Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0E031606.29ON173993048850.0
Kpol_1037.226.29ON149692431080.0
TDEL0G044006.29ON149091431000.0
ZYRO0C07524g6.29ON167092430910.0
TPHA0J004006.29ON151285629620.0
KAFR0A051206.29ON147984229350.0
Ecym_30336.29ON147489128600.0
SAKL0E01540g6.29ON141592328580.0
NCAS0D021306.29ON143486428460.0
YOL004W (SIN3)6.29ON153687528440.0
ACL004W6.29ON137787028320.0
Smik_15.1666.29ON156685228180.0
NDAI0C026606.29ON165787428110.0
Suva_15.1716.29ON156185028020.0
KNAG0F029206.29ON149284128010.0
Skud_15.1586.29ON155585127650.0
KLLA0C06182g6.29ON151985527350.0
CAGL0E02475g6.29ON149387627220.0
KLTH0C10956g6.29ON143392326920.0
Kwal_56.224626.29ON154192126610.0
CAGL0J11594g6.29ON9373775322e-54
SAKL0G07612g5.397ON40373763.8
Kpol_1064.538.403ON48972764.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0E03160
         (1739 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0E03160 Chr5 (789593..794812) [5220 bp, 1739 aa] {ON} Anc_6....  1886   0.0  
Kpol_1037.22 s1037 (46639..51129) [4491 bp, 1496 aa] {ON} (46639...  1201   0.0  
TDEL0G04400 Chr7 (795501..799973) [4473 bp, 1490 aa] {ON} Anc_6....  1198   0.0  
ZYRO0C07524g Chr3 (569197..574209) [5013 bp, 1670 aa] {ON} simil...  1195   0.0  
TPHA0J00400 Chr10 complement(89956..94494) [4539 bp, 1512 aa] {O...  1145   0.0  
KAFR0A05120 Chr1 (1015307..1019746) [4440 bp, 1479 aa] {ON} Anc_...  1135   0.0  
Ecym_3033 Chr3 complement(64660..69084) [4425 bp, 1474 aa] {ON} ...  1106   0.0  
SAKL0E01540g Chr5 complement(114922..119169) [4248 bp, 1415 aa] ...  1105   0.0  
NCAS0D02130 Chr4 (394326..398630) [4305 bp, 1434 aa] {ON} Anc_6....  1100   0.0  
YOL004W Chr15 (316938..321548) [4611 bp, 1536 aa] {ON}  SIN3Comp...  1100   0.0  
ACL004W Chr3 (347727..351860) [4134 bp, 1377 aa] {ON} Syntenic h...  1095   0.0  
Smik_15.166 Chr15 (284165..288865) [4701 bp, 1566 aa] {ON} YOL00...  1090   0.0  
NDAI0C02660 Chr3 complement(615526..620499) [4974 bp, 1657 aa] {...  1087   0.0  
Suva_15.171 Chr15 (291325..296010) [4686 bp, 1561 aa] {ON} YOL00...  1083   0.0  
KNAG0F02920 Chr6 (552441..556919) [4479 bp, 1492 aa] {ON} Anc_6....  1083   0.0  
Skud_15.158 Chr15 (276509..281176) [4668 bp, 1555 aa] {ON} YOL00...  1069   0.0  
KLLA0C06182g Chr3 (544281..548840) [4560 bp, 1519 aa] {ON} simil...  1058   0.0  
CAGL0E02475g Chr5 (236580..241061) [4482 bp, 1493 aa] {ON} simil...  1053   0.0  
KLTH0C10956g Chr3 (901384..905685) [4302 bp, 1433 aa] {ON} simil...  1041   0.0  
Kwal_56.22462 s56 complement(139779..144404) [4626 bp, 1541 aa] ...  1029   0.0  
CAGL0J11594g Chr10 complement(1126896..1129709) [2814 bp, 937 aa...   209   2e-54
SAKL0G07612g Chr7 (634753..635964) [1212 bp, 403 aa] {ON} simila...    34   3.8  
Kpol_1064.53 s1064 (95468..96937) [1470 bp, 489 aa] {ON} (95468....    34   4.6  

>TBLA0E03160 Chr5 (789593..794812) [5220 bp, 1739 aa] {ON} Anc_6.29
            YOL004W
          Length = 1739

 Score = 1886 bits (4885), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 903/930 (97%), Positives = 903/930 (97%)

Query: 810  NNIAPDINDHQQQVMYEENAVRPEIDLDPSLVPIVPEPTQPIEDTLPLVEETNFFDKVKK 869
            NNIAPDINDHQQQVMYEENAVRPEIDLDPSLVPIVPEPTQPIEDTLPLVEETNFFDKVKK
Sbjct: 810  NNIAPDINDHQQQVMYEENAVRPEIDLDPSLVPIVPEPTQPIEDTLPLVEETNFFDKVKK 869

Query: 870  YIGNKTIYAEFLKVLNLYSVDLLEVDELVEKIKYYLNDNEELFSWFKNFVGYVEKPKHIE 929
            YIGNKTIYAEFLKVLNLYSVDLLEVDELVEKIKYYLNDNEELFSWFKNFVGYVEKPKHIE
Sbjct: 870  YIGNKTIYAEFLKVLNLYSVDLLEVDELVEKIKYYLNDNEELFSWFKNFVGYVEKPKHIE 929

Query: 930  NIVHEKHKLDLDLCEACGPSYKKLPKTDTLMPCSGRDEMCWEILNDEWVGHPVWASEDSG 989
            NIVHEKHKLDLDLCEACGPSYKKLPKTDTLMPCSGRDEMCWEILNDEWVGHPVWASEDSG
Sbjct: 930  NIVHEKHKLDLDLCEACGPSYKKLPKTDTLMPCSGRDEMCWEILNDEWVGHPVWASEDSG 989

Query: 990  FIAHRKINTKKPYLRLKKKVHEYDFYIESNLRTIQTLETIASKIANMTENEKCNFKLPDG 1049
            FIAHRKINTKKPYLRLKKKVHEYDFYIESNLRTIQTLETIASKIANMTENEKCNFKLPDG
Sbjct: 990  FIAHRKINTKKPYLRLKKKVHEYDFYIESNLRTIQTLETIASKIANMTENEKCNFKLPDG 1049

Query: 1050 LGHTTSTIYKKVIRKVYDKERGFEIIDALHEYPAIAVPVVLKRLKQKDEEWRRAQREWNK 1109
            LGHTTSTIYKKVIRKVYDKERGFEIIDALHEYPAIAVPVVLKRLKQKDEEWRRAQREWNK
Sbjct: 1050 LGHTTSTIYKKVIRKVYDKERGFEIIDALHEYPAIAVPVVLKRLKQKDEEWRRAQREWNK 1109

Query: 1110 VWRELEQKVFFKSLDHLGLTFKQADKKLLTTKQLISEISSIKVDQTHKRMHWLTPKPKSQ 1169
            VWRELEQKVFFKSLDHLGLTFKQADKKLLTTKQLISEISSIKVDQTHKRMHWLTPKPKSQ
Sbjct: 1110 VWRELEQKVFFKSLDHLGLTFKQADKKLLTTKQLISEISSIKVDQTHKRMHWLTPKPKSQ 1169

Query: 1170 LDFNLPDKDIIFDILSFVEIFVEHTSTYSNPEKERLIDFMKYFTSLFFSIPLEEIKEAIS 1229
            LDFNLPDKDIIFDILSFVEIFVEHTSTYSNPEKERLIDFMKYFTSLFFSIPLEEIKEAIS
Sbjct: 1170 LDFNLPDKDIIFDILSFVEIFVEHTSTYSNPEKERLIDFMKYFTSLFFSIPLEEIKEAIS 1229

Query: 1230 KRDITEKNDEKLEDKQKNGEENSKKRTSRDITLSLEDILQRTKYQRLKYGDDSDEVDGHG 1289
            KRDITEKNDEKLEDKQKNGEENSKKRTSRDITLSLEDILQRTKYQRLKYGDDSDEVDGHG
Sbjct: 1230 KRDITEKNDEKLEDKQKNGEENSKKRTSRDITLSLEDILQRTKYQRLKYGDDSDEVDGHG 1289

