
         (202 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0E04360 Chr5 (1107926..1108534) [609 bp, 202 aa] {ON}             369   e-131
TBLA0E04350 Chr5 (1106371..1107063) [693 bp, 230 aa] {ON}             162   1e-49
TBLA0E01640 Chr5 (395468..396157) [690 bp, 229 aa] {ON}                78   4e-17
SAKL0H20614g Chr8 (1809584..1810294) [711 bp, 236 aa] {ON} some ...    63   1e-11
YNR075W Chr14 (779916..781040) [1125 bp, 374 aa] {ON}  COS10Prot...    58   2e-09
SAKL0D01254g Chr4 (95413..96000) [588 bp, 195 aa] {ON} some simi...    55   7e-09
Kwal_26.7243 s26 (278708..279808) [1101 bp, 366 aa] {ON} YNL336W...    56   9e-09
SAKL0D15312g Chr4 (1275517..1276116) [600 bp, 199 aa] {ON} some ...    50   3e-07
Suva_14.7 Chr14 (7591..8013) [423 bp, 140 aa] {ON} YJR161C (REAL)      49   3e-07
ZYRO0B00154g Chr2 (3082..4164) [1083 bp, 360 aa] {ON} weakly sim...    50   6e-07
KNAG0C05530 Chr3 complement(1073752..1074441) [690 bp, 229 aa] {...    50   8e-07
ZYRO0C00242g Chr3 (8037..9107) [1071 bp, 356 aa] {ON} weakly sim...    49   1e-06
Skud_3.88 Chr3 (133816..134520) [705 bp, 234 aa] {ON} YCR007C (R...    49   2e-06
KLTH0D00374g Chr4 complement(33818..34939) [1122 bp, 373 aa] {ON...    49   2e-06
NCAS0H00970 Chr8 complement(180888..181661) [774 bp, 257 aa] {ON}      49   2e-06
Smik_3.91 Chr3 (124341..125060) [720 bp, 239 aa] {ON} YCR007C (R...    48   3e-06
Kwal_26.7673 s26 complement(466671..467774) [1104 bp, 367 aa] {O...    49   3e-06
Suva_12.273 Chr12 complement(443438..444577) [1140 bp, 379 aa] {...    49   3e-06
Kwal_27.10096 s27 (192352..193374) [1023 bp, 340 aa] {ON} YNL336...    49   3e-06
Suva_1.100 Chr1 (165459..166430) [972 bp, 323 aa] {ON} YCR007C (...    49   3e-06
KLLA0C19063g Chr3 complement(1692492..1693121) [630 bp, 209 aa] ...    48   3e-06
Skud_19.5 Chr19 (3036..3746) [711 bp, 236 aa] {ON} YHL044W (REAL)      48   4e-06
TDEL0B03200 Chr2 (564384..565469) [1086 bp, 361 aa] {ON}               48   4e-06
YGL263W Chr7 (2790..3932) [1143 bp, 380 aa] {ON}  COS12Protein o...    48   5e-06
SAKL0H20636g Chr8 (1810817..1811494) [678 bp, 225 aa] {ON} weakl...    47   5e-06
ZYRO0D00352g Chr4 (26055..27125) [1071 bp, 356 aa] {ON} weakly s...    48   5e-06
SAKL0D15290g Chr4 (1274588..1275202) [615 bp, 204 aa] {ON} some ...    47   7e-06
YHL044W Chr8 (13565..14272) [708 bp, 235 aa] {ON} Putative integ...    47   7e-06
SAKL0C10956g Chr3 (990412..990927) [516 bp, 171 aa] {ON} some si...    46   8e-06
ZYRO0D00242g Chr4 (12246..13301) [1056 bp, 351 aa] {ON} weakly s...    47   1e-05
Smik_3.4 Chr3 (3476..4723) [1248 bp, 415 aa] {ON} YGL263W (REAL)       47   1e-05
Suva_14.9 Chr14 (8076..8222,8226..8447,8451..8492) [411 bp, 137 ...    45   1e-05
ZYRO0A13948g Chr1 complement(1108143..1109129) [987 bp, 328 aa] ...    46   2e-05
TDEL0A01190 Chr1 complement(200994..202103) [1110 bp, 369 aa] {O...    45   3e-05
Smik_16.462 Chr16 complement(798062..799213) [1152 bp, 383 aa] {...    45   3e-05
Smik_18.2 Chr18 (1570..2265) [696 bp, 231 aa] {ON} YHL044W (REAL)      45   4e-05
KNAG0G03450 Chr7 complement(740617..741114) [498 bp, 165 aa] {ON}      44   5e-05
YCR007C Chr3 complement(126011..126730) [720 bp, 239 aa] {ON} Pu...    44   5e-05
Kwal_49.19404 s49 (2490..3092) [603 bp, 200 aa] {ON} [contig 369...    44   6e-05
Kwal_56.22593 s56 complement(194937..195539) [603 bp, 200 aa] {O...    44   6e-05
SAKL0C10978g Chr3 complement(991612..992388) [777 bp, 258 aa] {O...    44   8e-05
Smik_9.248 Chr9 complement(405227..405625) [399 bp, 132 aa] {ON}...    42   9e-05
Skud_1.87 Chr1 (157764..158435) [672 bp, 223 aa] {ON}  YGL051W (...    44   1e-04
Skud_69.1 Chr69 (40..750) [711 bp, 236 aa] {ON} YHL044W (REAL)         44   1e-04
Skud_55.1 Chr55 complement(256..1125) [870 bp, 289 aa] {ON} YGR2...    44   1e-04
YAR033W Chr1 (188107..188811) [705 bp, 234 aa] {ON}  MST28Putati...    43   2e-04
TDEL0F02400 Chr6 complement(444921..446048) [1128 bp, 375 aa] {O...    43   3e-04
Smik_11.1 Chr11 (1..498) [498 bp, 165 aa] {OFF} YBR302C (HSP)          42   3e-04
KLTH0B06710g Chr2 (538970..540142) [1173 bp, 390 aa] {ON} weakly...    43   3e-04
KLTH0G19580g Chr7 (1693206..1694351) [1146 bp, 381 aa] {ON} weak...    43   3e-04
Skud_13.255 Chr13 complement(436932..437678) [747 bp, 248 aa] {O...    42   3e-04
YNL336W Chr14 (8330..9475) [1146 bp, 381 aa] {ON}  COS1Protein o...    42   3e-04
YGL053W Chr7 (402589..403302) [714 bp, 237 aa] {ON}  PRM8Pheromo...    42   3e-04
Smik_18.5 Chr18 (7625..8875) [1251 bp, 416 aa] {ON}  YDL248W (REAL)    42   3e-04
Suva_16.529 Chr16 complement(913015..913104,913108..913224,91322...    41   4e-04
NDAI0G02270 Chr7 complement(508794..509516) [723 bp, 240 aa] {ON}      42   4e-04
Skud_41.1 Chr41 (3..701) [699 bp, 232 aa] {ON} YCR007C (REAL)          42   4e-04
ZYRO0E00440g Chr5 (28214..29269) [1056 bp, 351 aa] {ON} weakly s...    42   4e-04
TDEL0A06960 Chr1 (1219819..1220964) [1146 bp, 381 aa] {ON}             42   5e-04
Skud_11.1 Chr11 (2..898) [897 bp, 298 aa] {ON}  YKL219W (REAL)         42   6e-04
ZYRO0C18590g Chr3 complement(1460662..1461690) [1029 bp, 342 aa]...    42   6e-04
Skud_107.1 Chr107 (3..590) [588 bp, 196 aa] {OFF} YKL219W (HSP)        41   6e-04
YFL062W Chr6 (6426..7565) [1140 bp, 379 aa] {ON}  COS4Protein of...    42   7e-04
ZYRO0F18700g Chr6 complement(1550815..1551843) [1029 bp, 342 aa]...    41   8e-04
YBR302C Chr2 complement(810340..811479) [1140 bp, 379 aa] {ON}  ...    41   9e-04
YML132W Chr13 (7244..8383) [1140 bp, 379 aa] {ON}  COS3Protein i...    41   9e-04
YAR023C Chr1 complement(179281..179820) [540 bp, 179 aa] {ON} Pu...    40   0.001
SAKL0C10868g Chr3 (986125..986898) [774 bp, 257 aa] {ON} weakly ...    41   0.001
Smik_9.252 Chr9 complement(407060..408235) [1176 bp, 391 aa] {ON...    41   0.001
YAR028W Chr1 (184892..185596) [705 bp, 234 aa] {ON} Putative int...    40   0.001
ZYRO0A00220g Chr1 (9173..10243) [1071 bp, 356 aa] {ON} weakly si...    41   0.001
Kwal_26.9047 s26 (1053474..1053833) [360 bp, 119 aa] {ON} YHL048...    39   0.001
KLTH0B10296g Chr2 (867082..867360) [279 bp, 92 aa] {ON} conserve...    39   0.001
NCAS0I00840 Chr9 complement(154605..155312) [708 bp, 235 aa] {ON}      40   0.001
ZYRO0D00154g Chr4 (5577..6647) [1071 bp, 356 aa] {ON} weakly sim...    40   0.001
NCAS0C03030 Chr3 (596013..596771) [759 bp, 252 aa] {ON}                40   0.001
YGR295C Chr7 complement(1081584..1082729) [1146 bp, 381 aa] {ON}...    40   0.001
ZYRO0A13816g Chr1 complement(1099212..1099886) [675 bp, 224 aa] ...    40   0.002
KAFR0H03780 Chr8 (718980..719699) [720 bp, 239 aa] {ON}                40   0.002
YDL248W Chr4 (1802..2953) [1152 bp, 383 aa] {ON}  COS7Protein of...    40   0.002
TDEL0D00660 Chr4 complement(115547..116641) [1095 bp, 364 aa] {O...    40   0.002
YAR031W Chr1 (186836..187732) [897 bp, 298 aa] {ON}  PRM9Pheromo...    40   0.002
Skud_13.8 Chr13 (8824..9525) [702 bp, 233 aa] {ON} YHL044W (REAL)      40   0.002
YGL051W Chr7 (403687..404391) [705 bp, 234 aa] {ON}  MST27Putati...    39   0.002
Smik_16.6 Chr16 (5125..5739) [615 bp, 204 aa] {ON} YGL263W (REAL)      39   0.003
KLTH0B10252g Chr2 (863070..863741) [672 bp, 223 aa] {ON} some si...    39   0.003
Skud_3.71 Chr3 complement(107662..108369) [708 bp, 235 aa] {ON} ...    39   0.003
ZYRO0E00330g Chr5 (16701..17774) [1074 bp, 357 aa] {ON} weakly s...    39   0.003
Skud_1.88 Chr1 (159215..159829) [615 bp, 204 aa] {ON} YGL053W (R...    39   0.004
Suva_8.398 Chr8 (714632..715528) [897 bp, 298 aa] {ON} YAR031W (...    39   0.004
KAFR0C00130 Chr3 complement(15602..16237) [636 bp, 211 aa] {ON}        38   0.007
Smik_1.90 Chr1 (160467..161183) [717 bp, 238 aa] {ON} YAR033W (R...    38   0.008
Skud_64.1 Chr64 (3..983) [981 bp, 327 aa] {ON}  YBR302C (REAL)         38   0.008
YKL219W Chr11 (14485..15708) [1224 bp, 407 aa] {ON}  COS9Protein...    38   0.008
YJR161C Chr10 complement(742848..743999) [1152 bp, 383 aa] {ON} ...    38   0.008
NDAI0G01470 Chr7 (324888..325607) [720 bp, 239 aa] {ON}                38   0.009
Smik_1.105 Chr1 (168370..168972) [603 bp, 200 aa] {ON}  YGL053W ...    38   0.009
KLTH0D00242g Chr4 complement(20418..21098) [681 bp, 226 aa] {ON}...    38   0.009
Skud_53.1 Chr53 complement(1..876) [876 bp, 292 aa] {ON}  YGR295...    38   0.010
KAFR0B03990 Chr2 complement(833771..834451) [681 bp, 226 aa] {ON}      37   0.011
NDAI0G02310 Chr7 complement(517385..518269) [885 bp, 294 aa] {ON}      38   0.011
Smik_4.183 Chr4 (337090..337404) [315 bp, 105 aa] {OFF} YAR023C ...    36   0.013
Skud_8.1 Chr8 (1116..2270) [1155 bp, 384 aa] {ON} YHL048W (REAL)       37   0.014
Skud_1.80 Chr1 (152939..152944,152948..153196,153443..153919) [7...    37   0.014
Suva_1.79 Chr1 complement(139959..140705) [747 bp, 248 aa] {ON} ...    37   0.014
Suva_3.29 Chr3 complement(39749..40108,40112..40258) [507 bp, 16...    37   0.016
Smik_9.244 Chr9 complement(403860..404315) [456 bp, 151 aa] {ON}...    36   0.019
Skud_66.1 Chr66 (3..554) [552 bp, 183 aa] {OFF} YKL219W (HSP)          35   0.045
YAR027W Chr1 (183770..184477) [708 bp, 235 aa] {ON}  UIP3Putativ...    35   0.053
YHL048W Chr8 (6401..7546) [1146 bp, 381 aa] {ON}  COS8Nuclear me...    35   0.062
YIR043C Chr9 complement(437043..437735) [693 bp, 230 aa] {OFF} P...    35   0.063
ZYRO0E00132g Chr5 (2603..3472) [870 bp, 289 aa] {ON} weakly simi...    35   0.095
NDAI0F04400 Chr6 (1077197..1077844) [648 bp, 215 aa] {ON}              35   0.10 
Suva_2.719 Chr2 complement(1263749..1263928,1263932..1264054) [3...    33   0.13 
YHL042W Chr8 (15667..16119) [453 bp, 150 aa] {ON} Putative prote...    33   0.14 
TDEL0A01180 Chr1 complement(200029..200700) [672 bp, 223 aa] {ON}      34   0.16 
TBLA0B05730 Chr2 (1355413..1356048) [636 bp, 211 aa] {ON}              34   0.19 
YHL043W Chr8 (14901..15413) [513 bp, 170 aa] {ON}  ECM34Putative...    33   0.23 
Suva_13.219 Chr13 (356145..356654) [510 bp, 169 aa] {ON} YCR007C...    33   0.23 
Suva_2.722 Chr2 complement(1264397..1264660,1264664..1264828) [4...    33   0.25 
NDAI0F04550 Chr6 complement(1105670..1106464) [795 bp, 264 aa] {...    33   0.28 
KLTH0C00264g Chr3 (12563..12979) [417 bp, 138 aa] {ON} some simi...    33   0.29 
Suva_9.16 Chr9 (16781..17056) [276 bp, 92 aa] {ON}  YNL336W (REAL)     32   0.33 
Skud_1.86 Chr1 (156935..157462) [528 bp, 175 aa] {ON} YAR028W (R...    33   0.36 
KLLA0A11957g Chr1 (1041208..1041834) [627 bp, 208 aa] {ON} conse...    33   0.42 
Skud_1.82 Chr1 (154805..155515) [711 bp, 236 aa] {ON} YAR027W (R...    33   0.48 
TDEL0D00130 Chr4 (14810..15271) [462 bp, 153 aa] {ON}                  32   0.63 
TDEL0H03830 Chr8 (646726..651474) [4749 bp, 1582 aa] {ON} Anc_7....    32   0.77 
KLTH0B10274g Chr2 (865279..865761) [483 bp, 160 aa] {ON} conserv...    32   0.78 
Smik_1.89 Chr1 (159430..160005) [576 bp, 191 aa] {ON} YAR027W (R...    32   0.94 
TDEL0A06970 Chr1 (1221638..1222240) [603 bp, 200 aa] {ON}              32   1.0  
ZYRO0D04158g Chr4 (336740..341503) [4764 bp, 1587 aa] {ON} simil...    32   1.4  
NCAS0A10610 Chr1 (2114082..2114984) [903 bp, 300 aa] {ON}              31   1.9  
Smik_13.228 Chr13 complement(361792..362511) [720 bp, 239 aa] {O...    30   2.3  
Suva_16.16 Chr16 (13822..14175,14179..14226) [402 bp, 134 aa] {O...    30   2.4  
TBLA0B10010 Chr2 (2398498..2399028) [531 bp, 176 aa] {ON}              30   2.7  
KLTH0B10230g Chr2 (861584..862198) [615 bp, 204 aa] {ON} some si...    30   3.1  
Smik_17.8 Chr17 complement(5956..6321) [366 bp, 122 aa] {OFF} YJ...    29   3.1  
Suva_16.527 Chr16 complement(912397..912444,912448..912603) [204...    28   4.3  
SAKL0H05522g Chr8 complement(496278..496697) [420 bp, 139 aa] {O...    29   5.6  
Kpol_1036.100 s1036 (259603..261150,261154..262107) [2502 bp, 83...    30   5.6  

>TBLA0E04360 Chr5 (1107926..1108534) [609 bp, 202 aa] {ON} 
          Length = 202

 Score =  369 bits (948), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 184/202 (91%), Positives = 184/202 (91%)

Query: 1   MSSLPDQTKSLLAPQXXXXXXXXXXXXXXXXXXYISYFSHQFWVLNEYLRFRICYYNLIF 60
           MSSLPDQTKSLLAPQ                  YISYFSHQFWVLNEYLRFRICYYNLIF
Sbjct: 1   MSSLPDQTKSLLAPQSSSDEEEKEELLELPKSKYISYFSHQFWVLNEYLRFRICYYNLIF 60

Query: 61  CSVIVLFSNDHKLWLPLTYVFIVLDIFYGWVILILLTAPIRKKYVLGVDGQLELMLLVID 120
           CSVIVLFSNDHKLWLPLTYVFIVLDIFYGWVILILLTAPIRKKYVLGVDGQLELMLLVID
Sbjct: 61  CSVIVLFSNDHKLWLPLTYVFIVLDIFYGWVILILLTAPIRKKYVLGVDGQLELMLLVID 120

Query: 121 NKPGLDLEKWDSITLQINSHLFNTHRWMNTDFIFDGKQCLQLFEYLIKPNKFIQLYVDPA 180
           NKPGLDLEKWDSITLQINSHLFNTHRWMNTDFIFDGKQCLQLFEYLIKPNKFIQLYVDPA
Sbjct: 121 NKPGLDLEKWDSITLQINSHLFNTHRWMNTDFIFDGKQCLQLFEYLIKPNKFIQLYVDPA 180

Query: 181 LINLNLQIEEARRCHYESLEIN 202
           LINLNLQIEEARRCHYESLEIN
Sbjct: 181 LINLNLQIEEARRCHYESLEIN 202

>TBLA0E04350 Chr5 (1106371..1107063) [693 bp, 230 aa] {ON} 
          Length = 230

 Score =  162 bits (410), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 81/162 (50%), Positives = 112/162 (69%), Gaps = 1/162 (0%)

Query: 40  HQFWVLNEYLRFRICYYNLIFCSVIVLFSNDHKLWLPLTYVFIVLDIFYGWVILILLTAP 99
           +QFW LNEY+ FR+ Y  ++ C  +V+FS D  LW  L Y+ I +D  YG  ++IL T+P
Sbjct: 58  YQFWFLNEYVSFRVFYCIMLACIGVVIFSQDSLLWKVLMYICISIDAIYGISLVILFTSP 117

Query: 100 IRKKYVLGVDGQLELMLLVIDNKPGLDLEKWDSITLQINSHLFNTHRWMNTDFIFDGKQC 159
           +RKK +LG+ GQ++LML VI+ KP L+++KWD I   +NSHL+  + W N DF +DGKQC
Sbjct: 118 LRKKKILGLQGQMKLMLEVIETKPILEMKKWDLIASNLNSHLYIMNNWRNNDFFYDGKQC 177

Query: 160 LQLFEYLIKPNKFIQL-YVDPALINLNLQIEEARRCHYESLE 200
           L LF +LI+PN  IQ+  VD  L NLN  IE AR+ H ES++
Sbjct: 178 LNLFRFLIQPNIMIQIGVVDLELNNLNKAIEHARKVHTESID 219

>TBLA0E01640 Chr5 (395468..396157) [690 bp, 229 aa] {ON} 
          Length = 229

 Score = 78.2 bits (191), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 47/158 (29%), Positives = 88/158 (55%), Gaps = 2/158 (1%)

Query: 45  LNEYLRFRICYYNLIFCSVIVLFSNDHKLWLPLTYVFIVLDIFYGWVILILLTAPIRKKY 104
           LN+   FR  Y  LI   ++  +++  +L +   ++   + +F G +I  LL +  R KY
Sbjct: 41  LNKSWIFRAIYITLISLLLLSWWTDSDELKVLYGFLLFFVAVF-GSLISALLLSINRMKY 99

Query: 105 VLGVDGQLELMLLVIDNKPGLDLEKWDSITLQINSHLFNTHRWMNTDFIFDGKQCLQLFE 164
           ++G +GQ++L+  V   KP L +EKWD I   +N +L+  + + + +F ++GKQC+ LF+
Sbjct: 100 LMGTEGQMKLLAEVTKYKPSLYIEKWDLIASHLNDYLYEMNAFPDREFFYNGKQCMHLFQ 159

Query: 165 YLIKPNKFI-QLYVDPALINLNLQIEEARRCHYESLEI 201
            ++  N  +     DP + N    +E AR  H +S+++
Sbjct: 160 GIVSTNNTLPNGSTDPEVQNFGKYLELAREVHKDSIDL 197

>SAKL0H20614g Chr8 (1809584..1810294) [711 bp, 236 aa] {ON} some
           similarities with uniprot|P38723 Saccharomyces
           cerevisiae YHL048W COS8 Nuclear membrane protein member
           of a family of conserved often subtelomerically-encoded
           proteins regulation suggests a potential role in the
           unfolded protein response
          Length = 236

 Score = 63.2 bits (152), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 37/104 (35%), Positives = 60/104 (57%), Gaps = 15/104 (14%)

Query: 83  VLDIFYGWV-----------ILILLTAPI--RKKYVLGVDGQLELMLLVIDNKPGLDLEK 129
           VL  FYG +           ILIL +A I       LG+ GQ+E ++ V   +PGLD+ +
Sbjct: 56  VLATFYGGIEGFGLCLIPTLILILFSALIVLTTSSSLGLKGQMEFLVQVTTLRPGLDISR 115

Query: 130 WDSITLQINSHLFNTHRWMNTD-FIFDGKQCLQLF-EYLIKPNK 171
           WD I  ++N ++ NT +W++ + F FDG++C + F E+ I P++
Sbjct: 116 WDIIANRMNEYMLNTGKWLSENYFFFDGEECFKYFREWCILPSQ 159

>YNR075W Chr14 (779916..781040) [1125 bp, 374 aa] {ON}  COS10Protein
           of unknown function, member of the DUP380 subfamily of
           conserved, often subtelomerically-encoded proteins
          Length = 374

 Score = 58.2 bits (139), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 36/103 (34%), Positives = 53/103 (51%), Gaps = 5/103 (4%)

Query: 100 IRKKYVLGVDGQLELMLLVIDNKPGLDLEKWDSITLQINSHLFNTHRWMNTDFIFDGKQC 159
           IR K  + VD +++ +  +I N+ G   EKWD+I  + N+ LF    W N +F FDG  C
Sbjct: 273 IRPK-SMKVDDKMQYLSDII-NEQGASPEKWDTIARKTNTRLFEKRVWKNEEFFFDGTDC 330

Query: 160 LQLFEYLIKPNKFIQLYVDPALINLNL--QIEEAR-RCHYESL 199
              FE       F +    P  +N+ L   I+EA+  C+YE L
Sbjct: 331 QAFFERNFSSLLFSKKSASPRSLNVELWKYIQEAQLSCNYEPL 373

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 36/126 (28%), Positives = 57/126 (45%), Gaps = 21/126 (16%)

Query: 77  LTYVFIVLDIFYGWVILILLTAPIR-KKYVLGVDGQLELMLLVIDNKPGLDLEKWDSITL 135
           LT V ++L +     I IL    I+  KY L  +   +L   +I + PG     WD++ +
Sbjct: 67  LTSVVLILAL-----IAILPVVQIQYSKYTLS-NQLTQLSKEIIKSAPGAYSADWDAVAI 120

Query: 136 QINSHLFNTHRWMNTDFIFDGKQCLQLFEYLIKPNKFIQLYVDPALINLNLQIEEARRCH 195
             NS+L+    W    F F+G  C + F   I         ++PA+  L  Q E+ R   
Sbjct: 121 HFNSYLYENKAWKTAHFFFNGTDCQEAFRKTI---------LEPAV--LRRQNEDPR--- 166

Query: 196 YESLEI 201
           + S+EI
Sbjct: 167 FSSIEI 172

>SAKL0D01254g Chr4 (95413..96000) [588 bp, 195 aa] {ON} some
           similarities with uniprot|Q07788 Saccharomyces
           cerevisiae YDL248W COS7 Protein of unknown function
           member of a family of conserved often
           subtelomerically-encoded proteins
          Length = 195

 Score = 55.1 bits (131), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 50/102 (49%), Gaps = 3/102 (2%)

Query: 93  LILLTAPIRKKYVLGVDGQLELMLLVIDNKPGLDLEKWDSITLQINSHLFNTHRWMNTDF 152
           L+ +  P +K+  L V  +   +  VI+ KP  D+EKWD I   +N HL+    W   D+
Sbjct: 80  LVFIEYPEKKEKRLEVTQRTRFLTNVIEAKPFTDMEKWDIIAYNMNKHLYLGGDWPRNDY 139

Query: 153 IFDGKQCLQLFEYL-IKPNKFIQLYVD--PALINLNLQIEEA 191
            +DG+ C   F+ L I P+   Q   +   A   L   IEEA
Sbjct: 140 FYDGENCRDTFKKLFIDPHSGKQSKNENTNAYTELEPYIEEA 181

>Kwal_26.7243 s26 (278708..279808) [1101 bp, 366 aa] {ON} YNL336W
           (COS1) - similar to subtelomerically-encoded proteins
           [contig 47] FULL
          Length = 366

 Score = 55.8 bits (133), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 43/151 (28%), Positives = 68/151 (45%), Gaps = 18/151 (11%)

Query: 43  WVLNEYLRFRICYYN-LIFCSVIVLFSNDHKLWLPLTYVFIVLDIFYGWVILILLTAPIR 101
           W L++  +  +CY   L+FC   V   N     +P+  +F  L +     +L +L   + 
Sbjct: 20  WALHQQFKIPVCYVIWLLFCGFTVWLRN-----MPVV-IFFCLGL-----LLDMLMKCVH 68

Query: 102 KKYVLGVDGQLELMLL-VIDNKPGLDLEKWDSITLQINSHLFNTHRWMNTDFIFDGKQCL 160
                 V   L+++   VI+ +PG DL KWD +   IN  L+ +  W +   +FDGK C 
Sbjct: 69  SASKRAVFQHLDVLCEEVIEVQPGADLRKWDVVAAHINERLYKSGVWHSPYCVFDGKSCY 128

Query: 161 QLFEYLIKPNKFIQLYVDPALINLNLQIEEA 191
            +F  L+    F Q   D      N Q+ EA
Sbjct: 129 SIFRLLVL-TPFYQGKCD----KQNTQLAEA 154

 Score = 36.2 bits (82), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 19/78 (24%), Positives = 35/78 (44%), Gaps = 2/78 (2%)

Query: 114 LMLLVIDNKPGLDLEKWDSITLQINSHLFNTHRWMNTDFIFDGKQCLQLFEYLIKPNKFI 173
           ++ ++++ KP  D   WD +    N++L +       +F +DGK C   F  L   + F+
Sbjct: 273 ILAIIVEVKPKPDTSGWDDVARHCNAYLRDEKVRAIPEFFYDGKDCFWYFNRLY--SSFL 330

Query: 174 QLYVDPALINLNLQIEEA 191
                 +L      +EEA
Sbjct: 331 PKPCRVSLDEFKPYVEEA 348

>SAKL0D15312g Chr4 (1275517..1276116) [600 bp, 199 aa] {ON} some
           similarities with uniprot|P53344 Saccharomyces
           cerevisiae YGR295C COS6 Protein of unknown function
           member of a family of conserved often
           subtelomerically-encoded proteins
          Length = 199

 Score = 50.4 bits (119), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 36/142 (25%), Positives = 64/142 (45%), Gaps = 14/142 (9%)

Query: 40  HQFWVLNEYLRFRICYYNLIFCSVIVLFSNDHKLWLPLTYVFIVLDIFYGWVILILLTAP 99
           H F     +L+    +Y + + S +  F     +   +T + IV++   GW   +  T  
Sbjct: 36  HVFMKKQTFLKLPALFYGIYYFSNV--FDEIFAMCYRITLISIVIN---GWYSGMQAT-- 88

Query: 100 IRKKYVLGVDGQLELMLLVIDNKPGLDLEKWDSITLQINSHLFNTHRWMNTDFIFDGKQC 159
             K   L ++ +++ +  VI  +P +D+ KWD I   +N   +    W   +F FDGK C
Sbjct: 89  --KNLSLNLERRMDFLAEVIKVQPHIDMGKWDIIAANMNEFFYTKGTWHTEEFFFDGKHC 146

Query: 160 LQLFEYLIKPNKFIQLYVDPAL 181
             +F+ L     F+  Y + AL
Sbjct: 147 HNVFKLL-----FVAPYSEKAL 163

>Suva_14.7 Chr14 (7591..8013) [423 bp, 140 aa] {ON} YJR161C (REAL)
          Length = 140

 Score = 49.3 bits (116), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 43/95 (45%), Gaps = 17/95 (17%)

Query: 73  LWLPLTYVFIVLDIFYGWVILILLTAPIRKKYVLGVDGQLELMLLVIDNKPGLDLEKWDS 132
           LWL  T  F+          +I     + K+Y L            I++ PG + E+W++
Sbjct: 3   LWLSFTPFFL----------MICRERAVSKQYTL-------FRKETIESAPGTETEEWEA 45

Query: 133 ITLQINSHLFNTHRWMNTDFIFDGKQCLQLFEYLI 167
           I + +NS+++    W N  F FDG+ C Q F   I
Sbjct: 46  IVINLNSYMYENKLWNNRYFFFDGRSCQQSFRLCI 80

>ZYRO0B00154g Chr2 (3082..4164) [1083 bp, 360 aa] {ON} weakly
           similar to uniprot|P47187 Saccharomyces cerevisiae
           YJR161C COS5 Protein of unknown function member of a
           family of conserved often subtelomerically-encoded
           proteins
          Length = 360

 Score = 50.4 bits (119), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 52/88 (59%), Gaps = 6/88 (6%)

Query: 113 ELMLLVIDNKPGLDLEKWDSITLQINSHLFNTHRWMNTDFIFDGKQCLQLFEYLIKPNKF 172
           EL+  V+++ PG+D+EKWD I  ++NS  +  H W    F +DG Q LQL   L K N  
Sbjct: 93  ELVQQVLESNPGVDIEKWDEIANRLNSSFYQEHFWNTPYFFYDG-QGLQL---LFKAN-V 147

Query: 173 IQLYVDPALINL-NLQIEEARRCHYESL 199
           ++ Y++  L ++ +    ++ RC+ +SL
Sbjct: 148 LRPYLEGKLDDITDTDKTQSARCYLQSL 175

 Score = 37.0 bits (84), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 17/62 (27%), Positives = 33/62 (53%), Gaps = 1/62 (1%)

Query: 112 LELMLLVIDNKPGLDLEKWDSITLQINSHLFNTHR-WMNTDFIFDGKQCLQLFEYLIKPN 170
           ++ + ++    PG +L+KWD I+  +N +L    +  +  +  FDGK CL  ++   +P 
Sbjct: 272 MKCLAIIAKVNPGKELDKWDQISKYMNQYLTEEEKNGLFKNRFFDGKHCLDFYKTCFEPL 331

Query: 171 KF 172
            F
Sbjct: 332 SF 333

>KNAG0C05530 Chr3 complement(1073752..1074441) [690 bp, 229 aa] {ON}
           
          Length = 229

 Score = 49.7 bits (117), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 28/117 (23%), Positives = 62/117 (52%), Gaps = 8/117 (6%)

Query: 58  LIFCSVIVLFSNDHKLWLPLTYVFIVLDIFYGWVILILLTAPIRKKYVLGV-DGQLELML 116
           ++F +  VL   D + ++   ++ I+  +  G V +++     R  Y++ V +   +++ 
Sbjct: 48  VLFLTSTVLMVQDTREYVLSAFMIIICAV--GAVAIVVFI--FRYHYLIRVFNSNTKILF 103

Query: 117 L--VIDNKPGLDLEKWDSITLQINSHLFNTHRWMNTDFIFDGKQCLQLFE-YLIKPN 170
           L  V+ ++P LD E W++I  ++N   ++T  W    + +DG+ CL+ F  ++I P 
Sbjct: 104 LGEVVKHRPSLDPESWNAIADRMNQQFYSTEEWSTPYYFYDGQSCLEFFRSFVIGPK 160

>ZYRO0C00242g Chr3 (8037..9107) [1071 bp, 356 aa] {ON} weakly
           similar to uniprot|P43542 Saccharomyces cerevisiae
           YFL062W COS4 Protein of unknown function member of a
           family of conserved often subtelomerically-encoded
           proteins
          Length = 356

 Score = 49.3 bits (116), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 27/73 (36%), Positives = 39/73 (53%), Gaps = 1/73 (1%)

Query: 90  WVILILLTAPIRKKYVLGVDGQLELMLLVIDNKPGLDLEKWDSITLQINSHLFNTHRWMN 149
           W++ +LL         L      EL+  V+++ PGLD+EKWD I  ++NS  +  H W  
Sbjct: 67  WMLALLLPFSWLHNSKLHPKNMTELVQQVLESNPGLDIEKWDEIANRLNSSFYQEHFWNT 126

Query: 150 TDFIFDGKQCLQL 162
             F +DG Q LQL
Sbjct: 127 PYFFYDG-QGLQL 138

 Score = 37.7 bits (86), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 24/97 (24%), Positives = 47/97 (48%), Gaps = 2/97 (2%)

Query: 78  TYVFIVLDIFYGWVILILLTAPIRKKYV-LGVDGQLELMLLVIDNKPGLDLEKWDSITLQ 136
           T   +++ ++Y ++ LI   +  R  Y  + +   ++ + ++    PG +L KWD I   
Sbjct: 234 TLFALIMIMYYQYMSLICYWSLYRFMYPQMDIIQAMKCLAIIAKVNPGKELAKWDQIARY 293

Query: 137 INSHLFNTHR-WMNTDFIFDGKQCLQLFEYLIKPNKF 172
           +N +L    +  +  +  FDGK CL  +E   +P  F
Sbjct: 294 MNQYLAEEEKNGLFKNRFFDGKHCLDFYETCFEPLSF 330

>Skud_3.88 Chr3 (133816..134520) [705 bp, 234 aa] {ON} YCR007C
           (REAL)
          Length = 234

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 40/137 (29%), Positives = 65/137 (47%), Gaps = 8/137 (5%)

Query: 36  SYFSHQFWVLNEYLRFRICYYNLIFCS-VIVLFSNDHKLWLPLTYVFIVLDIFYGWVILI 94
           SY  + F+ +  Y    +C+  L+     IVLF   H + L    VF +L +F+   + +
Sbjct: 36  SYLYYVFYEMAHYRPTIVCFLALVISILTIVLF---HNIVL-CNVVFGLLILFFSISMFV 91

Query: 95  LLTAPIRKKYVLGVDGQLELMLLVIDNKPGLDLEKWDSITLQINSHLFNTHRWMNTDFIF 154
           L T   R   V   + +++L+L VI  KP +  ++W  IT  +N +LF+   W    + +
Sbjct: 92  LGTFTDR---VSDEEFEIKLLLEVITRKPAVKGKEWRIITYNMNQYLFDNELWNTPYYFY 148

Query: 155 DGKQCLQLFEYLIKPNK 171
             K C   F  LIK  K
Sbjct: 149 SDKSCYGFFRRLIKGKK 165

>KLTH0D00374g Chr4 complement(33818..34939) [1122 bp, 373 aa] {ON}
           weakly similar to uniprot|P53344 Saccharomyces
           cerevisiae YGR295C COS6 Protein of unknown function
           member of a family of conserved often
           subtelomerically-encoded proteins
          Length = 373

 Score = 49.3 bits (116), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 37/134 (27%), Positives = 64/134 (47%), Gaps = 16/134 (11%)

Query: 37  YFSHQFWVLNEYLRFRICYYNLIFCSV---IVLFSNDHKLWLPLTYVFIVLDIFYGWVIL 93
           Y S   W L++ +R  + Y  L+  S+   IV FS  +KL       +I + +F   ++ 
Sbjct: 21  YKSSLRWALDQLMRMPLFY--LLLSSIVIDIVWFSIGNKL----HSFWIHVPVFSSLLLQ 74

Query: 94  ILLTAPIRKKYVLGVDGQLELMLLVIDNKPGLDLEKWDSITLQINSHLFNTHRWMNTDFI 153
           I +T  I        +    L  +VI+  PG+  E+WD    ++NSH +    W N+  +
Sbjct: 75  IKVTKAIS-------NSIQRLCEIVIEEGPGMQEEQWDIAAARMNSHFYEQGLWPNSCCL 127

Query: 154 FDGKQCLQLFEYLI 167
           + G+QC   F +L+
Sbjct: 128 YSGRQCHAAFRHLV 141

>NCAS0H00970 Chr8 complement(180888..181661) [774 bp, 257 aa] {ON} 
          Length = 257

 Score = 48.5 bits (114), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 19/79 (24%), Positives = 37/79 (46%)

Query: 101 RKKYVLGVDGQLELMLLVIDNKPGLDLEKWDSITLQINSHLFNTHRWMNTDFIFDGKQCL 160
           R + + G   +++  L +I  KP    + WD I   +N++ +    W N +F + GK+C 
Sbjct: 97  RTETITGTQAKMKFFLEIIQYKPNATSKSWDVIAAHMNTYFYREGHWANENFFYSGKECY 156

Query: 161 QLFEYLIKPNKFIQLYVDP 179
             F  L    +++ +   P
Sbjct: 157 NWFMELTTKVEYVPIEQPP 175

>Smik_3.91 Chr3 (124341..125060) [720 bp, 239 aa] {ON} YCR007C
           (REAL)
          Length = 239

 Score = 48.1 bits (113), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 42/146 (28%), Positives = 71/146 (48%), Gaps = 20/146 (13%)

Query: 48  YLRFRICYYN-------LIFCSV--IVLFSNDHKLWLPLTYVFIVLDIFYGWVILILLTA 98
           YL + + +Y        LI  SV  IVLF N     +P   V   L IF   ++LI+  +
Sbjct: 44  YLLYEMAHYKPISFSFVLILVSVLIIVLFHN-----VPACNVVFGLTIFITIMVLIIALS 98

Query: 99  PIRKKYVLGVDG-QLELMLLVIDNKPGLDLEKWDSITLQINSHLFNTHRWMNTDFIFDGK 157
                  +  +G +++L+L VI  KP ++ ++W  IT  +N +LF+   W    F +  +
Sbjct: 99  IFSMD--ISEEGFKIKLLLEVITRKPEVEGKEWRIITHNMNQYLFDNGLWNTQSFFYCEE 156

Query: 158 QCLQLFEYLIK---PNKFIQLYVDPA 180
           +C +LF  L++   PN ++    D A
Sbjct: 157 KCYKLFRSLVRGKDPNAYVNSSTDGA 182

>Kwal_26.7673 s26 complement(466671..467774) [1104 bp, 367 aa] {ON}
           YNL336W (COS1) - similar to subtelomerically-encoded
           proteins [contig 55] FULL
          Length = 367

 Score = 48.5 bits (114), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 34/62 (54%), Gaps = 1/62 (1%)

Query: 107 GVDGQLELMLL-VIDNKPGLDLEKWDSITLQINSHLFNTHRWMNTDFIFDGKQCLQLFEY 165
            V   LE++   VI  +PG +L KWD +   IN  L+ +  W N   I+DG+ C+ LF  
Sbjct: 73  AVTQHLEVLCEEVIKIQPGANLSKWDVVAAHINERLYRSGAWYNPYCIYDGEYCISLFRL 132

Query: 166 LI 167
           L+
Sbjct: 133 LV 134

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/78 (25%), Positives = 36/78 (46%)

Query: 114 LMLLVIDNKPGLDLEKWDSITLQINSHLFNTHRWMNTDFIFDGKQCLQLFEYLIKPNKFI 173
           L+ ++++ KP  D   WD++  Q N++L     W   +F +DG  CL  F   +  +   
Sbjct: 272 LLAIIVEVKPKTDTMAWDNVAKQFNAYLQREKVWPTPEFFYDGNDCLWAFNKFVSSDTNA 331

Query: 174 QLYVDPALINLNLQIEEA 191
              +  +   L   I+EA
Sbjct: 332 PYPLHGSFNELKPYIKEA 349

>Suva_12.273 Chr12 complement(443438..444577) [1140 bp, 379 aa] {ON}
           YFL062W (REAL)
          Length = 379

 Score = 48.5 bits (114), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 29/50 (58%)

Query: 118 VIDNKPGLDLEKWDSITLQINSHLFNTHRWMNTDFIFDGKQCLQLFEYLI 167
           +I + PG D E W+SI +++NS+++    W N  F FDG  C Q F   I
Sbjct: 109 IIKSAPGTDTEDWESIVIKLNSYMYENKIWNNKYFFFDGWSCQQSFRICI 158