Query: 1290 NRHDDQKXXXXXXXXRQEAKKPWLLGTLVEEANAQGEIMHRNIFNMFSNTNMYIFIRHLT 1349
            NRHDDQK        RQEAKKPWLLGTLVEEANAQGEIMHRNIFNMFSNTNMYIFIRHLT
Sbjct: 1290 NRHDDQKLLEEEELLRQEAKKPWLLGTLVEEANAQGEIMHRNIFNMFSNTNMYIFIRHLT 1349

Query: 1350 TMYERLHEIKQMNDKVSREISGRKISKFAKDLNLISTQLTEMGLDFSEGDVYQQLLVLCK 1409
            TMYERLHEIKQMNDKVSREISGRKISKFAKDLNLISTQLTEMGLDFSEGDVYQQLLVLCK
Sbjct: 1350 TMYERLHEIKQMNDKVSREISGRKISKFAKDLNLISTQLTEMGLDFSEGDVYQQLLVLCK 1409

Query: 1410 RLILGDLEHQWFEESLRQAFNNKAFKLYTLDKVTQALVKHAHTIISDLKTTEIMALFEKD 1469
            RLILGDLEHQWFEESLRQAFNNKAFKLYTLDKVTQALVKHAHTIISDLKTTEIMALFEKD
Sbjct: 1410 RLILGDLEHQWFEESLRQAFNNKAFKLYTLDKVTQALVKHAHTIISDLKTTEIMALFEKD 1469

Query: 1470 RTKNSTSSKDQILYRLQTRARMTHNENMFRIEYNNTTKHICIQYIALDDLTVKDAKTLEE 1529
            RTKNSTSSKDQILYRLQTRARMTHNENMFRIEYNNTTKHICIQYIALDDLTVKDAKTLEE
Sbjct: 1470 RTKNSTSSKDQILYRLQTRARMTHNENMFRIEYNNTTKHICIQYIALDDLTVKDAKTLEE 1529

Query: 1530 KWKYYITSYALSHPTEGIFQENIQIPFXXXXXXXXXXXXXXXXXXXKQTKSLMKYSPEGI 1589
            KWKYYITSYALSHPTEGIFQENIQIPF                   KQTKSLMKYSPEGI
Sbjct: 1530 KWKYYITSYALSHPTEGIFQENIQIPFLERIIEEEQLYEDEETDDQKQTKSLMKYSPEGI 1589

Query: 1590 SGSTLKIKIDPQNYCLNIEEGSFDIFSRKSLNQFPVKLTQDSKYGTMPKLKNTVEKFLNS 1649
            SGSTLKIKIDPQNYCLNIEEGSFDIFSRKSLNQFPVKLTQDSKYGTMPKLKNTVEKFLNS
Sbjct: 1590 SGSTLKIKIDPQNYCLNIEEGSFDIFSRKSLNQFPVKLTQDSKYGTMPKLKNTVEKFLNS 1649

Query: 1650 KMGWKRAISKDQMESIESKWDHLSNNGNLEGYQEKSILKDVNGTDISKISPMKTFTVTES 1709
            KMGWKRAISKDQMESIESKWDHLSNNGNLEGYQEKSILKDVNGTDISKISPMKTFTVTES
Sbjct: 1650 KMGWKRAISKDQMESIESKWDHLSNNGNLEGYQEKSILKDVNGTDISKISPMKTFTVTES 1709

Query: 1710 ANGVPNDKADGEERGNDTTAEEVGNESTVC 1739
            ANGVPNDKADGEERGNDTTAEEVGNESTVC
Sbjct: 1710 ANGVPNDKADGEERGNDTTAEEVGNESTVC 1739

 Score = 1036 bits (2678), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 534/678 (78%), Positives = 534/678 (78%)

Query: 54  VPSVATTNDLASNVLKQQPSQQPFRLPSISDLNVESNVMVNQHQQLQHPSISPSQNMTSM 113
           VPSVATTNDLASNVLKQQPSQQPFRLPSISDLNVESNVMVNQHQQLQHPSISPSQNMTSM
Sbjct: 54  VPSVATTNDLASNVLKQQPSQQPFRLPSISDLNVESNVMVNQHQQLQHPSISPSQNMTSM 113

Query: 114 NTGIMNSNTSGISRHNSNPTPKSNPLKVSSFDNPLPPLSNKSIGIVNSNSPXXXXXXXXX 173
           NTGIMNSNTSGISRHNSNPTPKSNPLKVSSFDNPLPPLSNKSIGIVNSNSP         
Sbjct: 114 NTGIMNSNTSGISRHNSNPTPKSNPLKVSSFDNPLPPLSNKSIGIVNSNSPTNSHATINT 173

Query: 174 XXXXXXXXXXMVNPNPTIPSVAVNSASPIVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 233
                     MVNPNPTIPSVAVNSASPIV                              
Sbjct: 174 NTNSTSNINSMVNPNPTIPSVAVNSASPIVHSQSPLLNQQPQEQQQQQHLLQNMQPHQQQ 233

Query: 234 XXXXXXXXXXXXXXDMSNKENKNIKPNMGMIPVSNLNQEXXXXXXXXXXXXXXXXXQDSP 293
                         DMSNKENKNIKPNMGMIPVSNLNQE                 QDSP
Sbjct: 234 KQKQQSLQSNSNKLDMSNKENKNIKPNMGMIPVSNLNQETDATTATTTANTMPNNTQDSP 293

Query: 294 KEDNQYRPLNVKDALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIARVSSLF 353
           KEDNQYRPLNVKDALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIARVSSLF
Sbjct: 294 KEDNQYRPLNVKDALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIARVSSLF 353

Query: 354 HDYPSLIQGFNTFLPQGYRIECSSNPNLPITVITPMGTTTVSGVLETSVTENQNHQLQHS 413
           HDYPSLIQGFNTFLPQGYRIECSSNPNLPITVITPMGTTTVSGVLETSVTENQNHQLQHS
Sbjct: 354 HDYPSLIQGFNTFLPQGYRIECSSNPNLPITVITPMGTTTVSGVLETSVTENQNHQLQHS 413

Query: 414 LPQPSTTASASNVDSKVSSISGIMGPSNITEXXXXXXXXXXXXLINVNDSAPISGSISST 473
           LPQPSTTASASNVDSKVSSISGIMGPSNITE            LINVNDSAPISGSISST
Sbjct: 414 LPQPSTTASASNVDSKVSSISGIMGPSNITEQSQQQQRHHPQQLINVNDSAPISGSISST 473

Query: 474 VPSNVEPTNMXXXXXXXXXXXXXLPNTNTPKSXXXXXXXXXXXXXXXFPMVSSVSPPLQE 533
           VPSNVEPTNM             LPNTNTPKS               FPMVSSVSPPLQE
Sbjct: 474 VPSNVEPTNMNAAANAAISAASALPNTNTPKSQTTPPIATAGTATQQFPMVSSVSPPLQE 533

Query: 534 LPEQRRTQDVEFSQAISYVNKIKNRFANQPYIYKHFLEILQTYQREQKPINEVYSQVTVL 593
           LPEQRRTQDVEFSQAISYVNKIKNRFANQPYIYKHFLEILQTYQREQKPINEVYSQVTVL
Sbjct: 534 LPEQRRTQDVEFSQAISYVNKIKNRFANQPYIYKHFLEILQTYQREQKPINEVYSQVTVL 593

Query: 594 FQEAPDLLEDFKKFLPDSSANNNGSIVTSQEENFMYANGFNQQQPHLTPHSEIQAQNLPP 653
           FQEAPDLLEDFKKFLPDSSANNNGSIVTSQEENFMYANGFNQQQPHLTPHSEIQAQNLPP
Sbjct: 594 FQEAPDLLEDFKKFLPDSSANNNGSIVTSQEENFMYANGFNQQQPHLTPHSEIQAQNLPP 653