 Score = 42.7 bits (99), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 42/85 (49%), Gaps = 3/85 (3%)

Query: 82  IVLDIFYGWVILILLTAPIRKKYV--LGVDGQLELMLLVIDNKPGLDLEKWDSITLQINS 139
           I   + Y     +LLT   +   V  + ++ +++ +L VI  +  +D   WD I  ++N 
Sbjct: 257 IFFRVLYLSSTFLLLTKNFQNSRVALMKIEDKMQYILTVISEQK-IDANGWDQIAKKMNV 315

Query: 140 HLFNTHRWMNTDFIFDGKQCLQLFE 164
           +LF    + N +F FDG  C + FE
Sbjct: 316 YLFEEKVYKNIEFFFDGSDCKRFFE 340

>Kwal_27.10096 s27 (192352..193374) [1023 bp, 340 aa] {ON} YNL336W
           (COS1) - similar to subtelomerically-encoded proteins
           [contig 42] FULL
          Length = 340

 Score = 48.5 bits (114), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 38/113 (33%), Positives = 60/113 (53%), Gaps = 13/113 (11%)

Query: 77  LTYVFIVLDIFYGWV-ILILLTAPIRKKYVLGVDGQLE-----LMLLVIDNKPGLDLEKW 130
           +T V I    F G V +L++L       Y+ G    L+     L   VID +PG D  KW
Sbjct: 37  ITCVVIKFSRFEGSVSVLVILVG----SYLAGARRALKKNIEKLCNEVIDQRPGADTLKW 92

Query: 131 DSITLQINSHLFNTHRWMNTDFIFDGKQCLQLF-EYLIKPN--KFIQLYVDPA 180
           + IT ++N  L++   + N   IFDG+ C +LF E +++P+  K  +LY++ A
Sbjct: 93  NLITQRLNGLLYDEGLYNNPYCIFDGEHCQELFRELVLEPSLQKSDKLYLETA 145

 Score = 38.1 bits (87), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 24/129 (18%), Positives = 60/129 (46%), Gaps = 9/129 (6%)

Query: 36  SYFSHQFWVLNEYLRFRICYYNLIFCSVIVLFSNDHKLWLPLTYVFIVLDIFYGWVILIL 95
           ++++  FW +  +L F +       C ++ +     +  L +T   + L + Y +V+L  
Sbjct: 187 THYNEVFWSMCRFLSFTL-QPPYCLCPLVAI-----RPKLSVTRNSLALIVVYLFVVLSY 240

Query: 96  LTAPIRKKYVLGVDGQLELMLLVIDNKPGLDLEKWDSITLQINSHLFNTHRWMNTDFIFD 155
               I +   + ++ +L  +  V   +P   +E W+ +  ++N +++    W + +F  D
Sbjct: 241 RRIKIEE---MKIEARLTFLKTVSLVRPHAQVEGWNVVAKRMNKYMYEEKGWHSKEFFHD 297

Query: 156 GKQCLQLFE 164
           G+ C + F+
Sbjct: 298 GEDCSRYFK 306

>Suva_1.100 Chr1 (165459..166430) [972 bp, 323 aa] {ON} YCR007C
           (REAL)
          Length = 323

 Score = 48.5 bits (114), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 38/163 (23%), Positives = 71/163 (43%), Gaps = 16/163 (9%)

Query: 47  EYLRFRICYYNLIFCSVIV---------LFSNDHKLWLPLTYVFIVLDIFYGWVILILLT 97
            YL + I +Y L   S+++         +F  D  +++ +  V   LD+F+    LI   
Sbjct: 116 SYLLYEIAHYTLTMISLMIPVVSVLLALIFHYD-AVYV-VASVLCFLDLFFSIFALIYFN 173

Query: 98  APIRKKYVLGVDGQLELMLLVIDNKPGLDLEKWDSITLQINSHLFNTHRWMNTDFIFDGK 157
             I  +       + +L+L VI  KP L  E+W +IT   N +LF    W    + +  K
Sbjct: 174 ESISDRGF-----KTKLLLEVIARKPALKGEEWRTITYNTNQYLFENDLWNTPYYFYSDK 228

Query: 158 QCLQLFEYLIKPNKFIQLYVDPALINLNLQIEEARRCHYESLE 200
           +C   F+ L++  + +   V P+  + N  + +      ++ E
Sbjct: 229 KCHSFFQDLVETGRRVAAPVGPSTNDNNNTLSDPSTNGTDNTE 271

>KLLA0C19063g Chr3 complement(1692492..1693121) [630 bp, 209 aa]
           {ON} conserved hypothetical protein
          Length = 209

 Score = 47.8 bits (112), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 40/74 (54%), Gaps = 3/74 (4%)

Query: 120 DNKPG-LDLEKWDSITLQINSHLFNTHRWMNTDFIFDGKQCLQLFEYLIKP--NKFIQLY 176
           D KP  +D+++WD +   +N HL+    W N  F +DGK+C  +F  L+K   +  +  Y
Sbjct: 126 DFKPSYIDMKQWDIVARVVNKHLYEAGSWPNNRFFYDGKRCQAMFIALVKKPTDPLLDDY 185

Query: 177 VDPALINLNLQIEE 190
           +  A   L + ++E
Sbjct: 186 ISKANETLKISMDE 199

>Skud_19.5 Chr19 (3036..3746) [711 bp, 236 aa] {ON} YHL044W (REAL)
          Length = 236

 Score = 47.8 bits (112), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 34/141 (24%), Positives = 62/141 (43%), Gaps = 17/141 (12%)

Query: 67  FSNDHKLWLPLTYVFIVLDIFYGWVILILL---TAPIRKKYVLGVDGQLELMLLVIDNKP 123
           F  D  +     + F++L +    V LI+L   T+   K   L  + +++L++ VI  KP
Sbjct: 65  FRTDDDVVTFFGFFFMILGLASFLVFLIVLHGNTSAKCKLNALSDECKIKLLVEVITRKP 124

Query: 124 GLDLEKWDSITLQINSHLFNTHRWMNTDFIFDGKQCLQLFE------YLIKPNKFIQLYV 177
            +D+E WD I   +N + ++   + +    +DG  C ++F       Y   PN       
Sbjct: 125 NVDMETWDPIACSMNQYAYDRGTYPDKSLFYDGNICYRVFRELAIVPYCENPNG------ 178

Query: 178 DPALINLNLQIEEARRCHYES 198
                N +L +E  +R  Y +
Sbjct: 179 --NCANTDLGVENNQRTKYAN 197

>TDEL0B03200 Chr2 (564384..565469) [1086 bp, 361 aa] {ON} 
          Length = 361

 Score = 48.1 bits (113), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 40/80 (50%), Gaps = 3/80 (3%)

Query: 93  LILLTAPIRKKYVL---GVDGQLELMLLVIDNKPGLDLEKWDSITLQINSHLFNTHRWMN 149
           +IL+ A I   Y L     + ++ L+  + +  PG D  +WD +  +IN+++        
Sbjct: 254 VILMLAVISTGYSLRLSTTENRIRLLATIANVAPGEDTNRWDVVAKRINAYMNEDSNVTG 313

Query: 150 TDFIFDGKQCLQLFEYLIKP 169
               FDGK CL+ FE  +KP
Sbjct: 314 VQRFFDGKDCLRFFEKELKP 333

 Score = 34.3 bits (77), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 14/42 (33%), Positives = 20/42 (47%), Gaps = 1/42 (2%)

Query: 130 WDSITLQINSHLFNTHRWMNTDFIFDGKQCLQLF-EYLIKPN 170
           WD +  Q+N   +    W     IFDG +C   F  Y++KP 
Sbjct: 122 WDKVASQLNRKYYTEGDWKTPHCIFDGAECESYFRRYVLKPT 163

>YGL263W Chr7 (2790..3932) [1143 bp, 380 aa] {ON}  COS12Protein of
           unknown function, member of the DUP380 subfamily of
           conserved, often subtelomerically-encoded proteins
          Length = 380

 Score = 47.8 bits (112), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 38/148 (25%), Positives = 61/148 (41%), Gaps = 27/148 (18%)

Query: 73  LWLPLT----------YVFIVLDIFYGWVILILLTAPIRKKYVLGVDGQLELMLLVIDNK 122
           +WLPL           Y+ IV  + +  +  +   + I ++  LG     +    +I N 
Sbjct: 53  MWLPLIIAWKIRGKRHYLVIVTALMFEVLYFLWTYSYIFRERTLGKQVS-QFAKEIITNT 111

Query: 123 PGLDLEKWDSITLQINSHLFNTHRWMNTDFIFDGKQCLQLFE------YLIKPNKFIQL- 175
           PG+D E W+ + +  NS+L+    W    F FDG  C + F       + +K N F    
Sbjct: 112 PGIDTEDWERVAVNFNSYLYENKLWNTEYFFFDGSSCQEAFRKMLLEPFSLKKNDFANAK 171

Query: 176 -------YVDPALINLNLQIEEARRCHY 196
                  Y + AL     QIE  R+ H+
Sbjct: 172 VPDGSVCYTEKALQVYFTQIE--RKWHW 197

>SAKL0H20636g Chr8 (1810817..1811494) [678 bp, 225 aa] {ON} weakly
           similar to uniprot|P25354 Saccharomyces cerevisiae
           YCR007C Putative integral membrane protein member of
           DUP240 gene family
          Length = 225

 Score = 47.4 bits (111), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 38/66 (57%), Gaps = 4/66 (6%)

Query: 106 LGVD--GQLELMLLVIDNKPGLDLEKWDSITLQINSHLFNTHRWMNTDFIFDGKQCLQLF 163
           +G+D  G+  L++ +   +P LD+ KWD I   IN+ +    +W +  + ++G++C   F
Sbjct: 92  IGLDLQGRARLLVEITVTRPALDMSKWDIIAADINNFMLKKGKWSSKQYFYNGEECFDFF 151

Query: 164 E--YLI 167
           +  YLI
Sbjct: 152 KKGYLI 157

>ZYRO0D00352g Chr4 (26055..27125) [1071 bp, 356 aa] {ON} weakly
           similar to uniprot|P43542 Saccharomyces cerevisiae
           YFL062W COS4 Protein of unknown function member of a
           family of conserved often subtelomerically-encoded
           proteins
          Length = 356

 Score = 47.8 bits (112), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 29/104 (27%), Positives = 50/104 (48%), Gaps = 9/104 (8%)

Query: 67  FSNDHKLWLPLTYVFIVLDIFYGWVILILLTAPIRKKYVLGVDGQLELMLLVIDNKPGLD 126
           F+N +K+ L + +    + I+ G  ++        K   LGV  +++ +   + + PG D
Sbjct: 229 FTNINKVGLFVFFCVTFVSIYKGRGMV--------KYKALGVLHRIKFLATAMQHAPGND 280

Query: 127 LEKWDSITLQINSHLFNTHRWMN-TDFIFDGKQCLQLFEYLIKP 169
           LEKWD I   +N +L     W    +  FDGK+CL  +    +P
Sbjct: 281 LEKWDHIARHMNYYLHEKGVWRRPEENFFDGKECLDFYRSQFEP 324

 Score = 29.6 bits (65), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 15/56 (26%), Positives = 27/56 (48%), Gaps = 2/56 (3%)

Query: 112 LELMLLVIDNKPGLDLEKWDSITLQINSHLFNTHRWMNTDFIFDGKQCLQLFEYLI 167
           L   +L +D  PG+D  KWD +T ++N  L++        + F+   C  +  + I
Sbjct: 100 LRDTVLAVD--PGVDARKWDIVTSKVNYVLYDNGYRRTPYYFFNRSHCWSVSHHYI 153

>SAKL0D15290g Chr4 (1274588..1275202) [615 bp, 204 aa] {ON} some
           similarities with uniprot|P43542 Saccharomyces
           cerevisiae YFL062W COS4 Protein of unknown function
           member of a family of conserved often
           subtelomerically-encoded proteins
          Length = 204

 Score = 46.6 bits (109), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 40/159 (25%), Positives = 66/159 (41%), Gaps = 27/159 (16%)

Query: 65  VLFSNDHKLWLPLTYVFIVL--DIFYGWVI-----LILLTAPIRKKYVLGVDGQLELMLL 117
           VL S   KLW   + +  VL       WV+     L L+T+     + + + G+ +L  L
Sbjct: 37  VLKSGVFKLWSAFSIIMGVLCWKTHNFWVVFFSLELFLITSIFIPSFAMYIAGRFKLREL 96

Query: 118 V------IDNKPGLDLEKWDSITLQINSHLFNTHRWMNTDFIFDGKQCLQLFEYLI---- 167
           V       + KPG D+E+WD +   +N  +     W      +DG+ C Q F  LI    
Sbjct: 97  VKFSEEVAEVKPGTDMERWDIVASNMNEFMQAEKLWSILHSFYDGQHCFQQFRRLILHPY 156

Query: 168 ----------KPNKFIQLYVDPALINLNLQIEEARRCHY 196
                     K N  ++ Y + A+ +    I++  + HY
Sbjct: 157 SEHTSKKMKAKQNADLKPYAEEAVRSYQASIDQYWQHHY 195

>YHL044W Chr8 (13565..14272) [708 bp, 235 aa] {ON} Putative integral
           membrane protein, member of DUP240 gene family; green
           fluorescent protein (GFP)-fusion protein localizes to
           the plasma membrane in a punctate pattern
          Length = 235

 Score = 47.0 bits (110), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 40/83 (48%), Gaps = 9/83 (10%)

Query: 105 VLGVDGQLELMLLVIDNKPGLDLEKWDSITLQINSHLFNTHRWMNTDFIFDGKQCLQLFE 164
            L  D + +L+  VI +KP +DL  WD I   +N  +++     +  F +DG  C Q+F+
Sbjct: 104 CLDDDCKFKLLAEVITHKPNMDLSTWDRIAYDMNQFVYDRRICADRSFFYDGSYCYQVFK 163

Query: 165 YLIKPNKFIQLYVDPALINLNLQ 187
            L+           P L+N N+ 
Sbjct: 164 KLV---------ATPYLVNSNMN 177

>SAKL0C10956g Chr3 (990412..990927) [516 bp, 171 aa] {ON} some
           similarities with uniprot|P53822 Saccharomyces
           cerevisiae YNL336W COS1 Protein of unknown function
           member of a family of conserved often
           subtelomerically-encoded proteins
          Length = 171

 Score = 46.2 bits (108), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 23/90 (25%), Positives = 47/90 (52%), Gaps = 2/90 (2%)

Query: 77  LTYVFIVLDIFYGWVILILLT--APIRKKYVLGVDGQLELMLLVIDNKPGLDLEKWDSIT 134
           L  + +V  I + + + I+ T  + I      G++ +   ++ + D  PG+++ KWD + 
Sbjct: 60  LAALSVVTGILFAFSLPIIATQVSGICVSRGFGLEQKTRFLVEIRDINPGMNMPKWDIVA 119

Query: 135 LQINSHLFNTHRWMNTDFIFDGKQCLQLFE 164
            ++N +LF    + N   ++DGK CL  F+
Sbjct: 120 SRMNDYLFEAKYYRNKYALYDGKSCLDGFK 149

>ZYRO0D00242g Chr4 (12246..13301) [1056 bp, 351 aa] {ON} weakly
           similar to uniprot|P53822 Saccharomyces cerevisiae
           YNL336W COS1 Protein of unknown function member of a
           family of conserved often subtelomerically-encoded
           proteins
          Length = 351

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 28/45 (62%)

Query: 114 LMLLVIDNKPGLDLEKWDSITLQINSHLFNTHRWMNTDFIFDGKQ 158
           L+  V+ + PGLD+EKWD I  ++NS  +  H W    F +DG+Q
Sbjct: 92  LVQQVLKSNPGLDIEKWDEIANRLNSSFYQEHMWNTPYFFYDGQQ 136

 Score = 45.4 bits (106), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 18/64 (28%), Positives = 35/64 (54%)

Query: 106 LGVDGQLELMLLVIDNKPGLDLEKWDSITLQINSHLFNTHRWMNTDFIFDGKQCLQLFEY 165
           +G+   ++ + ++    PG +L+KWD I   +N +L   ++ +  +  FDGK CL  ++ 
Sbjct: 264 MGIMQGIKFLAIITKVSPGEELDKWDQIARYMNQYLSEEYKHLPNNNFFDGKHCLDCYQA 323

Query: 166 LIKP 169
             KP
Sbjct: 324 CFKP 327

>Smik_3.4 Chr3 (3476..4723) [1248 bp, 415 aa] {ON} YGL263W (REAL)
          Length = 415

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 28/50 (56%)

Query: 118 VIDNKPGLDLEKWDSITLQINSHLFNTHRWMNTDFIFDGKQCLQLFEYLI 167
           +I N PG+D+E W+ + +  NS+L+    W    + FDG  C + F  ++
Sbjct: 142 IIKNTPGIDIEGWERVAVNFNSYLYENKLWNTEYYFFDGSSCQEAFRKML 191

>Suva_14.9 Chr14 (8076..8222,8226..8447,8451..8492) [411 bp, 137 aa]
           {OFF} YFL062W (HSP)
          Length = 137

 Score = 45.1 bits (105), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 35/127 (27%), Positives = 59/127 (46%), Gaps = 2/127 (1%)

Query: 74  WLPLTYVFIVLDIFYGWVILILLTAPIRKKYVLGVDGQLELMLLVIDNKPGLDLEKWDSI 133
           +LP   +     + Y     +LLT   +K  V  +  + ++ L  I ++  +D   WD I
Sbjct: 9   YLPFAEIEYFFRVLYLGSNFLLLTNSYQKSRVAPMRMEDKMYLFTIISEQEIDANGWDQI 68

Query: 134 TLQINSHLFNTHRWMNTDFIFDGKQCLQLFEYLIKPNKFIQLYVDPALINLNL-QIEEAR 192
             ++N +LF    + N +F F+G  C +LF          +  V P L+N+ L  I+EA+
Sbjct: 69  AKKMNVYLFEQKVYSNKEFFFNGIYCERLFNCNFSNLLSSKESVPPFLLNVELWPIKEAQ 128

Query: 193 -RCHYES 198
             C  ES
Sbjct: 129 LACGDES 135

>ZYRO0A13948g Chr1 complement(1108143..1109129) [987 bp, 328 aa]
           {ON} some similarities with uniprot|P53344 Saccharomyces
           cerevisiae YGR295C COS6 Protein of unknown function
           member of a family of conserved often
           subtelomerically-encoded proteins
          Length = 328

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 28/45 (62%)

Query: 114 LMLLVIDNKPGLDLEKWDSITLQINSHLFNTHRWMNTDFIFDGKQ 158
           L+  V+ + PGLD+EKWD I  ++NS  +  H W    F +DG+Q
Sbjct: 69  LVQQVLKSNPGLDIEKWDEIANRLNSSFYQEHIWNTPYFFYDGQQ 113

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 18/64 (28%), Positives = 35/64 (54%)

Query: 106 LGVDGQLELMLLVIDNKPGLDLEKWDSITLQINSHLFNTHRWMNTDFIFDGKQCLQLFEY 165
           +G+   ++ + ++    PG +L+KWD I   +N +L   ++ +  +  FDGK CL  ++ 
Sbjct: 241 MGIMQGIKFLAIITKVSPGEELDKWDQIARYMNQYLSEEYKHLPNNKFFDGKHCLDCYQA 300

Query: 166 LIKP 169
             KP
Sbjct: 301 CFKP 304

>TDEL0A01190 Chr1 complement(200994..202103) [1110 bp, 369 aa] {ON} 
          Length = 369

 Score = 45.4 bits (106), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 30/131 (22%), Positives = 59/131 (45%), Gaps = 14/131 (10%)

Query: 52  RICYYNLIFCSVIVLFSNDHKLWLPLTYVFIVLDIFYGWVILILLTAPIRKKYVLGVDGQ 111
           +IC+++ +       ++  H   L L  + I+L I    VI    +  + K  +     +
Sbjct: 236 KICFFSAL------AYTFSHTWCLRLVQIMIIL-ITASAVIFTGYSPELSKTRI-----R 283

Query: 112 LELMLLVIDNKPGLDLEKWDSITLQINSHLFNTHRWMNTDFIFDGKQCLQLFEYLIKP-- 169
           + L+  + D  PG D+++WD +  +IN ++            FDGK C++  + ++ P  
Sbjct: 284 IRLLATIADVAPGEDMDRWDMVAKRINGYVMQDSNDTCAKMFFDGKDCMKFSKNVLNPLM 343

Query: 170 NKFIQLYVDPA 180
           +K    Y  PA
Sbjct: 344 SKSTSYYQFPA 354

 Score = 32.0 bits (71), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 10/36 (27%), Positives = 18/36 (50%)

Query: 130 WDSITLQINSHLFNTHRWMNTDFIFDGKQCLQLFEY 165
           WD++  ++N   +    W    + FDG+QC   F +
Sbjct: 128 WDNVACRLNRKFYAAGEWKTPYYYFDGQQCEDYFRH 163

>Smik_16.462 Chr16 complement(798062..799213) [1152 bp, 383 aa] {ON}
           YBR302C (REAL)
          Length = 383

 Score = 45.4 bits (106), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 19/79 (24%), Positives = 42/79 (53%), Gaps = 2/79 (2%)

Query: 86  IFYGWVILILLTA-PIRKKYVLGVDGQLELMLLVIDNKPGLDLEKWDSITLQINSHLFNT 144
           ++ GW+  +++   P  +  ++G++ +++ +  +I N+       W+ I  ++N +LF  
Sbjct: 273 LYLGWMFFMMVEGFPNLRVSLMGMEHKMQFLSTII-NEQKAGANGWEEIAKKMNRYLFEK 331

Query: 145 HRWMNTDFIFDGKQCLQLF 163
             W N +F FDG  C + F
Sbjct: 332 KVWKNEEFFFDGTDCERFF 350

 Score = 37.4 bits (85), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 17/62 (27%), Positives = 28/62 (45%)

Query: 113 ELMLLVIDNKPGLDLEKWDSITLQINSHLFNTHRWMNTDFIFDGKQCLQLFEYLIKPNKF 172
           E   ++  N P ++ + W S+    NS+L+ +  W    F FD   C + F   I    F
Sbjct: 116 EFSKIITKNAPSMNTDDWKSVAANFNSYLYESKAWNTRHFFFDVWDCQESFRRNILEPFF 175

Query: 173 IQ 174
           +Q
Sbjct: 176 LQ 177

>Smik_18.2 Chr18 (1570..2265) [696 bp, 231 aa] {ON} YHL044W (REAL)
          Length = 231

 Score = 44.7 bits (104), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 31/124 (25%), Positives = 64/124 (51%), Gaps = 15/124 (12%)

Query: 55  YYNLIFCSVIVL--------FSNDHKLWLPLTYVFIVLDIFYGWVILIL-LTAPIRKKYV 105
           +Y + F SV+V+        F +D  ++L   ++ +   + + ++ L L +  P   KYV
Sbjct: 42  FYFMFFHSVVVIVFGYITFHFEDDLVVFLACFFMVLGFGLLFFYIPLCLDMGGP---KYV 98

Query: 106 L-GVD--GQLELMLLVIDNKPGLDLEKWDSITLQINSHLFNTHRWMNTDFIFDGKQCLQL 162
           L G+D   ++ L++ VI++KP + ++ W+ I   +N + +  H +      +DG  C ++
Sbjct: 99  LDGLDFNCKMNLLVQVIEHKPSISIDTWNRIAYNMNQYAYEHHLFPENSLFYDGSSCYKV 158

Query: 163 FEYL 166
           F  L
Sbjct: 159 FREL 162

>KNAG0G03450 Chr7 complement(740617..741114) [498 bp, 165 aa] {ON} 
          Length = 165

 Score = 43.9 bits (102), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 20/73 (27%), Positives = 36/73 (49%)

Query: 92  ILILLTAPIRKKYVLGVDGQLELMLLVIDNKPGLDLEKWDSITLQINSHLFNTHRWMNTD 151
           +LI  ++    +    + GQL LM+ VI  +P  D + WD++   +N  L+    W    
Sbjct: 86  VLIYTSSKYHLRNCFELTGQLALMVGVIRTRPSADQKTWDAVAYSLNKVLYERGLWNTPY 145

Query: 152 FIFDGKQCLQLFE 164
            ++ GKQ   +F+
Sbjct: 146 CLYSGKQAYGMFK 158

>YCR007C Chr3 complement(126011..126730) [720 bp, 239 aa] {ON}
           Putative integral membrane protein, member of DUP240
           gene family; YCR007C is not an essential gene
          Length = 239

 Score = 44.3 bits (103), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 25/119 (21%), Positives = 59/119 (49%), Gaps = 13/119 (10%)

Query: 85  DIFYGWVILI----LLTAPIRKKYVLGVDG-QLELMLLVIDNKPGLDLEKWDSITLQINS 139
           D+ +G+ I +     L+  I     +  +G +++L+L VI ++P +  ++W +IT  +N 
Sbjct: 79  DVVFGFSIFVTSILFLSTLIPFNVYISDEGFRIKLLLEVITHRPAVKGKEWRAITDNMNQ 138

Query: 140 HLFNTHRWMNTDFIFDGKQCLQLFEYLIKPNKFIQLYVDPALINLNLQIEEARRCHYES 198
           +L +   W    + +  ++C + F +L+K          P  +N+N  +++A     ++
Sbjct: 139 YLLDNGLWSTRYYFYSSERCYKFFRFLVKEK--------PPGVNVNSSVKDATSTQIDA 189

>Kwal_49.19404 s49 (2490..3092) [603 bp, 200 aa] {ON} [contig 369]
           FULL
          Length = 200

 Score = 43.9 bits (102), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 36/58 (62%)

Query: 106 LGVDGQLELMLLVIDNKPGLDLEKWDSITLQINSHLFNTHRWMNTDFIFDGKQCLQLF 163
           L V  ++EL  LV  ++P L+L+KW+SI + +N+++F    +    F +DG++C   F
Sbjct: 105 LSVVARVELCKLVSKDRPSLNLKKWNSIAVHMNNYIFEQGLYSMPYFFWDGEECRIFF 162

>Kwal_56.22593 s56 complement(194937..195539) [603 bp, 200 aa] {ON}
           [contig 184] FULL
          Length = 200

 Score = 43.9 bits (102), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 36/58 (62%)

Query: 106 LGVDGQLELMLLVIDNKPGLDLEKWDSITLQINSHLFNTHRWMNTDFIFDGKQCLQLF 163
           L V  ++EL  LV  ++P L+L+KW+SI + +N+++F    +    F +DG++C   F
Sbjct: 105 LSVVARVELCKLVSKDRPSLNLKKWNSIAVHMNNYIFEQGLYSMPYFFWDGEECRIFF 162

>SAKL0C10978g Chr3 complement(991612..992388) [777 bp, 258 aa] {ON}
           some similarities with uniprot|P47187 Saccharomyces
           cerevisiae YJR161C COS5 Protein of unknown function
           member of a family of conserved often
           subtelomerically-encoded proteins
          Length = 258

 Score = 43.9 bits (102), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 44/93 (47%), Gaps = 6/93 (6%)

Query: 78  TYVFIVLDIFYGWVILILLTAPIRKKYVLGVDGQLEL------MLLVIDNKPGLDLEKWD 131
           T + ++L IF G   ++      R+   + V    EL      +  V D KPG+   KWD
Sbjct: 105 TAICVLLSIFTGIASVVSFVLVARQLSDVEVSRGFELEQSVQFLFEVRDVKPGMRTVKWD 164

Query: 132 SITLQINSHLFNTHRWMNTDFIFDGKQCLQLFE 164
            +  ++N +LF T  + +    +DGK CL  F+
Sbjct: 165 IVASRMNDYLFETKYYPHRYAFYDGKSCLDGFK 197

>Smik_9.248 Chr9 complement(405227..405625) [399 bp, 132 aa] {ON}
           YJR161C (REAL)
          Length = 132

 Score = 42.4 bits (98), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 25/46 (54%)

Query: 118 VIDNKPGLDLEKWDSITLQINSHLFNTHRWMNTDFIFDGKQCLQLF 163
           +++N  G ++E W+S+    NS+L+    W    F FDG  C + F
Sbjct: 20  IVENTAGTEIESWESVAGNFNSYLYENKLWNTKYFFFDGPSCHEAF 65

>Skud_1.87 Chr1 (157764..158435) [672 bp, 223 aa] {ON}  YGL051W
           (REAL)
          Length = 223

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 37/64 (57%)

Query: 109 DGQLELMLLVIDNKPGLDLEKWDSITLQINSHLFNTHRWMNTDFIFDGKQCLQLFEYLIK 168
           D ++EL++ VI  KP +  ++W +IT ++N +LFN  +W    + +  + C + F  LI+
Sbjct: 106 DFEIELLVEVIARKPAVKGKEWRTITYKMNRYLFNEGKWNTPYYFYCEESCHRYFLRLIE 165

Query: 169 PNKF 172
              F
Sbjct: 166 GRTF 169

>Skud_69.1 Chr69 (40..750) [711 bp, 236 aa] {ON} YHL044W (REAL)
          Length = 236

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 41/81 (50%)

Query: 86  IFYGWVILILLTAPIRKKYVLGVDGQLELMLLVIDNKPGLDLEKWDSITLQINSHLFNTH 145
           +FY   +   ++ P  +   L    +++L+  VI +KP +++  W  I   +N ++F+  
Sbjct: 87  LFYYVPLFYYISLPEHRLSCLSHSCKMKLLAEVITHKPNVNMLTWGPIAYNMNQYVFDQG 146

Query: 146 RWMNTDFIFDGKQCLQLFEYL 166
              N  F +DGK C Q+F  L
Sbjct: 147 ICPNKSFFYDGKSCYQVFREL 167

>Skud_55.1 Chr55 complement(256..1125) [870 bp, 289 aa] {ON} YGR295C
           (REAL)
          Length = 289

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 26/50 (52%)

Query: 118 VIDNKPGLDLEKWDSITLQINSHLFNTHRWMNTDFIFDGKQCLQLFEYLI 167
           +I+N PG   + WD+I + +NS+++    W      FDG  C + F   I
Sbjct: 24  IIENTPGTHADDWDAIAVNLNSYMYENKLWKTEYLFFDGSHCQEAFRTTI 73

 Score = 38.9 bits (89), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 25/49 (51%)

Query: 116 LLVIDNKPGLDLEKWDSITLQINSHLFNTHRWMNTDFIFDGKQCLQLFE 164
           L  I N+  +  + WD I   +N +LF    W N ++ FDG  C + FE
Sbjct: 202 LSTIINEQDIGAKGWDKIAKIMNRYLFEQKAWRNEEYFFDGIDCQRFFE 250

>YAR033W Chr1 (188107..188811) [705 bp, 234 aa] {ON}  MST28Putative
           integral membrane protein, involved in vesicle
           formation; forms complex with Mst27p; member of DUP240
           gene family; binds COPI and COPII vesicles
          Length = 234

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 31/133 (23%), Positives = 65/133 (48%), Gaps = 4/133 (3%)

Query: 36  SYFSHQFWVLNEYLRFRICYYNLIFCSVIVLFSNDHKLWLPLTYVFIVLDIFYGWVILIL 95
           SY S+  + +  Y    I    +    ++++F ND++  +  + +F     F   V L++
Sbjct: 36  SYLSYWIYEIARYTPVMILSLVIGVLVLLIIFFNDNEACVFNSAIFA----FTSLVGLLI 91

Query: 96  LTAPIRKKYVLGVDGQLELMLLVIDNKPGLDLEKWDSITLQINSHLFNTHRWMNTDFIFD 155
           + +    K V   + + EL++ VI  KP ++ ++W  IT  +N +LFN  +W    + + 
Sbjct: 92  ILSDGNPKLVSRRNFRTELLVDVITRKPAVEGKEWRIITYNMNQYLFNHGQWHTPYYFYS 151

Query: 156 GKQCLQLFEYLIK 168
            + C + F  L++
Sbjct: 152 DEDCYRYFLRLVE 164

>TDEL0F02400 Chr6 complement(444921..446048) [1128 bp, 375 aa] {ON} 
          Length = 375

 Score = 42.7 bits (99), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 26/101 (25%), Positives = 45/101 (44%), Gaps = 1/101 (0%)

Query: 70  DHKLWLPLTYVFIVLDIFYG-WVILILLTAPIRKKYVLGVDGQLELMLLVIDNKPGLDLE 128
           DH   L L ++ +V+ +F       I +T       +     ++ L+  + +  PG D E
Sbjct: 246 DHTWSLRLIHMIVVILMFVALSTTSIGITLLGNTLSITTTKDRIRLLAAISNVAPGEDSE 305

Query: 129 KWDSITLQINSHLFNTHRWMNTDFIFDGKQCLQLFEYLIKP 169
            WD +  ++N++L            FDGK+C   FE  +KP
Sbjct: 306 LWDVVAKRMNAYLNEDPNVTGVQRFFDGKECCSFFEKQLKP 346

 Score = 32.7 bits (73), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 13/41 (31%), Positives = 20/41 (48%), Gaps = 1/41 (2%)

Query: 130 WDSITLQINSHLFNTHRWMNTDFIFDGKQCLQLFE-YLIKP 169
           WD +  ++N   +N   W     +FDG  C   F  Y++KP
Sbjct: 125 WDKVASKLNRKFYNAGDWKTPYCLFDGSHCEIFFRCYVLKP 165

>Smik_11.1 Chr11 (1..498) [498 bp, 165 aa] {OFF} YBR302C (HSP)
          Length = 165

 Score = 41.6 bits (96), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 31/59 (52%), Gaps = 1/59 (1%)

Query: 105 VLGVDGQLELMLLVIDNKPGLDLEKWDSITLQINSHLFNTHRWMNTDFIFDGKQCLQLF 163
           ++G++ +++  L  I N+       WD I  ++N +LF    W N +F FDG  C + F
Sbjct: 68  LMGMEHKMQF-LSTIMNEQKTGANGWDEIAKKMNRYLFEKKVWKNEEFFFDGTDCERFF 125

>KLTH0B06710g Chr2 (538970..540142) [1173 bp, 390 aa] {ON} weakly
           similar to uniprot|P38723 Saccharomyces cerevisiae
           YHL048W COS8 Nuclear membrane protein member of a family
           of conserved often subtelomerically-encoded proteins
           regulation suggests a potential role in the unfolded
           protein response
          Length = 390

 Score = 42.7 bits (99), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 30/55 (54%)

Query: 113 ELMLLVIDNKPGLDLEKWDSITLQINSHLFNTHRWMNTDFIFDGKQCLQLFEYLI 167
           +L   V++  PG+ +E+WD +  ++N  L     W  T+ +FDG  C  LF  L+
Sbjct: 101 QLCREVLEGNPGMQIEQWDLVAQRLNDFLHAEGHWPVTNPLFDGHMCHSLFRKLV 155

 Score = 37.4 bits (85), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 20/83 (24%), Positives = 40/83 (48%), Gaps = 5/83 (6%)

Query: 82  IVLDIFYGWVILILLTAPIRKKYVLGVDGQLELMLLVIDNKPGLDLEKWDSITLQINSHL 141
           ++ ++F+G    I+L+  +R   V   D  +EL   ++  +P  D  +WD +   +N +L
Sbjct: 278 VLSNVFWG----IILSPALRDTDVNARD-LMELWATIVAVEPRGDTSEWDRVASHMNKYL 332

Query: 142 FNTHRWMNTDFIFDGKQCLQLFE 164
                       +DG+ C+Q F+
Sbjct: 333 VTASAAGRAAQFYDGENCMQRFK 355

>KLTH0G19580g Chr7 (1693206..1694351) [1146 bp, 381 aa] {ON} weakly
           similar to uniprot|P38723 Saccharomyces cerevisiae
           YHL048W COS8 Nuclear membrane protein, member of a
           family of conserved, often subtelomerically-encoded
           proteins; regulation suggests a potential role in the
           unfolded protein response
          Length = 381

 Score = 42.7 bits (99), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 31/133 (23%), Positives = 63/133 (47%), Gaps = 8/133 (6%)

Query: 36  SYFSHQFWVLNEYLRFRICYYNLIFCSVIVLFSNDHKLWLPL-TYVFIVLDIFYGWVILI 94
           ++ S Q W+L+E ++  +    L+   ++  F +  K   PL TY+   L ++    ++ 
Sbjct: 16  AFISPQLWILSELMKVPLIQ-ALLAVGMLSSFYSCLKGAFPLVTYITAYLLLYVSQNLIE 74

Query: 95  LLTAPIRKKYVLGVDGQLELMLLVIDNKPGLDLEKWDSITLQINSHLFNTHRWMNTDFIF 154
             +    KK+V  +  +      V    PG++++ WD IT +IN ++ +   W +   +F
Sbjct: 75  KRSEKAAKKHVKQICEE------VTREAPGVNVKSWDDITERINENIHSEGDWPSRFCLF 128

Query: 155 DGKQCLQLFEYLI 167
           +G+ C   F   I
Sbjct: 129 EGRSCYTFFRQAI 141

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 29/61 (47%)

Query: 104 YVLGVDGQLELMLLVIDNKPGLDLEKWDSITLQINSHLFNTHRWMNTDFIFDGKQCLQLF 163
           ++LG D  +    ++ D  PG D+EKWD +    N+           +F FDG  C++ F
Sbjct: 284 WLLGTDHLMTWWAIISDINPGEDVEKWDIVAKTFNARWTVDDHCCLREFFFDGDHCMKTF 343

Query: 164 E 164
            
Sbjct: 344 R 344

>Skud_13.255 Chr13 complement(436932..437678) [747 bp, 248 aa] {ON}
           YCR007C (REAL)
          Length = 248

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 40/88 (45%), Gaps = 5/88 (5%)

Query: 81  FIVLDIFYGWVILILLTAPIRKKYVLGVDGQLELMLLVIDNKPGLDLEKWDSITLQINSH 140
           FIV D F     +I    P+      G + Q +L+L VI  KP ++  +W +I   +N +
Sbjct: 94  FIVFDTFGIIAAVIKFAMPM-----TGDNFQTKLLLEVIARKPSVEGVEWRTIAYNVNEY 148

Query: 141 LFNTHRWMNTDFIFDGKQCLQLFEYLIK 168
           LFN   W    + +    C   F+  +K
Sbjct: 149 LFNKGLWNTPYYFYSEDSCYGTFKRFMK 176

>YNL336W Chr14 (8330..9475) [1146 bp, 381 aa] {ON}  COS1Protein of
           unknown function, member of the DUP380 subfamily of
           conserved, often subtelomerically-encoded proteins
          Length = 381

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 58/128 (45%), Gaps = 14/128 (10%)

Query: 82  IVLDIFY-GWVILILLTA-PIRKKYVLGVDGQLELMLL-VIDNKPGLDLEKWDSITLQIN 138
           ++L  FY GW++ +L+      +  VL V  + ++  L  I N+       WD I  ++N
Sbjct: 257 LLLRTFYLGWILFMLVQGFQNMRMIVLSVKMEHKMQFLSTIINEQESGANGWDEIAKKMN 316

Query: 139 SHLFNTHRWMNTDFIFDGKQCLQLFEYLIKPNKFIQLYVDPALINLNLQIE------EAR 192
            +LF    W N +F FDG  C   F +      +  L    ++  L+L +E      EA+
Sbjct: 317 RYLFEKKVWKNEEFFFDGIDCEWFFSHFF----YRVLSAKKSMRALSLNVELWPYIKEAQ 372

Query: 193 -RCHYESL 199
             C  ESL
Sbjct: 373 LSCSEESL 380

 Score = 37.7 bits (86), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 28/104 (26%), Positives = 46/104 (44%), Gaps = 16/104 (15%)

Query: 73  LWLPLT----------YVFIV--LDIFYGWVILILLTAPIRKKYVLGVDGQL-ELMLLVI 119
           LWLPL+          Y  IV  L +F G + ++++    RK+    +  QL +    V 
Sbjct: 55  LWLPLSVWWKLSNNCIYPLIVSLLVLFLGPIFVLVICGLSRKR---SLSKQLIQFCKEVT 111

Query: 120 DNKPGLDLEKWDSITLQINSHLFNTHRWMNTDFIFDGKQCLQLF 163
           +N P  D   W+ +   +NS+L+    W    F F+   C + F
Sbjct: 112 ENTPSSDPHDWEVVAANLNSYLYENKAWNTKYFFFNAMVCQEAF 155

>YGL053W Chr7 (402589..403302) [714 bp, 237 aa] {ON}
           PRM8Pheromone-regulated protein with 2 predicted
           transmembrane segments and an FF sequence, a motif
           involved in COPII binding; forms a complex with Prp9p in
           the ER; member of DUP240 gene family
          Length = 237

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 29/115 (25%), Positives = 59/115 (51%), Gaps = 7/115 (6%)

Query: 59  IFCSVIVLF-SNDHKLWLPLTYVFIVLDIFYGWVILILLTAPIRKKYVLGVDGQLELMLL 117
           +  S+I+LF  N++ + + + ++ I   I    ++LIL   P     +   D + +L++ 
Sbjct: 60  VLISIIILFHDNENCVGVSVGFLLIFSGILV--IVLILRFGP----QISDEDFKCKLLME 113