Query: 654 LGSFSTQPNGVFPKQESQQIVPTSRFDANNDXXXXXXXXXXXXXXXXXXXXXXXXNVHPE 713
           LGSFSTQPNGVFPKQESQQIVPTSRFDANND                        NVHPE
Sbjct: 654 LGSFSTQPNGVFPKQESQQIVPTSRFDANNDQLAQQQHRHQQQQQQIPQQSTMYQNVHPE 713

Query: 714 VVPVSDLRSQPETMHAPT 731
           VVPVSDLRSQPETMHAPT
Sbjct: 714 VVPVSDLRSQPETMHAPT 731

>Kpol_1037.22 s1037 (46639..51129) [4491 bp, 1496 aa] {ON}
            (46639..51129) [4491 nt, 1497 aa]
          Length = 1496

 Score = 1201 bits (3108), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 581/924 (62%), Positives = 710/924 (76%), Gaps = 26/924 (2%)

Query: 827  ENAVRPEIDLDPSLVPIVPEPTQPIEDTLPLVEETNFFDKVKKYIGNKTIYAEFLKVLNL 886
            E  VRPEIDLDPS+VP++PEPT+PIE++L LVEE NFFDK KK+IGNK +Y EFLK+LNL
Sbjct: 586  EGIVRPEIDLDPSIVPVIPEPTEPIEESLSLVEEANFFDKAKKFIGNKQVYVEFLKILNL 645

Query: 887  YSVDLLEVDELVEKIKYYLNDNEELFSWFKNFVGYVEKPKHIENIVHEKHKLDLDLCEAC 946
            YS D+L +D+L+EK+ YYL  N+ELF WFKNFVG+ +KPKHIEN+VHEKHKLDLDLCEAC
Sbjct: 646  YSQDILSLDDLIEKVDYYLGSNKELFDWFKNFVGFQDKPKHIENVVHEKHKLDLDLCEAC 705

Query: 947  GPSYKKLPKTDTLMPCSGRDEMCWEILNDEWVGHPVWASEDSGFIAHRKINTKKPYLRLK 1006
            GPSYKKLPKTDT MPCSGRDEMCWE+LNDEWVGHPVWASEDSGFIAHRK   ++   +++
Sbjct: 706  GPSYKKLPKTDTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIE 765

Query: 1007 KKVHEYDFYIESNLRTIQTLETIASKIANMTENEKCNFKLPDGLGHTTSTIYKKVIRKVY 1066
            ++ HEYDFYIESNLRTIQTLETIASKIANMTE EK  FKLP GLGHT++TIY+KVIRKVY
Sbjct: 766  EERHEYDFYIESNLRTIQTLETIASKIANMTEEEKQAFKLPIGLGHTSTTIYQKVIRKVY 825

Query: 1067 DKERGFEIIDALHEYPAIAVPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVFFKSLDHL 1126
            DKERGFEIIDALHEYP++AVPVVLKRLKQKD+EWRRAQREWNKVWRELEQKVFFKSLDHL
Sbjct: 826  DKERGFEIIDALHEYPSVAVPVVLKRLKQKDKEWRRAQREWNKVWRELEQKVFFKSLDHL 885

Query: 1127 GLTFKQADKKLLTTKQLISEISSIKVDQTHKRMHWLTPKPKSQLDFNLPDKDIIFDILSF 1186
            GLTFKQ+DKKLLTTKQL++EISSIKVDQT+KR+HWLTPKPKSQLD+ + DK ++FDIL  
Sbjct: 886  GLTFKQSDKKLLTTKQLLAEISSIKVDQTNKRIHWLTPKPKSQLDYEVKDKRVLFDILRL 945

Query: 1187 VEIFVEHTSTYSNPEKERLIDFMKYFTSLFFSIPLEEIKEAISKRDITEKNDEKLEDKQK 1246
             ++F+ HTS+YSNP+KERL DF++ +  LFFSIP+ EIK+A+   +    N ++L++ ++
Sbjct: 946  ADVFINHTSSYSNPDKERLRDFLQSYIGLFFSIPIREIKDAV---EAAIDNGKQLDENEQ 1002

Query: 1247 NGEENSKKRTSRDITLSLEDILQRTKYQRLKYGDDSDEVDGHGNRHDDQKXXXXXXXXRQ 1306
            N  + +  +  RD+ + L DIL R++YQRLK+  DS E           +        RQ
Sbjct: 1003 NSSKKNSNKRPRDVEICLSDILNRSRYQRLKHSLDSSEASLGAVSPGQNEQDDMDEMIRQ 1062

Query: 1307 EAKKPWLLGTLVEEANAQGEIMHRNIFNMFSNTNMYIFIRHLTTMYERLHEIKQMNDKVS 1366
            EAKKPWLLG+LVEEAN+QG I +R I+NMF+N NMY+F+R+L T+Y+RLHE+K +ND V+
Sbjct: 1063 EAKKPWLLGSLVEEANSQGLIQNRKIYNMFANVNMYVFMRNLITIYDRLHEVKDINDVVT 1122

Query: 1367 REISGRKISKFAKDLNLISTQLTEMGLDFSEGDVYQQLLVLCKRLILGDLEHQWFEESLR 1426
            +EI+GRK+ +FAKDLNLIS QL  MGLDFS GD Y QLL+L KRLI GDLEHQWFEESLR
Sbjct: 1123 KEINGRKVVQFAKDLNLISAQLKNMGLDFSGGDSYTQLLLLSKRLIEGDLEHQWFEESLR 1182

Query: 1427 QAFNNKAFKLYTLDKVTQALVKHAHTIISDLKTTEIMALFEKDRTKNSTSSKDQILYRLQ 1486
            QA+ N+AFKLYT+DKV Q+LVKHAH I++D K++++MALFEKDR  +ST+SKDQILYRLQ
Sbjct: 1183 QAYRNRAFKLYTIDKVIQSLVKHAHAIMTDSKSSDVMALFEKDRISSSTTSKDQILYRLQ 1242

Query: 1487 TRARMTHNENMFRIEYNNTTKHICIQYIALDDLTVKDAKTLEEKWKYYITSYALSHPTEG 1546
            TR+ M+  E+MFRIEYN     I IQYIALDDLT+++ KTLE+KWKYYITSY+LSHPTEG
Sbjct: 1243 TRSHMSTTEHMFRIEYNTKKSSISIQYIALDDLTLEEPKTLEDKWKYYITSYSLSHPTEG 1302

Query: 1547 IFQENIQIPFXXXXXXXXXXXXXXXXXXXKQTKSLMKYSPEGISGSTLKIKIDPQNYCLN 1606
            I QE I+IPF                          KYSPEG+S S L IKIDP+ Y L 
Sbjct: 1303 IPQEEIKIPFLDKVIESEQVHMEDEDDNP-------KYSPEGVSKSNLMIKIDPETYRLE 1355

Query: 1607 IEEGSFDIFSRKSLNQFPVKLTQDSKYGTMPKLKNTVEKFLNSKMGWKRAISKDQMESIE 1666
            +E GSFDIFSRKS+N+FPV +  +S        +N  + FLN K GWKR +S D +  IE
Sbjct: 1356 VEPGSFDIFSRKSVNKFPVDVFSESYKVKKQTRRNRCKNFLNGKHGWKRQLSSDAISKIE 1415

Query: 1667 SKWDHLSNNGNLEGYQEKSI----------LKDVNGTDISKISPMKTFTVTESANGVPND 1716
             K++ L N      +Q++S           L   + T   + S   + T   +   VP +
Sbjct: 1416 QKFNDLKNG----TFQQRSRSATSETTSVPLNASDSTQKEQESTGTSETSQPALQKVPIN 1471

Query: 1717 KA--DGEERGNDTTAEEVGNESTV 1738
             A  D EERGNDTT EEV +ES V
Sbjct: 1472 SAEPDQEERGNDTTTEEVESESVV 1495

 Score =  175 bits (443), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 78/97 (80%), Positives = 87/97 (89%)

Query: 299 YRPLNVKDALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIARVSSLFHDYPS 358
           YRPLNVKDAL+YLEQVK QFNSRPD+YNHFLDIMKDFKSQ+IDTPGVI RVS+LF  YP+
Sbjct: 121 YRPLNVKDALTYLEQVKLQFNSRPDIYNHFLDIMKDFKSQSIDTPGVIERVSTLFRGYPN 180

Query: 359 LIQGFNTFLPQGYRIECSSNPNLPITVITPMGTTTVS 395
           LIQGFNTFLPQGY IECSSNP+ PI V TP+G+  V+
Sbjct: 181 LIQGFNTFLPQGYTIECSSNPDDPIKVTTPLGSQIVT 217

 Score =  148 bits (374), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 83/149 (55%), Positives = 99/149 (66%), Gaps = 10/149 (6%)

Query: 525 SSVSPPLQELPEQRRTQDVEFSQAISYVNKIKNRFANQPYIYKHFLEILQTYQREQKPIN 584
           ++V+  +Q   +  +  DVEFSQA+SYVNKIKNRFA+QP IYKHFLEILQTYQREQKPI+
Sbjct: 343 TTVANNIQGTTQIEKPADVEFSQAVSYVNKIKNRFADQPDIYKHFLEILQTYQREQKPIS 402

Query: 585 EVYSQVTVLFQEAPDLLEDFKKFLPDSSAN-------NNGSIVTSQEENFMYANGFNQQQ 637
           EVY+QVTVLFQ APDLL+DFKKFLPDSS +               Q++  MY       Q
Sbjct: 403 EVYAQVTVLFQNAPDLLDDFKKFLPDSSPSVTTQQPVQPQQQALPQQQQPMYGVNNGYYQ 462

Query: 638 PHLTPHSEIQAQNLPPLGSFSTQPNGVFP 666
               P +    QNLPPLG+FS   NG  P
Sbjct: 463 AGKIPSAN---QNLPPLGNFSPPSNGAVP 488

 Score = 55.1 bits (131), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 45/71 (63%), Gaps = 2/71 (2%)

Query: 300 RPLNVK--DALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIARVSSLFHDYP 357
           +P +V+   A+SY+ ++K +F  +PD+Y HFL+I++ ++ +      V A+V+ LF + P
Sbjct: 357 KPADVEFSQAVSYVNKIKNRFADQPDIYKHFLEILQTYQREQKPISEVYAQVTVLFQNAP 416

Query: 358 SLIQGFNTFLP 368
            L+  F  FLP
Sbjct: 417 DLLDDFKKFLP 427

 Score = 50.1 bits (118), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 41/62 (66%)

Query: 548 AISYVNKIKNRFANQPYIYKHFLEILQTYQREQKPINEVYSQVTVLFQEAPDLLEDFKKF 607
           A++Y+ ++K +F ++P IY HFL+I++ ++ +      V  +V+ LF+  P+L++ F  F
Sbjct: 129 ALTYLEQVKLQFNSRPDIYNHFLDIMKDFKSQSIDTPGVIERVSTLFRGYPNLIQGFNTF 188

Query: 608 LP 609
           LP
Sbjct: 189 LP 190

 Score = 38.9 bits (89), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 42/72 (58%), Gaps = 2/72 (2%)

Query: 79  LPSISDLNVESNVMVNQHQQLQHPSISPSQNMTSMNTGIMNSNTSGISRHNSNPTPKSNP 138
           LPS S++N E+   ++Q    +  + +PS    + NTG+   N+S +SR N   T  S  
Sbjct: 28  LPSFSNINPENTTNISQQSNNKSTNTTPSSTSNTPNTGVKLENSSSLSRPNLPKT--STT 85

Query: 139 LKVSSFDNPLPP 150
           L V+SFDNPLPP
Sbjct: 86  LSVASFDNPLPP 97

>TDEL0G04400 Chr7 (795501..799973) [4473 bp, 1490 aa] {ON} Anc_6.29
            YOL004W
          Length = 1490

 Score = 1198 bits (3100), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 582/914 (63%), Positives = 707/914 (77%), Gaps = 13/914 (1%)

Query: 825  YEENAVRPEIDLDPSLVPIVPEPTQPIEDTLPLVEETNFFDKVKKYIGNKTIYAEFLKVL 884
            Y + AVRPEIDLDPS+VP+VPEPT PIED+L LVEET+FFD+ KK+IGNK IY EFLK+L
Sbjct: 583  YLDIAVRPEIDLDPSIVPVVPEPTAPIEDSLTLVEETSFFDRAKKFIGNKQIYTEFLKIL 642

Query: 885  NLYSVDLLEVDELVEKIKYYLNDNEELFSWFKNFVGYVEKPKHIENIVHEKHKLDLDLCE 944
            NL+S DLL+VDELV ++++YL  N+ELF WFKNFVG+ +KPKHIENIVHEKH+LDLDLCE
Sbjct: 643  NLFSQDLLDVDELVGRVEHYLGGNKELFVWFKNFVGFQDKPKHIENIVHEKHRLDLDLCE 702

Query: 945  ACGPSYKKLPKTDTLMPCSGRDEMCWEILNDEWVGHPVWASEDSGFIAHRKINTKKPYLR 1004
            ACGPSYKKLPK+DT MPCSGRDEMCW +LNDEWVGHPVWASEDSGFIAHRK   ++   +
Sbjct: 703  ACGPSYKKLPKSDTFMPCSGRDEMCWAVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFK 762

Query: 1005 LKKKVHEYDFYIESNLRTIQTLETIASKIANMTENEKCNFKLPDGLGHTTSTIYKKVIRK 1064
            ++++ HEYDFYIESNLRTIQTLETIASKIANM+E EK  FKLP GLGHT+ TIYKKVIRK
Sbjct: 763  IEEERHEYDFYIESNLRTIQTLETIASKIANMSEEEKATFKLPPGLGHTSLTIYKKVIRK 822

Query: 1065 VYDKERGFEIIDALHEYPAIAVPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVFFKSLD 1124
            VYDKERGFEIIDALHEYPAIAVPVVLKRLKQKDEEWRRAQREWNKVWRELEQKV++KSLD
Sbjct: 823  VYDKERGFEIIDALHEYPAIAVPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVYYKSLD 882

Query: 1125 HLGLTFKQADKKLLTTKQLISEISSIKVDQTHKRMHWLTPKPKSQLDFNLPDKDIIFDIL 1184
            HLGLTFKQADKKLLTTKQLISEI SIK DQT+KRMHWLTPKPK QLD+ +PDK + FDIL
Sbjct: 883  HLGLTFKQADKKLLTTKQLISEIGSIKTDQTNKRMHWLTPKPKDQLDYYVPDKSVFFDIL 942

Query: 1185 SFVEIFVEHTSTYSNPEKERLIDFMKYFTSLFFSIPLEEIKEAISKRDITEKNDEKLEDK 1244
            S  + F+ H S+YSNP+K RL D  K F SLFFSIP+ E+ EA+S+R   + + E    K
Sbjct: 943  SLTDTFINHNSSYSNPDKIRLKDLFKIFVSLFFSIPMYEVNEAVSRRGNLDDDKEDSTQK 1002

Query: 1245 QKNGEENSKKRTSRDITLSLEDILQRTKYQRLKYGDDSDEVDGHGNRHDDQKXXXXXXXX 1304
             ++   N+ KR   D  +SL ++L R K QR K    +DE         + +        
Sbjct: 1003 MESDNLNNSKRPRED-EISLSEVLHRAKNQRFK-SRAADETSEESAAEPEPELNEEEETI 1060

Query: 1305 RQEAKKPWLLGTLVEEANAQGEIMHRNIFNMFSNTNMYIFIRHLTTMYERLHEIKQMNDK 1364
            RQEAKKPWLLG LVEE NAQG I +R  FNMF+NTN+Y+F RHLTT+YERL E+K+MND 
Sbjct: 1061 RQEAKKPWLLGNLVEEVNAQGLINNRKTFNMFANTNIYVFFRHLTTLYERLEEVKKMNDA 1120

Query: 1365 VSREISGRKISKFAKDLNLISTQLTEMGLDFSEGDVYQQLLVLCKRLILGDLEHQWFEES 1424
            V++EI+ RK+ +FAKDLNLIS QL EMGLDF   D Y+QL  LCKRLI GD+EHQWFEES
Sbjct: 1121 VTKEINSRKVVQFAKDLNLISQQLKEMGLDFEGADAYEQLRHLCKRLIEGDIEHQWFEES 1180