Query: 118 VIDNKPGLDLEKWDSITLQINSHLFNTHRWMNTDFIFDGKQCLQLFEYLIKPNKF 172
           +I  KP +  ++W +IT ++N +LF+   W    + +  + C + F  LIK   F
Sbjct: 114 IITRKPTVKGKEWRTITYKMNQYLFDNDLWNTPYYFYRDEDCHRYFLSLIKGRTF 168

>Smik_18.5 Chr18 (7625..8875) [1251 bp, 416 aa] {ON}  YDL248W (REAL)
          Length = 416

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 28/88 (31%), Positives = 40/88 (45%), Gaps = 6/88 (6%)

Query: 116 LLVIDNKPGLDLEKWDSITLQINSHLFNTHRWMNTDFIFDGKQCLQLFEY----LIKPNK 171
           L  I N+       WD I  ++N +LF    W N +F FDG  C + F +    L+   K
Sbjct: 329 LSTIINEQESGANGWDEIAKKMNGYLFEKKVWKNEEFFFDGIDCERFFNHFFYRLLSARK 388

Query: 172 FIQLYVDPALINLNLQIEEARRCHYESL 199
              L+  P  + L   I+EA+ C  E L
Sbjct: 389 --SLWYLPLNVELWPYIKEAQLCRREGL 414

 Score = 41.2 bits (95), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 30/114 (26%), Positives = 49/114 (42%), Gaps = 15/114 (13%)

Query: 73  LWLPLT----------YVFIV-LDIFYGWVILILLTAPIRKKYVLGVDGQL-ELMLLVID 120
           LWLP++          Y F+  + +F G   L       RK+    +  QL E   ++  
Sbjct: 91  LWLPISVWWKMSKNWAYPFVASIFLFLGLAFLPCSHLLFRKR---ALSKQLTEFSKIITR 147

Query: 121 NKPGLDLEKWDSITLQINSHLFNTHRWMNTDFIFDGKQCLQLFEYLIKPNKFIQ 174
           N PG + + W ++   +NS+L+ +  W    F FD   C + F   I    F+Q
Sbjct: 148 NAPGTNADDWKNVAASLNSYLYESKAWNTRHFFFDAWDCQEAFRRNILEPFFLQ 201

>Suva_16.529 Chr16
           complement(913015..913104,913108..913224,913228..913527)
           [507 bp, 169 aa] {OFF} YFL062W (HSP)
          Length = 169

 Score = 41.2 bits (95), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 30/103 (29%), Positives = 49/103 (47%), Gaps = 14/103 (13%)

Query: 73  LWLPLTYVFIVLDIFYGWVILI-------LLTAPIR----KKYVLGVDGQLELMLLVIDN 121
           LWLPL   + +   + G+ ++        LLT PI     +K+   V   ++    +I +
Sbjct: 54  LWLPLGVWWEISGRWNGYPLVAAMCMDVALLTFPINMIIYRKH--AVSKHIQFCKEIIRS 111

Query: 122 KPGLDLEKWDSITLQINSHLFNTHRWMNTDFIFDGKQCLQLFE 164
            PG D+E W+ I L  NS+++    W N  F FD  +C + F 
Sbjct: 112 VPGTDIEDWEPIVLTFNSYMYGNKFW-NKVFFFDVPRCYESFR 153

>NDAI0G02270 Chr7 complement(508794..509516) [723 bp, 240 aa] {ON} 
          Length = 240

 Score = 41.6 bits (96), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/102 (23%), Positives = 47/102 (46%), Gaps = 4/102 (3%)

Query: 59  IFCSVIVLFSNDHKLWLPLTYVFIVL-DIFYGWVILILLTAPIRKKYVLGVDGQLELMLL 117
           IF S+   F +   +++   Y  ++L  +  G+V  +     +R+   L    Q++L+L 
Sbjct: 59  IFASISTYFKSGAAIFIACVYFLVLLMAVVIGYVYELRPNFKLRE---LNSQSQMKLLLE 115

Query: 118 VIDNKPGLDLEKWDSITLQINSHLFNTHRWMNTDFIFDGKQC 159
           VI+ KP      WD I   +N +L+        ++ +DG + 
Sbjct: 116 VIECKPTPSSSTWDVIACHVNEYLYTERYHTTPNYFYDGNEA 157

>Skud_41.1 Chr41 (3..701) [699 bp, 232 aa] {ON} YCR007C (REAL)
          Length = 232

 Score = 41.6 bits (96), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 32/58 (55%)

Query: 111 QLELMLLVIDNKPGLDLEKWDSITLQINSHLFNTHRWMNTDFIFDGKQCLQLFEYLIK 168
           +++L+L VI  KP +  ++W  IT  +N HLF+   W    + +  + C   F +LIK
Sbjct: 97  KIKLLLEVITRKPAVKGKEWRIITYNMNQHLFDNGLWNTPYYFYCDQSCYGFFRHLIK 154

>ZYRO0E00440g Chr5 (28214..29269) [1056 bp, 351 aa] {ON} weakly
           similar to uniprot|P38723 Saccharomyces cerevisiae
           YHL048W COS8 Nuclear membrane protein member of a family
           of conserved often subtelomerically-encoded proteins
           regulation suggests a potential role in the unfolded
           protein response
          Length = 351

 Score = 42.0 bits (97), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 40/72 (55%), Gaps = 4/72 (5%)

Query: 99  PIRKKYVLGVDGQL-ELMLLVIDNKPGLDLEKWDSITLQINSHLFNTHRWMNTDFIFDGK 157
           P+ K YVL  + +L   ++L +D  PG++  KW     ++N+ L+    W   +F F+ K
Sbjct: 91  PLHKNYVLSQNKELFSTIVLAVD--PGVEATKWREAASKMNTALYEQGFWKTLNFFFNEK 148

Query: 158 QCLQLF-EYLIK 168
           +C   F E+++K
Sbjct: 149 ECRDGFREHVLK 160

>TDEL0A06960 Chr1 (1219819..1220964) [1146 bp, 381 aa] {ON} 
          Length = 381

 Score = 42.0 bits (97), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 36/69 (52%), Gaps = 5/69 (7%)

Query: 108 VDGQLELMLLVIDNKPGLDLEKWDSITLQINSHLFNTHRWMNTDFIFDGKQCLQLFEYLI 167
            + ++  +  +++  PG D+++WD I   +N++   T    +    FDGK C++ F   +
Sbjct: 294 TNNRIRFLATIVNVAPGEDVDRWDEIARLMNAYFKRTR---SHGSFFDGKDCMRYFNTFL 350

Query: 168 KP--NKFIQ 174
           KP  NK  Q
Sbjct: 351 KPLMNKITQ 359

 Score = 30.4 bits (67), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 14/42 (33%), Positives = 21/42 (50%), Gaps = 1/42 (2%)

Query: 129 KWDSITLQINSHLFNTHRWMNTDFIFDGKQCLQLF-EYLIKP 169
           +WD++  ++N     T  W      FDG  C  LF  Y++KP
Sbjct: 137 EWDNVAARLNRDFLVTGEWRTPYCFFDGVLCESLFRRYVLKP 178

>Skud_11.1 Chr11 (2..898) [897 bp, 298 aa] {ON}  YKL219W (REAL)
          Length = 298

 Score = 41.6 bits (96), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 25/49 (51%)

Query: 116 LLVIDNKPGLDLEKWDSITLQINSHLFNTHRWMNTDFIFDGKQCLQLFE 164
           L  I N+  +    WD +  ++N +LF    W N +F FDG  C + FE
Sbjct: 211 LSTITNEQEIGANGWDQVAKRMNRYLFRQKVWKNEEFFFDGIDCQRFFE 259

 Score = 39.7 bits (91), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 25/50 (50%)

Query: 118 VIDNKPGLDLEKWDSITLQINSHLFNTHRWMNTDFIFDGKQCLQLFEYLI 167
           +I N PG D+E W++I   INS+++    W    F +    C + F   I
Sbjct: 29  IIANSPGTDVENWETIAANINSYMYVNKFWKTKYFFYGAWNCQEAFRLTI 78

>ZYRO0C18590g Chr3 complement(1460662..1461690) [1029 bp, 342 aa]
           {ON} weakly similar to uniprot|P53053 Saccharomyces
           cerevisiae YGL263W COS12 Protein of unknown function
           member of a family of conserved often subtelomerically-
           encoded proteins
          Length = 342

 Score = 41.6 bits (96), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 25/96 (26%), Positives = 46/96 (47%), Gaps = 3/96 (3%)

Query: 77  LTYVFIVLDIFYGWVILILLTA-PIRKKYVLGVDGQLELMLLVIDNKPGLDLEKWDSITL 135
            TY+  +  +  G +  +L     IRK  VL    ++     V+   PGLD +KW  +  
Sbjct: 51  FTYIGYIGAVVIGLLFFLLRHQFRIRKDKVLSNTKEM-FSRNVLAVNPGLDTKKWHEVAS 109

Query: 136 QINSHLFNTHRWMNTDFIFDGKQCLQLF-EYLIKPN 170
           ++N+  +    W +  F  DG +C   F E++++P+
Sbjct: 110 KMNNEFYEQDYWRSRHFFCDGDECHNSFREHILRPS 145

 Score = 41.2 bits (95), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 37/67 (55%), Gaps = 2/67 (2%)

Query: 100 IRKKY-VLGVDGQLELMLLVIDNKPGLDLEKWDSITLQINSHLFNTHRWMNTDFIF-DGK 157
           I++KY  + +  +++ +  V+   PG DLEKWD I   +N +L     W +    F DGK
Sbjct: 244 IKEKYKAVDITQRVKFLATVMHFAPGDDLEKWDRIASHMNWYLRVEGIWTHAHEKFADGK 303

Query: 158 QCLQLFE 164
           +CL  +E
Sbjct: 304 ECLDFYE 310

>Skud_107.1 Chr107 (3..590) [588 bp, 196 aa] {OFF} YKL219W (HSP)
          Length = 196

 Score = 40.8 bits (94), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 24/46 (52%)

Query: 118 VIDNKPGLDLEKWDSITLQINSHLFNTHRWMNTDFIFDGKQCLQLF 163
           +I N PG D+E W+ I   +NS+++    W    F +D   C + F
Sbjct: 13  IIANSPGTDVENWEPIAANLNSYMYENKFWKTKYFFYDAWNCQEAF 58

>YFL062W Chr6 (6426..7565) [1140 bp, 379 aa] {ON}  COS4Protein of
           unknown function, member of the DUP380 subfamily of
           conserved, often subtelomerically-encoded proteins
          Length = 379

 Score = 41.6 bits (96), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 30/123 (24%), Positives = 58/123 (47%), Gaps = 15/123 (12%)

Query: 86  IFYGWVILILLTA--PIRKKYVLGVDGQLELMLLVIDNKPGLDLEKWDSITLQINSHLFN 143
           ++ GW++ +L+     IR   ++ ++ +++ +  +I+ +       WD I  ++N +LF 
Sbjct: 262 LYLGWILFMLVQGFQNIRV-LIMSMEHKMQFLSTIINEQES-GANGWDEIARKMNRYLFE 319

Query: 144 THRWMNTDFIFDGKQCLQLFEYLIKPNKFIQLYVDPALINLNLQIE------EAR-RCHY 196
              W N +F FDG  C   F +      +  L    ++  L+L +E      EA+  C  
Sbjct: 320 KKVWKNEEFFFDGIDCEWFFSHFF----YRVLSAKKSMRALSLNVELWPYIKEAQLSCSE 375

Query: 197 ESL 199
           ESL
Sbjct: 376 ESL 378

 Score = 32.3 bits (72), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 26/104 (25%), Positives = 46/104 (44%), Gaps = 16/104 (15%)

Query: 73  LWLPLT----------YVFIV--LDIFYGWVILILLTAPIRKKYVLGVDGQL-ELMLLVI 119
           LWLPL+          Y  +V  L +F+G V ++++    RK+    +  QL +    + 
Sbjct: 55  LWLPLSVWWKLSNNWIYPLMVSLLVLFWGPVFVLVIFRLSRKR---SLSKQLTQFCKEIT 111

Query: 120 DNKPGLDLEKWDSITLQINSHLFNTHRWMNTDFIFDGKQCLQLF 163
            + P  D   W+ +   +NS+L+    W    F F+   C + F
Sbjct: 112 KSTPSSDPHDWEVVAANLNSYLYENKAWNIRYFFFNAMGCQEAF 155

>ZYRO0F18700g Chr6 complement(1550815..1551843) [1029 bp, 342 aa]
           {ON} weakly similar to uniprot|P53053 Saccharomyces
           cerevisiae YGL263W COS12 Protein of unknown function
           member of a family of conserved often subtelomerically-
           encoded proteins
          Length = 342

 Score = 41.2 bits (95), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 37/72 (51%), Gaps = 2/72 (2%)

Query: 100 IRKKYVLGVDGQLELMLLVIDNKPGLDLEKWDSITLQINSHLFNTHRWMNTDFIFDGKQC 159
           IRK  VL    ++     V+   PGLD +KW  +  ++N+  +    W +  F  DG +C
Sbjct: 75  IRKDKVLSNTKEM-FSRNVLAVNPGLDTKKWHEVASKMNNEFYEQDYWRSRHFFCDGDEC 133

Query: 160 LQLF-EYLIKPN 170
              F E++++P+
Sbjct: 134 HNSFREHILRPS 145

 Score = 41.2 bits (95), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 37/67 (55%), Gaps = 2/67 (2%)

Query: 100 IRKKY-VLGVDGQLELMLLVIDNKPGLDLEKWDSITLQINSHLFNTHRWMNTDFIF-DGK 157
           I++KY  + +  +++ +  V+   PG DLEKWD I   +N +L     W +    F DGK
Sbjct: 244 IKEKYKAVDITQRVKFLATVMHFAPGDDLEKWDRIASHMNWYLRVEGIWTHAHEKFPDGK 303

Query: 158 QCLQLFE 164
           +CL  +E
Sbjct: 304 ECLDFYE 310

>YBR302C Chr2 complement(810340..811479) [1140 bp, 379 aa] {ON}
           COS2Protein of unknown function, member of the DUP380
           subfamily of conserved, often subtelomerically-encoded
           proteins
          Length = 379

 Score = 41.2 bits (95), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 18/81 (22%), Positives = 41/81 (50%), Gaps = 2/81 (2%)

Query: 86  IFYGWVILILLTAPIR-KKYVLGVDGQLELMLLVIDNKPGLDLEKWDSITLQINSHLFNT 144
           ++ GW++ +L+      +  ++ ++ +++ +  +I+ +       WD I  ++N +LF  
Sbjct: 262 LYLGWILFMLVQGFQNIRVLIMSMEHKMQFLSTIINEQES-GANGWDEIARKMNRYLFEK 320

Query: 145 HRWMNTDFIFDGKQCLQLFEY 165
             W N +F FDG  C   F +
Sbjct: 321 KAWKNEEFFFDGIDCEWFFNH 341

 Score = 36.2 bits (82), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 27/105 (25%), Positives = 47/105 (44%), Gaps = 16/105 (15%)

Query: 73  LWLPLT----------YVFIV--LDIFYGWVILILLTAPIRKKYVLGVDGQL-ELMLLVI 119
           LWLPL+          Y  IV  L +F G + ++++    RK+    +  QL +    + 
Sbjct: 55  LWLPLSVWWKLSNNCIYPLIVSLLVLFLGPIFVLVICGLSRKR---SLSKQLIQFCKEIT 111

Query: 120 DNKPGLDLEKWDSITLQINSHLFNTHRWMNTDFIFDGKQCLQLFE 164
           +N P  D   W+ +   +NS+L+  + W    F F+   C + F 
Sbjct: 112 ENTPSSDPHDWEVVAANLNSYLYENNVWNTKYFFFNAMVCQEAFR 156

>YML132W Chr13 (7244..8383) [1140 bp, 379 aa] {ON}  COS3Protein
           involved in salt resistance; interacts with
           sodium:hydrogen antiporter Nha1p; member of the DUP380
           subfamily of conserved, often subtelomerically-encoded
           proteins
          Length = 379

 Score = 41.2 bits (95), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 18/81 (22%), Positives = 41/81 (50%), Gaps = 2/81 (2%)

Query: 86  IFYGWVILILLTAPIR-KKYVLGVDGQLELMLLVIDNKPGLDLEKWDSITLQINSHLFNT 144
           ++ GW++ +L+      +  ++ ++ +++ +  +I+ +       WD I  ++N +LF  
Sbjct: 262 LYLGWILFMLVQGFQNIRVLIMSMEHKMQFLSTIINEQES-GANGWDEIARKMNRYLFEK 320

Query: 145 HRWMNTDFIFDGKQCLQLFEY 165
             W N +F FDG  C   F +
Sbjct: 321 KAWKNEEFFFDGIDCEWFFNH 341

 Score = 36.2 bits (82), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 27/105 (25%), Positives = 47/105 (44%), Gaps = 16/105 (15%)

Query: 73  LWLPLT----------YVFIV--LDIFYGWVILILLTAPIRKKYVLGVDGQL-ELMLLVI 119
           LWLPL+          Y  IV  L +F G + ++++    RK+    +  QL +    + 
Sbjct: 55  LWLPLSVWWKLSNNCIYPLIVSLLVLFLGPIFVLVICGLSRKR---SLSKQLIQFCKEIT 111

Query: 120 DNKPGLDLEKWDSITLQINSHLFNTHRWMNTDFIFDGKQCLQLFE 164
           +N P  D   W+ +   +NS+L+  + W    F F+   C + F 
Sbjct: 112 ENTPSSDPHDWEVVAANLNSYLYENNVWNTKYFFFNAMVCQEAFR 156

>YAR023C Chr1 complement(179281..179820) [540 bp, 179 aa] {ON}
           Putative integral membrane protein, member of DUP240
           gene family
          Length = 179

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 32/58 (55%)

Query: 111 QLELMLLVIDNKPGLDLEKWDSITLQINSHLFNTHRWMNTDFIFDGKQCLQLFEYLIK 168
           + +L+L VI ++P +  ++W +IT  +N +LF    W      F   QC + F+ LIK
Sbjct: 56  RTKLLLEVITHRPSIAGKEWKTITYNMNQYLFKAGLWKTPYHFFCEHQCYEFFKDLIK 113

>SAKL0C10868g Chr3 (986125..986898) [774 bp, 257 aa] {ON} weakly
           similar to uniprot|P53822 Saccharomyces cerevisiae
           YNL336W COS1, Protein of unknown function, member of the
           DUP380 subfamily of conserved, often
           subtelomerically-encoded proteins
          Length = 257

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/97 (24%), Positives = 48/97 (49%), Gaps = 7/97 (7%)

Query: 80  VFIVLDIFYG----WVILILLTAPIRKKYVLGVDGQLELMLLVIDNKPGLDLEKWDSITL 135
           +F +   F+G      I  + +  I K   L ++ ++  ++ + D KPG+++ +WD +  
Sbjct: 110 LFFMASFFFGSASFGAIAGVASHGISKH--LELEQEIRFLIEIGDVKPGINILQWDIVAS 167

Query: 136 QINSHLFNTHRWMNTDFIFDGKQCLQLF-EYLIKPNK 171
           ++N +LF T  +      +DG+ C   F E  + P K
Sbjct: 168 RMNDYLFETGHYFGKYAFYDGRHCCNEFKEKYLLPRK 204

>Smik_9.252 Chr9 complement(407060..408235) [1176 bp, 391 aa] {ON}
           YBR302C (REAL)
          Length = 391

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 17/64 (26%), Positives = 32/64 (50%), Gaps = 1/64 (1%)

Query: 100 IRKKYVLGVDGQLELMLLVIDNKPGLDLEKWDSITLQINSHLFNTHRWMNTDFIFDGKQC 159
            +K  ++ ++  ++ +  +I N+       WD I  ++N +LF    W N +F FDG  C
Sbjct: 289 TKKVLIMSMEHNMQFLSTII-NEQKTGANGWDEIAKKMNKYLFEKKVWKNEEFFFDGTDC 347

Query: 160 LQLF 163
            + F
Sbjct: 348 ERFF 351

 Score = 36.6 bits (83), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 28/114 (24%), Positives = 46/114 (40%), Gaps = 15/114 (13%)

Query: 73  LWLPLTYVFIVLDIFYGWV-------ILILLTAPIRKKYVLGVDGQL-----ELMLLVID 120
           LWLPL+   I   +   W         L L+ A +   + L  D  L     E    +  
Sbjct: 67  LWLPLS---IWWKMSTNWTYPCLASSFLFLVLAFLPLSHSLSRDRALSKQLTEFSKAITR 123

Query: 121 NKPGLDLEKWDSITLQINSHLFNTHRWMNTDFIFDGKQCLQLFEYLIKPNKFIQ 174
           N PG + + W ++   +NS+L+ +  W      F+   C + F  +I    F+Q
Sbjct: 124 NAPGTNADDWKNVAASLNSYLYESKAWNTRYLFFEALDCQEAFRRIILEPFFLQ 177