Query: 1425 LRQAFNNKAFKLYTLDKVTQALVKHAHTIISDLKTTEIMALFEKDRTKNSTSSKDQILYR 1484
            LRQA+NNKAFKLYT+DKV Q+LVKHAHTI++D KT+EIM  FEKDRT+ +TS+KDQILYR
Sbjct: 1181 LRQAYNNKAFKLYTVDKVIQSLVKHAHTILTDSKTSEIMTSFEKDRTQINTSAKDQILYR 1240

Query: 1485 LQTRARMTHNENMFRIEYNNTTKHICIQYIALDDLTVKDAKTLEEKWKYYITSYALSHPT 1544
            LQ R+ M+  ENMFRIEYN  +K++ IQ+IA+DDLT+ + ++LEEKW+YY+TSY+LSHPT
Sbjct: 1241 LQVRSYMSSTENMFRIEYNKQSKNVRIQFIAVDDLTLAEPRSLEEKWRYYVTSYSLSHPT 1300

Query: 1545 EGIFQENIQIPFXXXXXXXXXXXXXXXXXXXKQTKSLMKYSPEGISGSTLKIKIDPQNYC 1604
            EGI QE +Q+PF                       S+ K+SPEG+S STLKIKIDP+ Y 
Sbjct: 1301 EGISQEELQLPFLEKVLETEEDYGSDVDNF-----SIDKFSPEGVSKSTLKIKIDPETYL 1355

Query: 1605 LNIEEGSFDIFSRKSLNQFPVKLTQDSKYGTMPKLKNTVEKFLNSKMGWKRAISKDQMES 1664
            L+IE GS+D+FSRKS+N+FPV +  +       K KN V +FL SK GWK+ +  DQ+++
Sbjct: 1356 LDIEAGSYDVFSRKSVNRFPVIVDSNDYTTKKEKKKNMVIQFLESKKGWKKNLDDDQVKA 1415

Query: 1665 IESKWDHLSNNGNLEGYQEKSILKDVNGTDI---SKISPMKTFTVTESANGVPNDKADGE 1721
            I+ K   +  NG+L+ + E S  +    ++I   SK+   K  TV +  N +P +  + E
Sbjct: 1416 IQEKLARVKENGSLDDFNEAS--QTQQASEIIAPSKVEQSKESTVAD-VNSLPKELVEAE 1472

Query: 1722 ERGNDTTAEEVGNE 1735
            +RGNDTTA+EV  E
Sbjct: 1473 DRGNDTTADEVDPE 1486

 Score =  192 bits (487), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 86/108 (79%), Positives = 96/108 (88%)

Query: 296 DNQYRPLNVKDALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIARVSSLFHD 355
           D  YRPLNVKDALSYLEQVK+QFNSRPDVYNHFLDIMKDFKSQAIDTPGVI RVS+LF  
Sbjct: 188 DAYYRPLNVKDALSYLEQVKYQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIDRVSTLFKG 247

Query: 356 YPSLIQGFNTFLPQGYRIECSSNPNLPITVITPMGTTTVSGVLETSVT 403
           YP LIQGFNTFLPQGYRIECS+NP+ PI V TPMG+++V+G +E +V 
Sbjct: 248 YPGLIQGFNTFLPQGYRIECSANPDEPIRVTTPMGSSSVAGTIENAVA 295

 Score =  159 bits (403), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 86/134 (64%), Positives = 95/134 (70%), Gaps = 11/134 (8%)

Query: 538 RRTQDVEFSQAISYVNKIKNRFANQPYIYKHFLEILQTYQREQKPINEVYSQVTVLFQEA 597
           ++T DVEFSQAI+YVNKIKNRFA QP IYKHFLEILQTYQREQKPINEVY+QVTVLFQ A
Sbjct: 375 KKTADVEFSQAINYVNKIKNRFAEQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQNA 434

Query: 598 PDLLEDFKKFLPDSSANNNGSIVTSQEEN-----FMYANGFNQQQPHLTPHSEIQAQNLP 652
           PDLL+DFKKFLPDSS + N               F  +  +N+  P   P S    QNLP
Sbjct: 435 PDLLDDFKKFLPDSSPSANRQQQQPGVLQQQSPAFGLSAYYNETSP---PTSR---QNLP 488

Query: 653 PLGSFSTQPNGVFP 666
           PLGSFS  PNG  P
Sbjct: 489 PLGSFSPPPNGAVP 502

 Score = 53.1 bits (126), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 40/62 (64%)

Query: 307 ALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIARVSSLFHDYPSLIQGFNTF 366
           A++Y+ ++K +F  +PD+Y HFL+I++ ++ +      V A+V+ LF + P L+  F  F
Sbjct: 385 AINYVNKIKNRFAEQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQNAPDLLDDFKKF 444

Query: 367 LP 368
           LP
Sbjct: 445 LP 446

 Score = 50.1 bits (118), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 40/62 (64%)

Query: 548 AISYVNKIKNRFANQPYIYKHFLEILQTYQREQKPINEVYSQVTVLFQEAPDLLEDFKKF 607
           A+SY+ ++K +F ++P +Y HFL+I++ ++ +      V  +V+ LF+  P L++ F  F
Sbjct: 199 ALSYLEQVKYQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIDRVSTLFKGYPGLIQGFNTF 258

Query: 608 LP 609
           LP
Sbjct: 259 LP 260

 Score = 34.3 bits (77), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 39/82 (47%), Gaps = 12/82 (14%)

Query: 79  LPSISDLNVES-----NVMVNQHQQLQHPSISPSQNMTSMNTGIMNSNTSGISRHNSNPT 133
           LPSISDL+ ES     + + + +  L+ PS+  +    +   G   + T  I     NP 
Sbjct: 75  LPSISDLSGESAHNGKDGLTSSNTPLRLPSVQSTYGSKAPGAGQEVNGT--IMESTVNPA 132

Query: 134 PK-----SNPLKVSSFDNPLPP 150
           P      S  L  +SFDNPLPP
Sbjct: 133 PAQGRQNSVGLSFASFDNPLPP 154

>ZYRO0C07524g Chr3 (569197..574209) [5013 bp, 1670 aa] {ON} similar to
            uniprot|P22579 Saccharomyces cerevisiae YOL004W SIN3 DNA
            binding protein involved in transcriptional regulation
          Length = 1670

 Score = 1195 bits (3091), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 570/924 (61%), Positives = 722/924 (78%), Gaps = 21/924 (2%)

Query: 820  QQQVMYEENAVRPEIDLDPSLVPIVPEPTQPIEDTLPLVEETNFFDKVKKYIGNKTIYAE 879
            QQ+V Y + AVRPEIDLDPS+VP+VPEPT+PIED+L LVEET+FFDK KK+IGNK +Y E
Sbjct: 755  QQEVQYVDIAVRPEIDLDPSIVPVVPEPTEPIEDSLSLVEETSFFDKAKKFIGNKQLYTE 814

Query: 880  FLKVLNLYSVDLLEVDELVEKIKYYLNDNEELFSWFKNFVGYVEKPKHIENIVHEKHKLD 939
            FLK+LNLYS DLL++D LVEK+++YL  ++ELF+WFKNFVGY ++PK+IEN++HEKH+LD
Sbjct: 815  FLKILNLYSQDLLDIDGLVEKVEHYLGGSKELFTWFKNFVGYQDRPKNIENVIHEKHRLD 874

Query: 940  LDLCEACGPSYKKLPKTDTLMPCSGRDEMCWEILNDEWVGHPVWASEDSGFIAHRKINTK 999
            LD+CEA GPSYKKLPK+DT MPCSGRDEMCWE+LNDEW+GHPVWASEDSGFIAHRK   +
Sbjct: 875  LDMCEASGPSYKKLPKSDTFMPCSGRDEMCWEVLNDEWIGHPVWASEDSGFIAHRKNQYE 934

Query: 1000 KPYLRLKKKVHEYDFYIESNLRTIQTLETIASKIANMTENEKCNFKLPDGLGHTTSTIYK 1059
            +   +++++ HEYDFYIESNLRTIQTLETIASKIANMTE EK NFKLP GLGHT+ TIYK
Sbjct: 935  ETLFKVEEERHEYDFYIESNLRTIQTLETIASKIANMTEEEKANFKLPPGLGHTSLTIYK 994

Query: 1060 KVIRKVYDKERGFEIIDALHEYPAIAVPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVF 1119
            KVIRKVYDKERGFEIIDALHE+PA+AVPVVLKRLKQKDEEWRRAQREWNKVWRELEQKV+
Sbjct: 995  KVIRKVYDKERGFEIIDALHEHPAVAVPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVY 1054

Query: 1120 FKSLDHLGLTFKQADKKLLTTKQLISEISSIKVDQTHKRMHWLTPKPKSQLDFNLPDKDI 1179
            FKSLDHLGLTFKQADKKLLTTKQLISEISSIKVDQT+KR+HWLTPKPKSQLD++ PD++I
Sbjct: 1055 FKSLDHLGLTFKQADKKLLTTKQLISEISSIKVDQTNKRIHWLTPKPKSQLDYDFPDREI 1114

Query: 1180 IFDILSFVEIFVEHTSTYSNPEKERLIDFMKYFTSLFFSIPLEEIKEAISKRDITEKNDE 1239
              DILS  E+F+ HT  YSN +KERL DF+K F SLFFSIP+ E+ + + +R  + K +E
Sbjct: 1115 FCDILSLTEVFLNHTGNYSNSDKERLKDFLKSFLSLFFSIPVSEVNDGLRRRSPSNK-EE 1173

Query: 1240 KLEDKQKNGEENSKKRTSRDITLSLEDILQRTKYQRLKYGDDSDEVDGHGNRHDD----- 1294
               +K++NG   +  +  R+I L L DIL R KYQ+LK   D +E  G   + ++     
Sbjct: 1174 HEANKKENGTALAHGKRPREIELPLRDILHRNKYQKLKLRSDGEE--GSIGQSEEGLDEQ 1231

Query: 1295 QKXXXXXXXXRQEAKKPWLLGTLVEEANAQGEIMHRNIFNMFSNTNMYIFIRHLTTMYER 1354
            ++        +QEAKKPWLLG +VEEANAQG I +R  FN+F+NT++Y+F RHLTT+YER
Sbjct: 1232 EEVDEEEEIIKQEAKKPWLLGNIVEEANAQGIISNRKSFNLFANTSIYVFFRHLTTLYER 1291

Query: 1355 LHEIKQMNDKVSREISGRKISKFAKDLNLISTQLTEMGLDFSEGDVYQQLLVLCKRLILG 1414
            L E+K ++ +V++EI+ RK+S+FAKDLNLIS QL  MGLDF+  D Y+QLL L KRLI G
Sbjct: 1292 LIEVKSIDQEVTQEINSRKVSQFAKDLNLISEQLKNMGLDFAGLDAYEQLLHLSKRLIEG 1351

Query: 1415 DLEHQWFEESLRQAFNNKAFKLYTLDKVTQALVKHAHTIISDLKTTEIMALFEKDRTKNS 1474
            D+EHQWFEESLRQA+NN+AFK YT+DKV QALVKHAHTI++D+K +EIM LFEKDRT  +
Sbjct: 1352 DIEHQWFEESLRQAYNNRAFKFYTVDKVVQALVKHAHTILTDIKCSEIMVLFEKDRTLAT 1411

Query: 1475 TSSKDQILYRLQTRARMTHNENMFRIEYNNTTKHICIQYIALDDLTVKDAKTLEEKWKYY 1534
            TS+KDQILYR+Q R+ M++ ENMFRIE+N  +KH+CIQYIA+DDLT+ +AK+LE+KWKYY
Sbjct: 1412 TSAKDQILYRMQARSHMSNTENMFRIEFNRISKHVCIQYIAIDDLTLAEAKSLEDKWKYY 1471

Query: 1535 ITSYALSHPTEGIFQENIQIPFXXXXXXXXXXXXXXXXXXXKQTKSLMKYSPEGISGSTL 1594
            +TSY+LSHPTEGI  E++Q+PF                   +      K+SPEG+S S+L
Sbjct: 1472 VTSYSLSHPTEGISHEDLQVPF-------LEKIIESEQEYDEDNGGDPKFSPEGVSKSSL 1524

Query: 1595 KIKIDPQNYCLNIEEGSFDIFSRKSLNQFPVKLTQDSKYGTMPKLKNTVEKFLNSKMGWK 1654
            +IKIDP+ Y L +E GS D+FSRK++N+FP++   +S    + K    +  +L+S+ GWK
Sbjct: 1525 RIKIDPETYFLEVEPGSCDVFSRKAVNKFPLEKNSESHKTKVDKKNELIRGYLDSEKGWK 1584

Query: 1655 RAISKDQMESIESKWDHLSNNGNLEGYQEK-----SILKDVNGTDISKISPMKTFTVTES 1709
            + +    ++S+E K + + N G L+GY+ +     S  K+   +D  +           +
Sbjct: 1585 KNLDAKSIQSVEEKLNFVKNYGTLQGYRAQENGLESTTKEAPFSDAVERKADSAAQADGA 1644

Query: 1710 ANGVPNDKADGEER-GNDTTAEEV 1732
            ANG P++ A  EER GNDTTAE+V
Sbjct: 1645 ANGGPSNTAGVEERGGNDTTAEDV 1668

 Score =  193 bits (491), Expect = 9e-49,   Method: Compositional matrix adjust.
 Identities = 91/125 (72%), Positives = 103/125 (82%), Gaps = 3/125 (2%)

Query: 293 PKEDNQYRPLNVKDALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIARVSSL 352
           P  D  YRPLNVKDALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVI RVS+L
Sbjct: 271 PLHDQYYRPLNVKDALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTL 330

Query: 353 FHDYPSLIQGFNTFLPQGYRIECSSNPNLPITVITPMGTTTVSGVLE---TSVTENQNHQ 409
           F  YP+LIQGFNTFLPQGYRI+CS NP+ PI V TPMG++TV+GV E    ++ + Q  +
Sbjct: 331 FRGYPNLIQGFNTFLPQGYRIDCSQNPDEPIKVTTPMGSSTVAGVAEMNQAALFQGQQPR 390

Query: 410 LQHSL 414
           +Q  L
Sbjct: 391 IQQHL 395

 Score =  157 bits (397), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 90/158 (56%), Positives = 107/158 (67%), Gaps = 11/158 (6%)

Query: 522 PMVSSVSPPLQ-ELPEQ-RRTQDVEFSQAISYVNKIKNRFANQPYIYKHFLEILQTYQRE 579
           P    V  P+Q +L +Q ++  DVEFSQAISYVNKIKNRF++QP IYKHFLEILQTYQRE
Sbjct: 497 PTQPEVPAPVQPQLADQTKKAADVEFSQAISYVNKIKNRFSDQPDIYKHFLEILQTYQRE 556

Query: 580 QKPINEVYSQVTVLFQEAPDLLEDFKKFLPDSSANNNGSIVTS-----QEENFMYANGFN 634
           QKPINEVY+QVTVLFQ APDLL+DFKKFLPDSSA+             Q +    A G+ 
Sbjct: 557 QKPINEVYAQVTVLFQNAPDLLDDFKKFLPDSSASAAQQQRQQLQPVMQHQQAAAATGYG 616

Query: 635 QQQPHLTPHSEIQAQNLPPLGSFSTQPNGVFPKQESQQ 672
               +   +  +  QNLPPLGSFS  PNG  P+   Q+
Sbjct: 617 ----YYGENQPVARQNLPPLGSFSPPPNGTAPRDYYQE 650

 Score = 55.1 bits (131), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 41/62 (66%)

Query: 307 ALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIARVSSLFHDYPSLIQGFNTF 366
           A+SY+ ++K +F+ +PD+Y HFL+I++ ++ +      V A+V+ LF + P L+  F  F
Sbjct: 525 AISYVNKIKNRFSDQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQNAPDLLDDFKKF 584

Query: 367 LP 368
           LP
Sbjct: 585 LP 586

 Score = 54.3 bits (129), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 60/120 (50%), Gaps = 16/120 (13%)

Query: 548 AISYVNKIKNRFANQPYIYKHFLEILQTYQREQKPINEVYSQVTVLFQEAPDLLEDFKKF 607
           A+SY+ ++K +F ++P +Y HFL+I++ ++ +      V  +V+ LF+  P+L++ F  F
Sbjct: 285 ALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFRGYPNLIQGFNTF 344

Query: 608 LP-----DSSANNN---------GSIVTSQEENFMYANGFNQQQPHLTPHSEIQAQNLPP 653
           LP     D S N +         GS   +       A  F  QQP +  H  +Q  + PP
Sbjct: 345 LPQGYRIDCSQNPDEPIKVTTPMGSSTVAGVAEMNQAALFQGQQPRIQQH--LQPLSFPP 402

>TPHA0J00400 Chr10 complement(89956..94494) [4539 bp, 1512 aa] {ON}
            Anc_6.29 YOL004W
          Length = 1512

 Score = 1145 bits (2962), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 550/856 (64%), Positives = 669/856 (78%), Gaps = 14/856 (1%)

Query: 829  AVRPEIDLDPSLVPIVPEPTQPIEDTLPLVEETNFFDKVKKYIGNKTIYAEFLKVLNLYS 888
            +VRPEIDLDPS+VP++PEP +PIED+L LVEETNFFDK KK+I NK IY EFLK+LNLYS
Sbjct: 621  SVRPEIDLDPSIVPVIPEPVEPIEDSLSLVEETNFFDKAKKFINNKQIYMEFLKILNLYS 680

Query: 889  VDLLEVDELVEKIKYYLNDNEELFSWFKNFVGYVEKPKHIENIVHEKHKLDLDLCEACGP 948
             ++L V+ELVEK++YYL  N+ELF WFK FVGY +KPKHIENIVHEKHKLDLDLCEA GP
Sbjct: 681  QNILNVNELVEKVQYYLGSNKELFDWFKGFVGYQDKPKHIENIVHEKHKLDLDLCEAYGP 740

Query: 949  SYKKLPKTDTLMPCSGRDEMCWEILNDEWVGHPVWASEDSGFIAHRKINTKKPYLRLKKK 1008
            SYKKLPKTDT MPCSGRDEMCWE+LND+WVGHPVWASEDSGFIAHRK   ++   +++++
Sbjct: 741  SYKKLPKTDTFMPCSGRDEMCWEVLNDDWVGHPVWASEDSGFIAHRKNQYEETLFKIEEE 800

Query: 1009 VHEYDFYIESNLRTIQTLETIASKIANMTENEKCNFKLPDGLGHTTSTIYKKVIRKVYDK 1068
             HEYDFYIESNLRTIQTLETIASKIANMTE E+ NFKLP GLGHT+ TIY+KVIRKVY K
Sbjct: 801  RHEYDFYIESNLRTIQTLETIASKIANMTEEERANFKLPIGLGHTSVTIYQKVIRKVYGK 860

Query: 1069 ERGFEIIDALHEYPAIAVPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVFFKSLDHLGL 1128
            ERGFE+IDALHEYPA+AVP++LKRLKQKDEEWRRAQREWNKVWREL+QKV++KSLDHLGL
Sbjct: 861  ERGFELIDALHEYPAVAVPIILKRLKQKDEEWRRAQREWNKVWRELQQKVYYKSLDHLGL 920

Query: 1129 TFKQADKKLLTTKQLISEISSIKVDQTHKRMHWLTPKPKSQLDFNLPDKDIIFDILSFVE 1188
            TFKQADKKLLTTKQLISEISSIKVDQT+K++HWLTPKPKSQLD+ + D+ I++DIL   +
Sbjct: 921  TFKQADKKLLTTKQLISEISSIKVDQTNKKLHWLTPKPKSQLDYKVADRQILYDILKLTD 980

Query: 1189 IFVEHTSTYSNPEKERLIDFMKYFTSLFFSIPLEEIKEAISKRDITEKNDEKLEDKQKNG 1248
            +F+ HTS YSNP+KERL DF++ F SLFF IPL +IK AI  R  +  +D K + ++ +G
Sbjct: 981  VFINHTSNYSNPDKERLRDFLQSFISLFFFIPLADIKAAIKIR--SPLDDTKTDSEESSG 1038

Query: 1249 EENS--KKRTSRDITLSLEDILQRTKYQRLKYGDDSDEVDGHGNRHDDQKXXXXXXXXRQ 1306
            + +   KKR+  D  +S  DIL + KYQ++K G D +E     N              RQ
Sbjct: 1039 DSDKFPKKRSIEDDDISFHDILDKVKYQKVKQGLDKNET--FSNDISSATSVDDDELIRQ 1096

Query: 1307 EAKKPWLLGTLVEEANAQGEIMHRNIFNMFSNTNMYIFIRHLTTMYERLHEIKQMNDKVS 1366
            EA+KPWLLG++V++AN+ G I +R+ +N+F NTN+Y+FIRHL T+YERL+E KQMN +V+
Sbjct: 1097 EAQKPWLLGSIVDDANSLGIIQNRSKYNIFGNTNIYVFIRHLITLYERLNEAKQMNAEVT 1156

Query: 1367 REISGRKISKFAKDLNLISTQLTEMGLDFSEGDVYQQLLVLCKRLILGDLEHQWFEESLR 1426
             EI  R I  FAKDLNL+STQL  MGLDF   D Y+QLL L  RLI G+LEH WFEESLR
Sbjct: 1157 EEIKNRSIVPFAKDLNLVSTQLKNMGLDFEGTDSYKQLLDLSTRLIEGNLEHHWFEESLR 1216

Query: 1427 QAFNNKAFKLYTLDKVTQALVKHAHTIISDLKTTEIMALFEKDRTKNSTSSKDQILYRLQ 1486
            QAF NKAFKLYT+DKVTQ++VKHAHTI+SD KT EIM L EKDR+  +TSSKDQILYRLQ
Sbjct: 1217 QAFRNKAFKLYTIDKVTQSIVKHAHTIMSDTKTAEIMMLMEKDRSCATTSSKDQILYRLQ 1276

Query: 1487 TRARMTHNENMFRIEYNNTTKHICIQYIALDDLTVKDAKTLEEKWKYYITSYALSHPTEG 1546
             R+ M+  +NMFRIE+N ++ +I IQYI +DDLT+ + KT EEKWKYYITSYALSHPTEG
Sbjct: 1277 ARSHMSTTDNMFRIEFNKSSDNISIQYIGMDDLTLGEPKTAEEKWKYYITSYALSHPTEG 1336

Query: 1547 IFQENIQIPFXXXXXXXXXXXXXXXXXXXKQTKSLMKYSPEGISGSTLKIKIDPQNYCLN 1606
            + QE IQIPF                          KYSP+G+S S LKIKI P+NY L 
Sbjct: 1337 VPQEEIQIPFLEKILETEEAYAEEEEVIND------KYSPKGVSQSDLKIKISPENYALE 1390

Query: 1607 IEEGSFDIFSRKSLNQFPVKLTQDSKYGTMPKLK-NTVEKFLNSKMGWKRAISKDQMESI 1665
            IE GSFD FSR S+N++P+ +T D  Y    KL  + V  FLN K GWK+++S+D++ +I
Sbjct: 1391 IEPGSFDTFSRLSMNKYPIDVTSDD-YKNKKKLSIDRVNAFLNGKFGWKQSLSEDEINNI 1449

Query: 1666 ESKWDHLSNNGNLEGY 1681
              K+ H+   G+L+ Y
Sbjct: 1450 NLKYSHIKKYGSLKNY 1465

 Score =  263 bits (671), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 165/352 (46%), Positives = 203/352 (57%), Gaps = 44/352 (12%)