>YAR028W Chr1 (184892..185596) [705 bp, 234 aa] {ON} Putative
           integral membrane protein, member of DUP240 gene family;
           GFP-fusion protein is induced in response to the
           DNA-damaging agent MMS
          Length = 234

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/89 (24%), Positives = 45/89 (50%), Gaps = 2/89 (2%)

Query: 80  VFIVLDIFYGWVILILLTAPIRKKYVLGVDGQLELMLLVIDNKPGLDLEKWDSITLQINS 139
           V +V+ +    + L+++ A    K +   +  ++L++ VI  KP    ++W ++   +N 
Sbjct: 76  VILVMSLIVASMALMVVAAFTFGKAITEQEFMIKLLVEVIARKPAG--KEWGTVAYNMNQ 133

Query: 140 HLFNTHRWMNTDFIFDGKQCLQLFEYLIK 168
           +LF    W    + + GK+C + F  LIK
Sbjct: 134 YLFMKRLWYTPYYFYSGKKCHEFFTTLIK 162

>ZYRO0A00220g Chr1 (9173..10243) [1071 bp, 356 aa] {ON} weakly
           similar to uniprot|P47187 Saccharomyces cerevisiae
           YJR161C COS5 Protein of unknown function member of a
           family of conserved often subtelomerically-encoded
           proteins
          Length = 356

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/84 (26%), Positives = 42/84 (50%), Gaps = 1/84 (1%)

Query: 82  IVLDIFYGWVILILLTAP-IRKKYVLGVDGQLELMLLVIDNKPGLDLEKWDSITLQINSH 140
           +V D+  G +    L  P +R +Y+       EL+  V+++ P +D+EKW  I  ++N +
Sbjct: 59  LVSDMTAGALFGCALVWPFVRVRYLKFYPNTTELVQQVLESNPEVDIEKWAEIANRLNIY 118

Query: 141 LFNTHRWMNTDFIFDGKQCLQLFE 164
            +  H W    F F+ +    +F+
Sbjct: 119 FYQEHLWSTPHFFFNNQHVQLVFK 142

 Score = 38.9 bits (89), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 16/58 (27%), Positives = 29/58 (50%)

Query: 112 LELMLLVIDNKPGLDLEKWDSITLQINSHLFNTHRWMNTDFIFDGKQCLQLFEYLIKP 169
           +  + ++I   PG +  KWD I   +N +L   +   +T+   DGK CL  ++   +P
Sbjct: 270 MNFLAIIIKVSPGKEPVKWDQIARYMNQYLAEENNGHSTNIFLDGKHCLNCYKTCFEP 327

>Kwal_26.9047 s26 (1053474..1053833) [360 bp, 119 aa] {ON} YHL048W
           (COS8) - similar to other subtelomerically-encoded
           proteins [contig 68] FULL
          Length = 119

 Score = 38.9 bits (89), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 17/77 (22%), Positives = 41/77 (53%), Gaps = 3/77 (3%)

Query: 91  VILILLTA---PIRKKYVLGVDGQLELMLLVIDNKPGLDLEKWDSITLQINSHLFNTHRW 147
           ++L+L+     P  K   + ++ +L+ +  +   KP   +E W+ +  ++N +++    W
Sbjct: 3   IVLLLIGVVLYPRMKIKEMKIEERLKFLKTISLVKPHAQIEGWNIVAKRMNKYMYEEKGW 62

Query: 148 MNTDFIFDGKQCLQLFE 164
            N +F ++G+ CL  F+
Sbjct: 63  HNREFFYNGEDCLNAFK 79

>KLTH0B10296g Chr2 (867082..867360) [279 bp, 92 aa] {ON} conserved
           hypothetical protein
          Length = 92

 Score = 38.5 bits (88), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 13/43 (30%), Positives = 28/43 (65%)

Query: 122 KPGLDLEKWDSITLQINSHLFNTHRWMNTDFIFDGKQCLQLFE 164
           KPG+D+ KWD I  ++N++L+  +  ++  + ++G+ C   F+
Sbjct: 3   KPGIDMRKWDFIAAKMNANLYQNNSLISPYYYYNGEACYCFFK 45

>NCAS0I00840 Chr9 complement(154605..155312) [708 bp, 235 aa] {ON} 
          Length = 235

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 23/44 (52%)

Query: 113 ELMLLVIDNKPGLDLEKWDSITLQINSHLFNTHRWMNTDFIFDG 156
           +L L +I  KP +D   WD I L IN HL+    W    F +DG
Sbjct: 113 KLFLEIIQWKPNVDPRSWDLIALHINQHLYEMGNWNTPGFFYDG 156

>ZYRO0D00154g Chr4 (5577..6647) [1071 bp, 356 aa] {ON} weakly
           similar to uniprot|P43542 Saccharomyces cerevisiae
           YFL062W COS4 Protein of unknown function member of a
           family of conserved often subtelomerically-encoded
           proteins
          Length = 356

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/112 (24%), Positives = 58/112 (51%), Gaps = 9/112 (8%)

Query: 89  GWVILILLTAPIRKKYVLGVDGQLELMLLVIDNKPGLDLEKWDSITLQINSHLFNTHRWM 148
           G+ +L+ L    R +Y        EL+  V+++ PG+D+EKW  I  ++N + +  H W 
Sbjct: 70  GFSVLLSLA---RLQYSKFYPNTTELVQQVLESNPGVDIEKWAEIANRLNIYFYQEHLWP 126

Query: 149 NTDFIFDGKQCLQLFEYLIKPNKFIQLYVDPALINL-NLQIEEARRCHYESL 199
              F F+ +    +F+     +K ++ Y++  L ++ ++   ++  C+ +SL
Sbjct: 127 MPHFFFNNQPVQLVFK-----DKVLRPYLEGKLDDITDMDKIQSANCYLQSL 173

 Score = 36.2 bits (82), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 15/58 (25%), Positives = 28/58 (48%)

Query: 112 LELMLLVIDNKPGLDLEKWDSITLQINSHLFNTHRWMNTDFIFDGKQCLQLFEYLIKP 169
           +  + ++I   PG +  KWD I   +N +L   +   + +   DGK CL  ++   +P
Sbjct: 270 MNFLAIIIKVSPGKEPAKWDQIAGYMNQYLAEENIGYSKNIFLDGKHCLNCYKTCFEP 327

>NCAS0C03030 Chr3 (596013..596771) [759 bp, 252 aa] {ON} 
          Length = 252

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/84 (29%), Positives = 37/84 (44%), Gaps = 2/84 (2%)

Query: 80  VFIVLDIFYGWVILILLTAPIRKKYVLGVDGQLELMLLVIDNKPGLDLEKWDSITLQINS 139
           +F  L   + + +LILL   I KK  +     L L   +ID  P      WD  T  +N 
Sbjct: 122 IFYTLPFIFWYGLLILLK--IDKKDSVKESQPLSLFKEIIDRTPNSTTASWDITTSHLND 179

Query: 140 HLFNTHRWMNTDFIFDGKQCLQLF 163
            L+   +W     ++DGK+C   F
Sbjct: 180 MLYEGKKWPTKYMMWDGKECHAWF 203

>YGR295C Chr7 complement(1081584..1082729) [1146 bp, 381 aa] {ON}
           COS6Protein of unknown function, member of the DUP380
           subfamily of conserved, often subtelomerically-encoded
           proteins
          Length = 381

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 44/167 (26%), Positives = 68/167 (40%), Gaps = 24/167 (14%)

Query: 43  WVLNEYLRFRICYYNLIFCSVIVLFSNDHKLWLPLTYVFIVLDIFYGWVILILLTAPIR- 101
           WVL      R     L +   + +  ND  +  PL   F+V       V+  ++T   R 
Sbjct: 228 WVLKRIFNRRCLPLFLFYLHNVFISRNDGTIARPL---FLV-------VLFFIMTRDFRN 277

Query: 102 -KKYVLGVDGQLELMLL-VIDNKPGLDLEKWDSITLQINSHLFNTHRWMNTDFIFDGKQC 159
            +  VL V  + ++  L  I N+       WD I  ++N +LF    W N +F FDG  C
Sbjct: 278 MRMIVLSVKMEHKMQFLSTIINEQESGANGWDEIAKKMNRYLFEKKVWKNEEFFFDGIDC 337

Query: 160 LQLFEYLIKPNKFIQLYVDPALINLNLQIE------EAR-RCHYESL 199
              F +      +  L    ++  L+L +E      EA+  C  ESL
Sbjct: 338 EWFFSHFF----YRVLSAKKSMRALSLNVELWPYIKEAQLSCSEESL 380

 Score = 35.0 bits (79), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 26/104 (25%), Positives = 44/104 (42%), Gaps = 16/104 (15%)

Query: 73  LWLPLT----------YVFIV--LDIFYGWVILILLTAPIRKKYVLGVDGQL-ELMLLVI 119
           LWLPL+          Y  +V  L +F+G V ++++    RK+    +  QL +    + 
Sbjct: 55  LWLPLSVWWKLSNNWIYPLMVSLLVLFWGPVFVLVIFRLSRKR---SLSKQLTQFCKEIT 111

Query: 120 DNKPGLDLEKWDSITLQINSHLFNTHRWMNTDFIFDGKQCLQLF 163
            N P  D   W+ +   +NS+ +    W    F F    C + F
Sbjct: 112 KNTPSSDPHDWEVVAANLNSYFYENKAWNTKYFFFSAMSCQEAF 155

>ZYRO0A13816g Chr1 complement(1099212..1099886) [675 bp, 224 aa]
           {ON} some similarities with uniprot|P38363 Saccharomyces
           cerevisiae YML132W COS3 Protein involved in salt
           resistance interacts with sodium:hydrogen antiporter
           Nha1p member of a family of conserved often
           subtelomerically- encoded proteins
          Length = 224

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/82 (26%), Positives = 41/82 (50%), Gaps = 1/82 (1%)

Query: 89  GWVILILLTAPIRKKYVLGVDGQLELMLLVIDNKPGLDLEKWDSITLQINSHLFNTHRWM 148
           G   L+    P   +YV       +L+  V+++ PG+D  KW+ I   +N   +  + W 
Sbjct: 67  GLSGLLFGLIPAWFQYVKEHPNTKKLVQQVLESNPGVDTRKWNEIANILNPFFYRENIWR 126

Query: 149 NTDFIFDGKQCLQLFEY-LIKP 169
              F F+G+   ++F+Y ++KP
Sbjct: 127 TPYFFFNGRHVQRVFKYNVLKP 148

>KAFR0H03780 Chr8 (718980..719699) [720 bp, 239 aa] {ON} 
          Length = 239

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 31/133 (23%), Positives = 58/133 (43%), Gaps = 4/133 (3%)

Query: 38  FSHQF-WVLNEYLRFRIC--YYNLIFCSVIVLFSNDHKLWLPLTYVFIVLDIFYGWVILI 94
           F ++F + L+E  + + C   Y L+  S+    +  +      T   +    F+  V   
Sbjct: 26  FRNRFTYGLSEMFKTKRCQISYTLLLASITAAITFANVPGKSDTSALLFALSFFILVATA 85

Query: 95  LLTAPIRKKYVLGVDGQLELMLLVIDNKPGLDLEKWDSITLQINSHLFNTHRWMNTDFIF 154
            +TA +  K       +++  L V++ KP +D   WD I   +N +L+N   W +    +
Sbjct: 86  FVTATVFIK-EFNTFAKVKFFLYVVEYKPNIDPHSWDIIASHMNVYLYNEGYWFSPRCFY 144

Query: 155 DGKQCLQLFEYLI 167
           DG+     F+ LI
Sbjct: 145 DGQAAYHYFKSLI 157

>YDL248W Chr4 (1802..2953) [1152 bp, 383 aa] {ON}  COS7Protein of
           unknown function, member of the DUP380 subfamily of
           conserved, often subtelomerically-encoded proteins; the
           authentic, non-tagged protein is detected in highly
           purified mitochondria in high-throughput studies
          Length = 383

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/108 (25%), Positives = 49/108 (45%), Gaps = 16/108 (14%)

Query: 73  LWLPLT----------YVFIV--LDIFYGWVILILLTAPIRKKYVLGVDGQL-ELMLLVI 119
           LWLPL+          Y  IV  L +F G + ++++    RK+    +  QL +    + 
Sbjct: 55  LWLPLSVWWKLSNNCIYPLIVSLLVLFLGPIFVLVICGLSRKR---SLSKQLIQFCKEIT 111

Query: 120 DNKPGLDLEKWDSITLQINSHLFNTHRWMNTDFIFDGKQCLQLFEYLI 167
           +N P  D   W+ +   +NS+L+    W   +F F+   C ++F   +
Sbjct: 112 ENTPSSDPHDWEVVVANLNSYLYENKAWNTKNFFFNATDCEKMFRTTV 159

 Score = 39.7 bits (91), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 24/50 (48%)

Query: 116 LLVIDNKPGLDLEKWDSITLQINSHLFNTHRWMNTDFIFDGKQCLQLFEY 165
           LL I N+       WD I  ++N +LF    W N +F FDG  C   F +
Sbjct: 294 LLTIINEQESGANGWDEIARKMNRYLFEKKAWKNEEFFFDGIDCEWFFSH 343

>TDEL0D00660 Chr4 complement(115547..116641) [1095 bp, 364 aa] {ON} 
          Length = 364

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 38/80 (47%), Gaps = 2/80 (2%)

Query: 91  VILILLTAPIRKKYVLGVD-GQLELMLLVIDNKPGLDLEKWDSITLQINSHLFNTHRWMN 149
            IL+  T   R    L     ++ L+  + D  P  D+++WD +  ++N++L       +
Sbjct: 257 TILMFATIAARPPLELSTTRSRIRLLATIADVAPREDMDRWDVVARRMNAYLSQDSN-SD 315

Query: 150 TDFIFDGKQCLQLFEYLIKP 169
               FDGK  L+ FE  +KP
Sbjct: 316 AGIFFDGKDYLEFFEKQLKP 335

>YAR031W Chr1 (186836..187732) [897 bp, 298 aa] {ON}
           PRM9Pheromone-regulated protein with 3 predicted
           transmembrane segments and an FF sequence, a motif
           involved in COPII binding; member of DUP240 gene family
          Length = 298

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/82 (24%), Positives = 44/82 (53%), Gaps = 5/82 (6%)

Query: 91  VILILLTAPIRKKYVLGVDGQLELMLLVIDNKPGLDLEKWDSITLQINSHLFNTHRWMNT 150
           +++I  + PI  +     + +++L++ +I  KP +  ++W +IT ++N +LF+   W   
Sbjct: 153 MVVIAFSEPIGDR-----EFKVKLLMEIITRKPAVKGKEWRTITYKMNQYLFDHGLWDTP 207

Query: 151 DFIFDGKQCLQLFEYLIKPNKF 172
            + +  + C + F  LIK   F
Sbjct: 208 YYFYRDEDCHRYFLSLIKGRTF 229

>Skud_13.8 Chr13 (8824..9525) [702 bp, 233 aa] {ON} YHL044W (REAL)
          Length = 233

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/90 (24%), Positives = 47/90 (52%), Gaps = 3/90 (3%)

Query: 80  VFIVLDIFYGWVILILLTAPIRKKYVLGVD---GQLELMLLVIDNKPGLDLEKWDSITLQ 136
           + +++  F   + L++LT  + + Y+L +    G++ L++ VI +KP  D   WD I   
Sbjct: 76  ILMIISFFTLPLSLVVLTYFLGEDYILDLLDDDGKMNLLVEVIHHKPNADKRTWDLIAHN 135

Query: 137 INSHLFNTHRWMNTDFIFDGKQCLQLFEYL 166
           +N   ++  ++ +    +DG  C ++F  L
Sbjct: 136 MNQFAYDHGKYCDKSLFYDGDCCYRVFRSL 165

>YGL051W Chr7 (403687..404391) [705 bp, 234 aa] {ON}  MST27Putative
           integral membrane protein, involved in vesicle
           formation; forms complex with Mst28p; member of DUP240
           gene family; binds COPI and COPII vesicles
          Length = 234

 Score = 39.3 bits (90), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 33/58 (56%)

Query: 111 QLELMLLVIDNKPGLDLEKWDSITLQINSHLFNTHRWMNTDFIFDGKQCLQLFEYLIK 168
           + EL++ VI  KP ++ ++W  IT  +N +LFN  +W    + +  + C + F  L++
Sbjct: 107 RTELLVDVITRKPAVEGKEWRIITYNMNQYLFNHGQWHTPYYFYSDEDCYRYFLRLVE 164

>Smik_16.6 Chr16 (5125..5739) [615 bp, 204 aa] {ON} YGL263W (REAL)
          Length = 204

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 23/50 (46%)

Query: 118 VIDNKPGLDLEKWDSITLQINSHLFNTHRWMNTDFIFDGKQCLQLFEYLI 167
           +I N PG D+E W+ +    N +L+    W    F FD   C + F   +
Sbjct: 121 IIKNTPGTDIENWERVAENFNFYLYENKLWNTKYFFFDDNSCHEAFRKTV 170

>KLTH0B10252g Chr2 (863070..863741) [672 bp, 223 aa] {ON} some
           similarities with uniprot|P36034 Saccharomyces
           cerevisiae YKL219W COS9 Protein of unknown function
           member of a family of conserved often
           subtelomerically-encoded proteins
          Length = 223

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 36/78 (46%), Gaps = 11/78 (14%)

Query: 84  LDIFYGWVILI--LLTAPIRKKYVLGVDGQLELMLLVIDNKPGLDLEKWDSITLQINSHL 141
           L +F G V L+     AP+ +         +  M  +I  +PG +  KWDSI  ++N+  
Sbjct: 86  LSLFSGMVHLVHNCGKAPVNR---------VRFMEEIIAVEPGTETRKWDSIAARLNAIF 136

Query: 142 FNTHRWMNTDFIFDGKQC 159
           ++ +      F +DG  C
Sbjct: 137 YSNNSLATPHFFYDGNAC 154

>Skud_3.71 Chr3 complement(107662..108369) [708 bp, 235 aa] {ON}
           YCR007C (REAL)
          Length = 235

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 32/58 (55%)

Query: 111 QLELMLLVIDNKPGLDLEKWDSITLQINSHLFNTHRWMNTDFIFDGKQCLQLFEYLIK 168
           +++L+L VI  KP +  ++W  IT  +N +LF+   W    + +  + C   F +LIK
Sbjct: 106 KIKLLLEVITRKPAVKGKEWRIITYNMNQYLFDNGLWNTPYYFYCDQSCYGFFRHLIK 163

>ZYRO0E00330g Chr5 (16701..17774) [1074 bp, 357 aa] {ON} weakly
           similar to uniprot|P47187 Saccharomyces cerevisiae
           YJR161C COS5 Protein of unknown function member of a
           family of conserved often subtelomerically-encoded
           proteins
          Length = 357

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 34/58 (58%), Gaps = 1/58 (1%)

Query: 113 ELMLLVIDNKPGLDLEKWDSITLQINSHLFNTHRWMNTDFIFDGKQCLQLFEY-LIKP 169
           +L+  V+++ PG+D  KWD I   +N   +  + W    F F+G+   ++F+Y ++KP
Sbjct: 92  KLVQQVLESNPGVDTRKWDEIANILNLFFYRENIWRTPYFFFNGQHVQRVFKYNVLKP 149

 Score = 35.8 bits (81), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 14/53 (26%), Positives = 28/53 (52%)

Query: 112 LELMLLVIDNKPGLDLEKWDSITLQINSHLFNTHRWMNTDFIFDGKQCLQLFE 164
           ++ + ++    P  +L+KWD I   +N +L   +   + +  FDGK CL  ++
Sbjct: 271 IKFLAIITKFSPRKELDKWDQIARYMNQYLMEGNSSHSRNIFFDGKHCLDCYK 323

>Skud_1.88 Chr1 (159215..159829) [615 bp, 204 aa] {ON} YGL053W
           (REAL)
          Length = 204

 Score = 38.9 bits (89), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 37/60 (61%)

Query: 109 DGQLELMLLVIDNKPGLDLEKWDSITLQINSHLFNTHRWMNTDFIFDGKQCLQLFEYLIK 168
           D +++L++ VI  +P ++ ++W +IT ++N +LFN  +W    + +  + C + F  LI+
Sbjct: 79  DFEIKLLVEVIAREPAVNGKEWRTITHKMNRYLFNEGKWNIPYYFYCEESCHRYFLSLIE 138

>Suva_8.398 Chr8 (714632..715528) [897 bp, 298 aa] {ON} YAR031W
           (REAL)
          Length = 298

 Score = 39.3 bits (90), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 22/82 (26%), Positives = 38/82 (46%), Gaps = 1/82 (1%)

Query: 111 QLELMLLVIDNKPGLDLEKWDSITLQINSHLFNTHRWMNTDFIFDGKQCLQLFEYLIKPN 170
            ++L+L VI  KP +  E+W +IT  +N +LF    W    +      C + F  L++  
Sbjct: 172 NIKLLLEVITRKPAVKGEEWRTITCNMNRYLFENELWGTPYYFHSENNCYRYFITLLE-G 230

Query: 171 KFIQLYVDPALINLNLQIEEAR 192
           K +    DP  I+    + E+ 
Sbjct: 231 KHLYPQSDPTAIDAQWDVLESE 252

>KAFR0C00130 Chr3 complement(15602..16237) [636 bp, 211 aa] {ON} 
          Length = 211

 Score = 38.1 bits (87), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 25/117 (21%), Positives = 51/117 (43%), Gaps = 11/117 (9%)

Query: 56  YNLIFCSVI-----VLFSNDHKLWLPLTYVFIVLDIFYGWVILILLTAPIRKKYVLGVDG 110
           + ++ C+V+     +L  N+    + L ++ +   +  G   L+  T+       L +  
Sbjct: 18  FGMLMCAVVLSTFSILIFNNGGFAMLLFFIALFSSLGTGITSLLTFTSD------LTISS 71

Query: 111 QLELMLLVIDNKPGLDLEKWDSITLQINSHLFNTHRWMNTDFIFDGKQCLQLFEYLI 167
            + L   +I+ +P +D   W+ IT  IN +LF    W      +DG+     F+ +I
Sbjct: 72  NVRLFQYIIEYRPNIDPHAWNIITSSINLYLFEQGEWSTPYRFYDGQSTYAYFKGMI 128

>Smik_1.90 Chr1 (160467..161183) [717 bp, 238 aa] {ON} YAR033W
           (REAL)
          Length = 238

 Score = 38.1 bits (87), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 33/56 (58%)

Query: 113 ELMLLVIDNKPGLDLEKWDSITLQINSHLFNTHRWMNTDFIFDGKQCLQLFEYLIK 168
           +L++ VI  KP +  ++W +IT ++N +LF+   W    F +  ++C + F  LI+
Sbjct: 109 KLLVEVITRKPAVKGKEWRTITYKMNQYLFDRGHWFTPYFFYCDEKCYRYFLRLIE 164

>Skud_64.1 Chr64 (3..983) [981 bp, 327 aa] {ON}  YBR302C (REAL)
          Length = 327

 Score = 38.1 bits (87), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 24/50 (48%)

Query: 118 VIDNKPGLDLEKWDSITLQINSHLFNTHRWMNTDFIFDGKQCLQLFEYLI 167
           +I N PG D+E W+SI   +N +++    W    F +    C + F   I
Sbjct: 101 IIANSPGTDVENWESIAANLNLYMYENKLWKTKYFFYGAWDCQEAFRIAI 150

 Score = 35.0 bits (79), Expect = 0.080,   Method: Compositional matrix adjust.
 Identities = 14/44 (31%), Positives = 22/44 (50%)

Query: 116 LLVIDNKPGLDLEKWDSITLQINSHLFNTHRWMNTDFIFDGKQC 159
           L  I N+     + W+ +  ++N +LF    W N +F FDG  C
Sbjct: 283 LSTITNEQETGADGWNQVARRMNMYLFRQKVWKNEEFFFDGIDC 326

>YKL219W Chr11 (14485..15708) [1224 bp, 407 aa] {ON}  COS9Protein of
           unknown function, member of the DUP380 subfamily of
           conserved, often subtelomerically-encoded proteins
          Length = 407

 Score = 38.1 bits (87), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 11/50 (22%), Positives = 26/50 (52%)

Query: 118 VIDNKPGLDLEKWDSITLQINSHLFNTHRWMNTDFIFDGKQCLQLFEYLI 167
           ++++ PG D   W+++   +NS+ +    W    F F+  +C + F  ++
Sbjct: 138 IVEHAPGTDTHDWETVAANLNSYFYENKAWNTEYFFFNAAECQKAFRKVL 187

 Score = 37.0 bits (84), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 18/88 (20%), Positives = 45/88 (51%), Gaps = 2/88 (2%)

Query: 79  YVFIVLDIFYGWVILILLTAPIRKKYVLGVDGQLELMLLVIDNKPGLDLEKWDSITLQIN 138
           ++F +L    G+++++ +   +R  + + ++ +++ +  +I+ +       WD I  ++N
Sbjct: 285 HLFRILCCGGGFLLMVRVFQNMRP-FSMHMEDKMQFLSTIINEQES-GANGWDEIAKKMN 342

Query: 139 SHLFNTHRWMNTDFIFDGKQCLQLFEYL 166
            +LF    W + +F FDG  C   F + 
Sbjct: 343 RYLFEKKVWTSEEFFFDGIDCEWFFNHF 370

>YJR161C Chr10 complement(742848..743999) [1152 bp, 383 aa] {ON}
           COS5Protein of unknown function, member the DUP380
           subfamily of conserved, often subtelomerically-encoded
           proteins
          Length = 383

 Score = 38.1 bits (87), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 24/50 (48%)

Query: 116 LLVIDNKPGLDLEKWDSITLQINSHLFNTHRWMNTDFIFDGKQCLQLFEY 165
           LL I N+       WD I  ++N +LF    W N +F F+G  C   F +
Sbjct: 294 LLTIINEQESGANGWDEIARKMNRYLFEKKAWKNEEFFFEGIDCEWFFSH 343

 Score = 37.7 bits (86), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 28/104 (26%), Positives = 46/104 (44%), Gaps = 16/104 (15%)

Query: 73  LWLPLT----------YVFIV--LDIFYGWVILILLTAPIRKKYVLGVDGQL-ELMLLVI 119
           LWLPL+          Y  IV  L +F G + ++++    RK+    +  QL +    V 
Sbjct: 55  LWLPLSVWWKLSNNCIYPLIVSLLVLFLGPIFVLVICGLSRKR---SLSKQLIQFCKEVT 111

Query: 120 DNKPGLDLEKWDSITLQINSHLFNTHRWMNTDFIFDGKQCLQLF 163
           +N P  D   W+ +   +NS+L+    W    F F+   C + F
Sbjct: 112 ENTPSSDPHDWEVVAANLNSYLYENKAWNTRYFFFNAMGCQEAF 155

>NDAI0G01470 Chr7 (324888..325607) [720 bp, 239 aa] {ON} 
          Length = 239

 Score = 37.7 bits (86), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 30/152 (19%), Positives = 72/152 (47%), Gaps = 6/152 (3%)

Query: 43  WVLNEYLRFRICYYN----LIFCSVIVLFSN--DHKLWLPLTYVFIVLDIFYGWVILILL 96
           ++L+EY+    C+      ++F ++ ++F++  +    L     F+ L +F   ++ ++ 
Sbjct: 34  YLLDEYVHQLECHICAGLVILFTALTLIFTHLKNFPFTLSCCRFFMKLSLFSFLLMFLIS 93

Query: 97  TAPIRKKYVLGVDGQLELMLLVIDNKPGLDLEKWDSITLQINSHLFNTHRWMNTDFIFDG 156
           +  + K   + +  +++++L VI+ KP      WD I   +N +L++   +   +F +DG
Sbjct: 94  SYWMFKLCKMNLQSEIKILLEVIECKPNASPHSWDIIACHMNEYLYSEGFYSTPNFFYDG 153

Query: 157 KQCLQLFEYLIKPNKFIQLYVDPALINLNLQI 188
               + F + I      QL  +  L +   +I
Sbjct: 154 SGVYRWFRFAIMKRLQAQLARENRLTDDGSEI 185

>Smik_1.105 Chr1 (168370..168972) [603 bp, 200 aa] {ON}  YGL053W
           (REAL)
          Length = 200

 Score = 37.7 bits (86), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 34/62 (54%)

Query: 111 QLELMLLVIDNKPGLDLEKWDSITLQINSHLFNTHRWMNTDFIFDGKQCLQLFEYLIKPN 170
           Q +L++ VI  KP +  ++W +IT  +N +LF  + W    + +  + C + F  LI+ +
Sbjct: 81  QRKLLVEVITRKPAVKGKEWKTITYNMNQYLFVNNLWNTPYYFYRDEDCHRYFLSLIEGH 140

Query: 171 KF 172
            F
Sbjct: 141 TF 142

>KLTH0D00242g Chr4 complement(20418..21098) [681 bp, 226 aa] {ON}
           some similarities with uniprot|P36034 Saccharomyces
           cerevisiae YKL219W COS9 Protein of unknown function
           member of a family of conserved often
           subtelomerically-encoded proteins
          Length = 226

 Score = 37.7 bits (86), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 13/67 (19%), Positives = 34/67 (50%)

Query: 100 IRKKYVLGVDGQLELMLLVIDNKPGLDLEKWDSITLQINSHLFNTHRWMNTDFIFDGKQC 159
           + + +V     +++ +  +I  +PG+D+ +WD +  + N+  +N     +  + +DG  C
Sbjct: 94  VERGFVTTAANKVQFLKELITIRPGIDMIEWDILATKANTIFYNESVLTSPYYFYDGASC 153

Query: 160 LQLFEYL 166
              F ++
Sbjct: 154 YSFFRFV 160

>Skud_53.1 Chr53 complement(1..876) [876 bp, 292 aa] {ON}  YGR295C
           (REAL)
          Length = 292

 Score = 37.7 bits (86), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 13/44 (29%), Positives = 22/44 (50%)

Query: 121 NKPGLDLEKWDSITLQINSHLFNTHRWMNTDFIFDGKQCLQLFE 164
           N PG D+E W++I   +NS+++    W    F +    C + F 
Sbjct: 112 NSPGTDVESWETIAANLNSYMYENKLWKTKYFFYGAWNCQEAFR 155

>KAFR0B03990 Chr2 complement(833771..834451) [681 bp, 226 aa] {ON} 
          Length = 226

 Score = 37.4 bits (85), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 24/125 (19%), Positives = 53/125 (42%), Gaps = 3/125 (2%)

Query: 43  WVLNEYLRFRICYYNLIFCSVIVLFSNDHKLWLPLTYVFIVLDIFYGWVILILLTAPIRK 102
           + +NEY   +I     I   V +LF+      + + ++F    +    V ++    P  +
Sbjct: 31  YYVNEYAHKKIFLTFFIGTLVGILFAILLSEQILICFIFSCFAVLSFVVSIVFAAIPTNE 90

Query: 103 KYVLGVDGQLELMLLVIDNKPGLDLEKWDSITLQINSHLFNTHRWMNTDFIFDGKQCLQL 162
                   +++ +  +I+NKP  +++ W  IT  IN +L++   W      ++ + C   
Sbjct: 91  ---FTSHAKMKFLSEIIENKPNANIQTWTVITSHINEYLYDNGLWKTPYRFYNNEDCYAF 147

Query: 163 FEYLI 167
           F   +
Sbjct: 148 FRSFV 152

>NDAI0G02310 Chr7 complement(517385..518269) [885 bp, 294 aa] {ON} 
          Length = 294

 Score = 37.7 bits (86), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 17/66 (25%), Positives = 34/66 (51%)

Query: 102 KKYVLGVDGQLELMLLVIDNKPGLDLEKWDSITLQINSHLFNTHRWMNTDFIFDGKQCLQ 161
           K Y L    +++L++ +I+NKP   ++ WD I   +N +L+    +   +F +DG +   
Sbjct: 113 KLYKLNSHNKMKLLMDIIENKPNASVQSWDIIARHMNKYLYLEGYYNTPNFFYDGNEVYY 172

Query: 162 LFEYLI 167
            F   +
Sbjct: 173 WFRRFV 178

>Smik_4.183 Chr4 (337090..337404) [315 bp, 105 aa] {OFF} YAR023C
           (HSP)
          Length = 105

 Score = 35.8 bits (81), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 22/39 (56%)

Query: 130 WDSITLQINSHLFNTHRWMNTDFIFDGKQCLQLFEYLIK 168
           W +IT  +N +LFN   W    + FD  +C + F+ LIK
Sbjct: 1   WKTITYNMNEYLFNKDLWKTPYYFFDEHECYEFFKTLIK 39

>Skud_8.1 Chr8 (1116..2270) [1155 bp, 384 aa] {ON} YHL048W (REAL)
          Length = 384

 Score = 37.4 bits (85), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 25/104 (24%), Positives = 41/104 (39%), Gaps = 11/104 (10%)

Query: 74  WLPLT----------YVFIVLDIFYGWVILILLTAPIRKKYVLGVDGQLELMLLVIDNKP 123
           WLPLT          Y ++V    +   +L  LT     ++ L      +    +I + P
Sbjct: 56  WLPLTVWWKISSNWIYPYLVTAFMFLGPVLSPLTPMTFHEHALSKQFT-QFSKEIIKSSP 114

Query: 124 GLDLEKWDSITLQINSHLFNTHRWMNTDFIFDGKQCLQLFEYLI 167
           G+ ++ W++     NS +     W    F FDG  C + F   I
Sbjct: 115 GIHVDDWEATAANFNSFMHENRLWNTEYFFFDGLSCQEAFRTTI 158

>Skud_1.80 Chr1 (152939..152944,152948..153196,153443..153919) [732
           bp, 243 aa] {ON} YGL053W (REAL)
          Length = 243

 Score = 37.4 bits (85), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 38/72 (52%), Gaps = 4/72 (5%)

Query: 81  FIVLDIFYGWVILILLTAPIR----KKYVLGVDGQLELMLLVIDNKPGLDLEKWDSITLQ 136
           F  L IF   ++LI   +P+     ++ +     Q++L+L VI  KP +   +W +IT  
Sbjct: 157 FTCLVIFLASIVLICCLSPVALCPFEEQISEELYQIKLLLEVITRKPAVRGREWRTITYN 216

Query: 137 INSHLFNTHRWM 148
           +N +LF+   W+
Sbjct: 217 MNQYLFDNGLWV 228

>Suva_1.79 Chr1 complement(139959..140705) [747 bp, 248 aa] {ON}
           YCR007C (REAL)
          Length = 248

 Score = 37.4 bits (85), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 16/58 (27%), Positives = 30/58 (51%)

Query: 111 QLELMLLVIDNKPGLDLEKWDSITLQINSHLFNTHRWMNTDFIFDGKQCLQLFEYLIK 168
           +++L++ VI  KP +   +W +IT  +N +LF    W    + +   +C   F  LI+
Sbjct: 119 KIKLLMEVITYKPAVKGREWRTITYNMNQYLFCNGLWTTPYYFYSEMRCSDFFRTLIR 176

>Suva_3.29 Chr3 complement(39749..40108,40112..40258) [507 bp, 169
           aa] {OFF} YCR007C (HSP)
          Length = 169

 Score = 36.6 bits (83), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 15/52 (28%), Positives = 25/52 (48%)

Query: 114 LMLLVIDNKPGLDLEKWDSITLQINSHLFNTHRWMNTDFIFDGKQCLQLFEY 165
           L++ VI  KP ++ E+W  I    N +LF    W    + + G  C   F++
Sbjct: 50  LLVEVIARKPAVEGEEWRVIAYNTNQYLFENELWNTPYYFYAGDNCYSYFQH 101

>Smik_9.244 Chr9 complement(403860..404315) [456 bp, 151 aa] {ON}
           YAR028W (REAL)
          Length = 151

 Score = 36.2 bits (82), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 26/103 (25%), Positives = 44/103 (42%), Gaps = 19/103 (18%)

Query: 61  CSVIVLFSNDHKLWLPLTYVFIVLDIFYGWVILILLTAPIRKKYVLGVDGQLELMLLVID 120
           C+V+ L S          Y F+ L  F G+V           + +   D ++EL++ +  
Sbjct: 24  CAVVSLVSR--------LYCFVALLNFVGFVCF---------ERINDRDFRIELLMEITT 66

Query: 121 NKPGLDLEKWDSITLQINSHLFNTHRWMNTDFIFDGKQCLQLF 163
            KP    +KW +I   +N  LFN   W  T + +  ++C   F
Sbjct: 67  RKPAG--KKWRTIAHSVNQDLFNEGLWHRTYYFYCDRECQSFF 107

>Skud_66.1 Chr66 (3..554) [552 bp, 183 aa] {OFF} YKL219W (HSP)
          Length = 183

 Score = 35.4 bits (80), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 31/60 (51%), Gaps = 1/60 (1%)

Query: 106 LGVDGQLELMLLVIDNKPGLDLEKWDSITLQINSHLFNTHRWMNTDFIFDGKQCLQLFEY 165
           + ++ +++ +  +I N+  +    WD I  ++N +LF  +   N DF FDG  C   F Y
Sbjct: 85  MKIEHKMQFLSSII-NEREIGANGWDHIAKRMNRYLFEQNVRKNEDFFFDGIDCKWFFNY 143

>YAR027W Chr1 (183770..184477) [708 bp, 235 aa] {ON}  UIP3Putative
           integral membrane protein of unknown function; interacts
           with Ulp1p at the nuclear periphery; member of DUP240
           gene family
          Length = 235

 Score = 35.4 bits (80), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 32/60 (53%)

Query: 112 LELMLLVIDNKPGLDLEKWDSITLQINSHLFNTHRWMNTDFIFDGKQCLQLFEYLIKPNK 171
           ++L++ VI  KP +  ++W  I   +N +LF+   W    + F   +C + F+ LIK  +
Sbjct: 107 IKLLVEVITRKPAVGGKEWRIIAYNMNQYLFDHGIWHTPYYFFCEHRCHKFFKSLIKQTR 166

>YHL048W Chr8 (6401..7546) [1146 bp, 381 aa] {ON}  COS8Nuclear
           membrane protein, member of the DUP380 subfamily of
           conserved, often subtelomerically-encoded proteins;
           regulation suggests a potential role in the unfolded
           protein response
          Length = 381

 Score = 35.4 bits (80), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 35/82 (42%), Gaps = 8/82 (9%)

Query: 105 VLGVDGQLELMLL-VIDNKPGLDLEKWDSITLQINSHLFNTHRWMNTDFIFDGKQCLQLF 163
           VL V  + ++  L  I N+       WD I  ++N +LF    W N +F +DG  C   F
Sbjct: 282 VLSVKMEHKMQFLSTIINEQESGANGWDEIAKKMNRYLFEKKVWNNEEFFYDGLDCEWFF 341

Query: 164 EY-------LIKPNKFIQLYVD 178
                    L KP  F  L V+
Sbjct: 342 RRFFYRLLSLKKPMWFASLNVE 363

 Score = 32.3 bits (72), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 22/105 (20%), Positives = 42/105 (40%), Gaps = 16/105 (15%)

Query: 73  LWLPLTYVFIVLDIFYGWV------ILILLTAPIRKKYVLGVDGQLELMLLVI------- 119
           LWLPL+   +   +   W+      +L+L   P     + G+  +  L   +I       
Sbjct: 55  LWLPLS---VWWKLSSNWIHPLIVSLLVLFLGPFFVLVICGLSRKRSLSKQLIQFCKEIT 111

Query: 120 DNKPGLDLEKWDSITLQINSHLFNTHRWMNTDFIFDGKQCLQLFE 164
           ++ P  D   W+ +   +NS+ +    W    F F+   C + F+
Sbjct: 112 EDTPSSDPHDWEVVAANLNSYFYENKTWNTKYFFFNAMSCQKAFK 156

>YIR043C Chr9 complement(437043..437735) [693 bp, 230 aa] {OFF}
           Possible pseudogene in strain S288C; YIR043C and the
           adjacent ORF, YIR044C, together may encode a
           non-functional member of the conserved, often
           subtelomerically-encoded Cos protein family
          Length = 230

 Score = 35.0 bits (79), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 28/60 (46%), Gaps = 1/60 (1%)

Query: 105 VLGVDGQLELMLL-VIDNKPGLDLEKWDSITLQINSHLFNTHRWMNTDFIFDGKQCLQLF 163
           VL V  + ++  L  I N+       WD I  ++N +LF    W N +F +DG  C   F
Sbjct: 134 VLSVKMEHKMQFLSTIINEQESGANGWDEIAKKMNRYLFEKKVWNNEEFFYDGLDCEWFF 193

>ZYRO0E00132g Chr5 (2603..3472) [870 bp, 289 aa] {ON} weakly similar
           to uniprot|P38363 Saccharomyces cerevisiae YML132W COS3
           Protein involved in salt resistance interacts with
           sodium:hydrogen antiporter Nha1p member of a family of
           conserved often subtelomerically- encoded proteins
          Length = 289

 Score = 35.0 bits (79), Expect = 0.095,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 26/51 (50%)

Query: 114 LMLLVIDNKPGLDLEKWDSITLQINSHLFNTHRWMNTDFIFDGKQCLQLFE 164
           L+  V++  P  D +KWD I  ++N   +  H W    F +DG+Q    F+
Sbjct: 30  LVRQVLELNPQRDFKKWDDIASKLNLLFYQEHIWNTPYFFYDGQQTQLAFK 80

>NDAI0F04400 Chr6 (1077197..1077844) [648 bp, 215 aa] {ON} 
          Length = 215

 Score = 34.7 bits (78), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 33/69 (47%), Gaps = 1/69 (1%)

Query: 102 KKYVLGVDGQLELMLLVIDNKPGLDLEKWDSITLQINSHLFNTHRWMNTDFIFDGKQCLQ 161
           K   L    Q++L+L VI+ KP      WD I   +N +L++        F +DG +   
Sbjct: 120 KTKKLNSQNQIKLLLDVIECKPNASSSSWDIIACHMNEYLYSEGAHNTPYFFYDGSETYW 179

Query: 162 LF-EYLIKP 169
            F +Y+ +P
Sbjct: 180 WFRKYVFEP 188

>Suva_2.719 Chr2 complement(1263749..1263928,1263932..1264054) [303
           bp, 101 aa] {OFF} YBR302C (HSP)
          Length = 101

 Score = 33.1 bits (74), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 15/60 (25%), Positives = 29/60 (48%), Gaps = 3/60 (5%)

Query: 105 VLGVDGQLELMLLVIDNKPGLDLEKWDSITLQINSHLFNTHRWMNTDFIFDGKQCLQLFE 164
            + ++G+++ +L + D   G +    D I  + N + F    + N +  FDG  C Q F+
Sbjct: 19  TMKMEGKMQYLLTIRDQATGTN---RDQIAKKTNVYPFEQKVYSNKELFFDGTDCEQFFD 75

>YHL042W Chr8 (15667..16119) [453 bp, 150 aa] {ON} Putative protein
           of unknown function; member of the DUP380 subfamily of
           conserved, often subtelomerically-encoded proteins
          Length = 150

 Score = 33.5 bits (75), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 15/59 (25%), Positives = 28/59 (47%)

Query: 106 LGVDGQLELMLLVIDNKPGLDLEKWDSITLQINSHLFNTHRWMNTDFIFDGKQCLQLFE 164
           + V+ +++ +  +I      D+  WD I  ++N +LF      +  F  DG  C + FE
Sbjct: 53  MKVEHRMQFLSTIISEHQKSDVNCWDQIAKKMNVYLFEQKVSGSDVFFLDGADCERFFE 111

>TDEL0A01180 Chr1 complement(200029..200700) [672 bp, 223 aa] {ON} 
          Length = 223

 Score = 33.9 bits (76), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 12/41 (29%), Positives = 21/41 (51%), Gaps = 1/41 (2%)

Query: 130 WDSITLQINSHLFNTHRWMNTDFIFDGKQCLQLFE-YLIKP 169
           WD +  ++N   ++   W   +  FDG  C   F+ Y++KP
Sbjct: 120 WDKVACRLNRKFYDAGDWKTLNLFFDGSNCEGFFKMYVLKP 160

>TBLA0B05730 Chr2 (1355413..1356048) [636 bp, 211 aa] {ON} 
          Length = 211

 Score = 33.9 bits (76), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 26/48 (54%), Gaps = 1/48 (2%)

Query: 123 PGLDLEKWDSITLQINSHLFNTHRWMNTDFIFDGKQCLQLF-EYLIKP 169
           PG +   W+ +TL IN+ ++N + W    F +D    ++ F E+ I P
Sbjct: 111 PGSNQLLWNQLTLNINTFIYNENYWNTPYFFYDKNSAMKYFYEFAINP 158

>YHL043W Chr8 (14901..15413) [513 bp, 170 aa] {ON}  ECM34Putative
           protein of unknown function; member of the DUP380
           subfamily of conserved, often subtelomerically-encoded
           proteins
          Length = 170

 Score = 33.1 bits (74), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 12/37 (32%), Positives = 21/37 (56%), Gaps = 1/37 (2%)

Query: 118 VIDNKPGLDLEKWDSITLQINSHLFNTHRWMNTDFIF 154
           +I + P  D+E WD +    NS+++    W NT++ F
Sbjct: 134 IIKSAPSTDMESWDRVAADFNSYMYENKLW-NTEYFF 169

>Suva_13.219 Chr13 (356145..356654) [510 bp, 169 aa] {ON} YCR007C
           (REAL)
          Length = 169

 Score = 33.1 bits (74), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 15/53 (28%), Positives = 29/53 (54%)

Query: 111 QLELMLLVIDNKPGLDLEKWDSITLQINSHLFNTHRWMNTDFIFDGKQCLQLF 163
           Q++L+L VI  KP ++  +W +IT  +N +L +   W    + +   +C  +F
Sbjct: 116 QIKLLLEVITRKPPVEGIEWKTITYNMNQYLCDKGYWSTPYYFYCEHRCYNVF 168

>Suva_2.722 Chr2 complement(1264397..1264660,1264664..1264828) [429
           bp, 143 aa] {OFF} YFL062W (HSP)
          Length = 143

 Score = 32.7 bits (73), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 30/63 (47%), Gaps = 7/63 (11%)

Query: 95  LLTAPI-----RKKYVLGVDGQLELMLLVIDNKPGLDLEKWDSITLQINSHLFNTHRWMN 149
           LLT PI     RK+ +     Q      +I + PG D+E W+ I +  NS+++    W N
Sbjct: 82  LLTFPIHMMIYRKRAISKQHTQF--CKEIIKSVPGTDIEDWEPIVINFNSYMYENKLWNN 139

Query: 150 TDF 152
             F
Sbjct: 140 EYF 142

>NDAI0F04550 Chr6 complement(1105670..1106464) [795 bp, 264 aa] {ON}
           
          Length = 264

 Score = 33.5 bits (75), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 32/65 (49%), Gaps = 1/65 (1%)

Query: 106 LGVDGQLELMLLVIDNKPGLDLEKWDSITLQINSHLFNTHRWMNTDFIFDGKQCLQLF-E 164
           L    Q++L+L VI+ KP      WD I   +N +L++        F +DG +    F +
Sbjct: 124 LNSHNQIKLLLDVIECKPNGSSSSWDIIACHMNEYLYSEGAHNTPYFFYDGSETYWWFRK 183

Query: 165 YLIKP 169
           Y+ +P
Sbjct: 184 YVFEP 188

>KLTH0C00264g Chr3 (12563..12979) [417 bp, 138 aa] {ON} some
           similarities with uniprot|P53053 Saccharomyces
           cerevisiae YGL263W COS12 Protein of unknown function
           member of a family of conserved often subtelomerically-
           encoded proteins
          Length = 138

 Score = 32.7 bits (73), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 13/54 (24%), Positives = 28/54 (51%)

Query: 111 QLELMLLVIDNKPGLDLEKWDSITLQINSHLFNTHRWMNTDFIFDGKQCLQLFE 164
           +L+ M  +   KPG+D++  D +  ++N++L +        + ++GK C   F 
Sbjct: 30  ELQFMKEIAAIKPGIDMKDCDVLAARMNTYLSSNSVLATPYYFYNGKSCYPFFR 83

>Suva_9.16 Chr9 (16781..17056) [276 bp, 92 aa] {ON}  YNL336W (REAL)
          Length = 92

 Score = 31.6 bits (70), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 13/44 (29%), Positives = 24/44 (54%), Gaps = 1/44 (2%)

Query: 121 NKPGLDLEKWDSITLQINSHLFNTHRWMNTDFIFDGKQCLQLFE 164
           +  G+ +  W  I  ++N +LF + ++   +F FDG  C + FE
Sbjct: 13  SGQGIGVNGWYQIAKEMNVYLF-SRKFARIEFFFDGSDCKRFFE 55

>Skud_1.86 Chr1 (156935..157462) [528 bp, 175 aa] {ON} YAR028W
           (REAL)
          Length = 175

 Score = 32.7 bits (73), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 24/102 (23%), Positives = 46/102 (45%), Gaps = 7/102 (6%)

Query: 67  FSNDHKLWLPLTYVFIVLDIFYGWVILILLTAPIRKKYVLGVDGQLELMLLVIDNKPGLD 126
           F +D+++ +  + V ++  IF    I    T PI  K     D +++L   VI  +P   
Sbjct: 42  FFHDNEVCVVASIVSLIFCIFILPFISDAFTQPISDK-----DFKIKLSAEVIALRPAG- 95

Query: 127 LEKWDSITLQINSHLFNTHRWMNTDFIFDGKQCLQLFEYLIK 168
            + W +    +N +LF+   W    + + G++C   F  + K
Sbjct: 96  -KGWGTTAYNMNQYLFDEGLWNTPYYFYRGRECHDFFRTITK 136

>KLLA0A11957g Chr1 (1041208..1041834) [627 bp, 208 aa] {ON}
           conserved hypothetical protein
          Length = 208

 Score = 32.7 bits (73), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 20/35 (57%)

Query: 129 KWDSITLQINSHLFNTHRWMNTDFIFDGKQCLQLF 163
            W+ I   +NS+LF    W +   I+DG+QC  LF
Sbjct: 129 SWEQIGRIMNSYLFQRGLWWSNSCIYDGQQCYVLF 163

>Skud_1.82 Chr1 (154805..155515) [711 bp, 236 aa] {ON} YAR027W
           (REAL)
          Length = 236

 Score = 32.7 bits (73), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 29/112 (25%), Positives = 55/112 (49%), Gaps = 7/112 (6%)

Query: 57  NLIFCSVIVLFS-NDHKLWLPLTYVFIVLDIFYGWVILILLTAPIRKKYVLGVDGQLELM 115
           N+I   +IV FS +D+K+    T   I+L +     + +L+   +   +V   D  L+L 
Sbjct: 58  NVILILLIVFFSFHDNKICA--TVFGILLFVLSRSTVSVLVG--MFGTHVSDRDFILKLS 113

Query: 116 LLVIDNKPGLDLEKWDSITLQINSHLFNTHRWMNTDFIFDGKQCLQLFEYLI 167
           + VI  KP    ++W ++   +N +LF+   W    + + G++C   F  +I
Sbjct: 114 VEVITRKPAG--KEWKAVAYNMNQYLFDEGLWYTPYYFYCGRKCRYFFRNII 163

>TDEL0D00130 Chr4 (14810..15271) [462 bp, 153 aa] {ON} 
          Length = 153

 Score = 31.6 bits (70), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 27/123 (21%), Positives = 53/123 (43%), Gaps = 11/123 (8%)

Query: 36  SYFSHQFWVLNEYLRFRICYYNLIFCSVIVLFSNDHKLWLPLTYVF-IVLDIFYGWVILI 94
           SY    + V +  L   + ++  ++C     F    K    LT++  I+L  F G++   
Sbjct: 30  SYVLINYKVFSSLLALELLFFGSLYC-----FEIRSKDIAILTFIIGIILVAFTGFI--- 81

Query: 95  LLTAPIRKKYVLGVDGQLELMLLVIDNKPGLDLEKWDSITLQINSHLFNTHRWMNTDFIF 154
             T    +   L  + +L  +  V   +PG+D E+W+ +  ++N   +   R     F +
Sbjct: 82  --TYLCSRDTGLTDENKLVFLKEVTVARPGIDNERWNVVARRLNPIFYQNSRSATAYFFY 139

Query: 155 DGK 157
           DG+
Sbjct: 140 DGE 142

>TDEL0H03830 Chr8 (646726..651474) [4749 bp, 1582 aa] {ON} Anc_7.68
            YAL029C
          Length = 1582

 Score = 32.3 bits (72), Expect = 0.77,   Method: Composition-based stats.
 Identities = 16/41 (39%), Positives = 24/41 (58%), Gaps = 3/41 (7%)

Query: 135  LQINSHLFNTHRWMNTDFIFDGKQCLQLFEYLIKPNKFIQL 175
            LQ+N ++     W  T FI +G  CLQ   +LI+ +K +QL
Sbjct: 1408 LQLNYNVTRLEEWCKTHFIPEGADCLQ---HLIQTSKLLQL 1445

>KLTH0B10274g Chr2 (865279..865761) [483 bp, 160 aa] {ON} conserved
           hypothetical protein
          Length = 160

 Score = 31.6 bits (70), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 18/72 (25%), Positives = 35/72 (48%), Gaps = 13/72 (18%)

Query: 108 VDGQLELMLLVIDNK-----------PGLDLEKWDSITLQINSHLFNTHRWMNTDFIFDG 156
           ++G++E ++L+  NK           PGL+++K   +  ++N  L  +       + +DG
Sbjct: 33  IEGRVESVILMPSNKVQFMKEIAILGPGLEMKKGGVVAAKMNPVLHKSSLLATPYYFYDG 92

Query: 157 KQCLQLF--EYL 166
           + C   F  EYL
Sbjct: 93  ESCYSCFRNEYL 104

>Smik_1.89 Chr1 (159430..160005) [576 bp, 191 aa] {ON} YAR027W
           (REAL)
          Length = 191

 Score = 31.6 bits (70), Expect = 0.94,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 36/64 (56%), Gaps = 2/64 (3%)

Query: 109 DGQLELMLLVIDNKPGLDLEKWDSITLQINSHLFNTHRWMNTDFIF-DGKQCLQLFEYLI 167
           D +++L+L VI  KP +  ++W  IT  I  H    +  +NT + F   K+C + FE L+
Sbjct: 60  DFKVKLLLEVITCKPAVKGKEWRIIT-HIMIHYLLDNSLLNTPYYFYCEKKCSKFFESLV 118

Query: 168 KPNK 171
           + N+
Sbjct: 119 EQNR 122

>TDEL0A06970 Chr1 (1221638..1222240) [603 bp, 200 aa] {ON} 
          Length = 200

 Score = 31.6 bits (70), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 13/56 (23%), Positives = 29/56 (51%), Gaps = 3/56 (5%)

Query: 111 QLELMLLVIDNKPGLDLEKWDSITLQINSHLFNTHRW---MNTDFIFDGKQCLQLF 163
           +++++ ++    PG D+++WD +  ++N+       W    N    FDGK  L+ +
Sbjct: 111 RIQILAIIATIAPGEDIDRWDEVARRVNALTDQNPTWGVYSNLWTFFDGKHGLRFY 166

>ZYRO0D04158g Chr4 (336740..341503) [4764 bp, 1587 aa] {ON} similar to
            uniprot|P19524 Saccharomyces cerevisiae YOR326W MYO2 One
            of two type V myosins involved in polarized distribution
            of mitochondria required for mitochondrion and vacuole
            inheritance and nuclear spindle orientation moves
            multiple cargo
          Length = 1587

 Score = 31.6 bits (70), Expect = 1.4,   Method: Composition-based stats.
 Identities = 14/41 (34%), Positives = 25/41 (60%), Gaps = 3/41 (7%)

Query: 135  LQINSHLFNTHRWMNTDFIFDGKQCLQLFEYLIKPNKFIQL 175
            LQ+N ++     W  T +I +G +CLQ   +L++ +K +QL
Sbjct: 1414 LQLNYNVTRLEEWCKTHYIPEGAECLQ---HLVQTSKLLQL 1451

>NCAS0A10610 Chr1 (2114082..2114984) [903 bp, 300 aa] {ON} 
          Length = 300

 Score = 30.8 bits (68), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 14/53 (26%), Positives = 29/53 (54%)

Query: 111 QLELMLLVIDNKPGLDLEKWDSITLQINSHLFNTHRWMNTDFIFDGKQCLQLF 163
           +++L   V+  KP ++L+ W+ IT  +N +L+    + N   ++D  +C   F
Sbjct: 157 KMKLYSEVLKYKPNINLKSWNIITFHMNEYLYQNGYFRNPFCLYDSSKCYNWF 209

>Smik_13.228 Chr13 complement(361792..362511) [720 bp, 239 aa] {ON}
           YCR007C (REAL)
          Length = 239

 Score = 30.4 bits (67), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 14/58 (24%), Positives = 28/58 (48%)

Query: 111 QLELMLLVIDNKPGLDLEKWDSITLQINSHLFNTHRWMNTDFIFDGKQCLQLFEYLIK 168
           Q++L+  VI  KP ++  +W  I   +N +L +   W    + +    C   F+ L++
Sbjct: 110 QIKLLSEVIKRKPPVEGVEWKIIAYNVNYYLLDKGLWNTPYYFYSKDNCYNAFKVLME 167

>Suva_16.16 Chr16 (13822..14175,14179..14226) [402 bp, 134 aa] {OFF}
           YJR161C (HSP)
          Length = 134

 Score = 29.6 bits (65), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 14/48 (29%), Positives = 23/48 (47%)

Query: 118 VIDNKPGLDLEKWDSITLQINSHLFNTHRWMNTDFIFDGKQCLQLFEY 165
            I ++  +D   WD I  ++N +LF      N +F FD   C   F++
Sbjct: 50  TIISEQKIDANGWDQIANKMNVYLFEQKVCENEEFFFDEVDCKWFFDH 97

>TBLA0B10010 Chr2 (2398498..2399028) [531 bp, 176 aa] {ON} 
          Length = 176

 Score = 30.0 bits (66), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 20/33 (60%)

Query: 105 VLGVDGQLELMLLVIDNKPGLDLEKWDSITLQI 137
           ++GV GQ  L+  VI  +PG D  KW  + +Q+
Sbjct: 74  LMGVTGQKNLVKHVIKIQPGNDRAKWGKLAVQM 106

>KLTH0B10230g Chr2 (861584..862198) [615 bp, 204 aa] {ON} some
           similarities with uniprot|P36034 Saccharomyces
           cerevisiae YKL219W COS9 Protein of unknown function
           member of a family of conserved often
           subtelomerically-encoded proteins
          Length = 204

 Score = 30.0 bits (66), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 10/40 (25%), Positives = 21/40 (52%)

Query: 125 LDLEKWDSITLQINSHLFNTHRWMNTDFIFDGKQCLQLFE 164
           +++ +WD I  ++N   +  + W    F +DG+ C   F+
Sbjct: 119 MEMREWDIIAARMNRVFYLNNSWATPYFFYDGEACHSFFK 158

>Smik_17.8 Chr17 complement(5956..6321) [366 bp, 122 aa] {OFF}
           YJR161C (HSP)
          Length = 122

 Score = 29.3 bits (64), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 11/37 (29%), Positives = 18/37 (48%), Gaps = 1/37 (2%)

Query: 118 VIDNKPGLDLEKWDSITLQINSHLFNTHRWMNTDFIF 154
           +  N PG D   W+ +   +NS+ +    W NT + F
Sbjct: 87  ITKNTPGTDPSDWEVVATNLNSYFYRNKTW-NTKYFF 122

>Suva_16.527 Chr16 complement(912397..912444,912448..912603) [204
           bp, 68 aa] {OFF} YNL336W (HSP)
          Length = 68

 Score = 28.1 bits (61), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 11/30 (36%), Positives = 16/30 (53%)

Query: 136 QINSHLFNTHRWMNTDFIFDGKQCLQLFEY 165
           ++N +LF    W   DF FDG  C   F++
Sbjct: 2   EMNVYLFEQKVWKTEDFFFDGIDCKWFFDH 31

>SAKL0H05522g Chr8 complement(496278..496697) [420 bp, 139 aa] {ON}
           no similarity
          Length = 139

 Score = 28.9 bits (63), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 12/38 (31%), Positives = 20/38 (52%)

Query: 122 KPGLDLEKWDSITLQINSHLFNTHRWMNTDFIFDGKQC 159
           KP +   KWD +   +N +LF T  +++     DG+ C
Sbjct: 42  KPNIIFLKWDIVANAMNDYLFQTGYYLSKYAFHDGQHC 79

>Kpol_1036.100 s1036 (259603..261150,261154..262107) [2502 bp, 833
           aa] {ON} (259603..261150,261154..262107) [2502 nt, 834
           aa]
          Length = 833

 Score = 29.6 bits (65), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 13/37 (35%), Positives = 23/37 (62%), Gaps = 2/37 (5%)

Query: 103 KYVLGVDGQLE--LMLLVIDNKPGLDLEKWDSITLQI 137
           KY+ G D  +   L    +D++P L+L+KWD  +++I
Sbjct: 654 KYIKGSDNHVADYLSRYGLDSQPTLNLDKWDKFSVEI 690

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.329    0.145    0.465 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 20,792,081
Number of extensions: 892241
Number of successful extensions: 2531
Number of sequences better than 10.0: 145
Number of HSP's gapped: 2565
Number of HSP's successfully gapped: 181
Length of query: 202
Length of database: 53,481,399
Length adjustment: 104
Effective length of query: 98
Effective length of database: 41,556,135
Effective search space: 4072501230
Effective search space used: 4072501230
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 63 (28.9 bits)