Query: 291 DSPKEDNQ-YRPLNVKDALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIARV 349
           DS + D Q YRPLNVKDAL+YLEQVK QF+SRPD+YNHFLDIMKDFKSQ+IDTPGVI RV
Sbjct: 133 DSKESDEQFYRPLNVKDALTYLEQVKLQFSSRPDIYNHFLDIMKDFKSQSIDTPGVIERV 192

Query: 350 SSLFHDYPSLIQGFNTFLPQGYRIECSSNPNLPITVITPMGTTTVSGVLETSVTENQNHQ 409
           S+LF  YPSLIQGFNTFLPQGY IEC++NPN       P+  TT  G          +  
Sbjct: 193 STLFRGYPSLIQGFNTFLPQGYTIECTNNPN------DPIKVTTPIG----------SET 236

Query: 410 LQHSLPQPSTTASASNVDSKVSSISGIMGPSNITEXXXXXXXXXXXXLINVN-DSAPISG 468
           + ++ P PS  A+ +NV    +S S     +                 I  N ++  I  
Sbjct: 237 IPYAKPIPSA-ATNTNVPGPTTSTSPPTAATTTGTTTPVAANTTAIPNITRNKETNAIEN 295

Query: 469 SISSTVPSNVEPTNMXXXXXXXXXXXXXLPNTNTPKSXXXXXXXXXXXXXXXFPMVSSVS 528
             ++  PS                    LPN  TP                  P+  ++ 
Sbjct: 296 VATAAQPS-------------------LLPNLGTPSHTEVTKSESVIQSSANAPIQPNMH 336

Query: 529 PPLQE-LPEQRRTQDVEFSQAISYVNKIKNRFANQPYIYKHFLEILQTYQREQKPINEVY 587
              Q+ +    +  DVEFSQA+SYVNKIKNRF ++P IYK FLEILQTYQ+EQKPI+EVY
Sbjct: 337 NMTQDTMKITEKPADVEFSQAVSYVNKIKNRFVDEPDIYKTFLEILQTYQKEQKPIHEVY 396

Query: 588 SQVTVLFQEAPDLLEDFKKFLPDSSANNNGSIVTSQEENFMYANGFNQQQPH 639
           SQVT+LFQ APDLL+DFKKFLPD+  NN+    T+Q    + AN    QQ H
Sbjct: 397 SQVTILFQNAPDLLDDFKKFLPDN--NNSAGAETNQN---IQANAMQYQQLH 443

>KAFR0A05120 Chr1 (1015307..1019746) [4440 bp, 1479 aa] {ON} Anc_6.29
            YOL004W
          Length = 1479

 Score = 1135 bits (2935), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 544/842 (64%), Positives = 663/842 (78%), Gaps = 11/842 (1%)

Query: 825  YEENAVRPEIDLDPSLVPIVPEPTQPIEDTLPLVEETNFFDKVKKYIGNKTIYAEFLKVL 884
            Y E  VRPEIDLDPS+VP+VPEPT+PIE    L+EET+FFDK KK+I NK IY EFLKVL
Sbjct: 603  YVEAPVRPEIDLDPSIVPVVPEPTEPIESNFTLIEETSFFDKAKKFINNKQIYTEFLKVL 662

Query: 885  NLYSVDLLEVDELVEKIKYYLNDNEELFSWFKNFVGYVEKPKHIENIVHEKHKLDLDLCE 944
            NL+S DL+ VD+LV K++YY+  ++ELF WF+NFVGY   PK IENIVHEKH+LDLDLCE
Sbjct: 663  NLFSQDLISVDDLVNKVEYYIGSSKELFEWFRNFVGYQGNPKIIENIVHEKHRLDLDLCE 722

Query: 945  ACGPSYKKLPKTDTLMPCSGRDEMCWEILNDEWVGHPVWASEDSGFIAHRKINTKKPYLR 1004
            ACGPSYK+LPK+DT MPCSGRD+MCWE+LNDEWVGHPVWASEDSGFIAHRK   ++   +
Sbjct: 723  ACGPSYKRLPKSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFK 782

Query: 1005 LKKKVHEYDFYIESNLRTIQTLETIASKIANMTENEKCNFKLPDGLGHTTSTIYKKVIRK 1064
            ++++ HEYD+YIESNLRTIQTLE I +KI+NM+E EK NFKL  GLGHT+ TIYKKVIRK
Sbjct: 783  IEEERHEYDYYIESNLRTIQTLEAIVNKISNMSEEEKKNFKLEPGLGHTSLTIYKKVIRK 842

Query: 1065 VYDKERGFEIIDALHEYPAIAVPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVFFKSLD 1124
            VYDKERGFEIIDALHE+PAIA P+VLKRLKQKDEEWRRAQREWNKVWRELEQKV+FKSLD
Sbjct: 843  VYDKERGFEIIDALHEHPAIAAPIVLKRLKQKDEEWRRAQREWNKVWRELEQKVYFKSLD 902

Query: 1125 HLGLTFKQADKKLLTTKQLISEISSIKVDQTHKRMHWLTPKPKSQLDFNLPDKDIIFDIL 1184
            HLGLTFKQADKKLLT KQLISEISSIKVDQ +KR+HWLTPKPKSQL+F++ D +I+FDIL
Sbjct: 903  HLGLTFKQADKKLLTIKQLISEISSIKVDQNNKRIHWLTPKPKSQLNFDIKDFEILFDIL 962

Query: 1185 SFVEIFVEHTSTYSNPEKERLIDFMKYFTSLFFSIPLEEIKEAISKRDITEKNDEKLEDK 1244
            S  E F+ H+STYS  +KERL DF+K F SLFFS+PL EI  A+ KR+  +KN EK+ D 
Sbjct: 963  SLSENFINHSSTYSTSDKERLNDFLKSFISLFFSVPLNEINNALDKRN-NQKNSEKVTDS 1021

Query: 1245 Q-KNGEENSKKRTSRDITLSLEDILQRTKYQRLKY---GDDSDE---VDGHGNRHDDQKX 1297
               +G EN KKR+  DI LS+ DIL RTKYQ++K    G DS E   +D   +   D++ 
Sbjct: 1022 ALPDGTENQKKRSIHDIELSMSDILHRTKYQKMKLSNRGSDSQEENNIDTIIDEESDERL 1081

Query: 1298 XXXXXXXRQEAKKPWLLGTLVEEANAQGEIMHRNIFNMFSNTNMYIFIRHLTTMYERLHE 1357
                   RQ+AK+PWLLG ++++ N QG I  R  FN+F+NTN+Y+F+RH TT+YERL E
Sbjct: 1082 AEEADLIRQDAKRPWLLGDIIDKTNTQGIITDRKKFNLFANTNIYVFLRHWTTLYERLLE 1141

Query: 1358 IKQMNDKVSREISGRKISKFAKDLNLISTQLTEMGLDFSEGDVYQQLLVLCKRLILGDLE 1417
            +K+MN +V++EI+ RK  KFA+DL L+STQL  MGLDF + D Y++LL L KRLI  D+E
Sbjct: 1142 LKEMNGEVTKEINNRKSVKFAEDLGLVSTQLKNMGLDFVDKDSYEELLRLSKRLIENDIE 1201

Query: 1418 HQWFEESLRQAFNNKAFKLYTLDKVTQALVKHAHTIISDLKTTEIMALFEKDRTKNSTSS 1477
            HQWFEESLRQA+NN+AFKLYT+DKV QALVKH HT+++D KTTE+M LFEKDR  ++TS+
Sbjct: 1202 HQWFEESLRQAYNNRAFKLYTVDKVVQALVKHGHTLMTDYKTTEVMKLFEKDRLSSATSA 1261

Query: 1478 KDQILYRLQTRARMTHNENMFRIEYNNTTKHICIQYIALDDLTVKDAKTLEEKWKYYITS 1537
            KDQILYRLQ R+ M++ E MFRIEYN   ++ICIQYIALDDLT+K+  T EEKWKYY+TS
Sbjct: 1262 KDQILYRLQARSHMSNTEYMFRIEYNKDDRNICIQYIALDDLTLKEGNTEEEKWKYYVTS 1321

Query: 1538 YALSHPTEGIFQENIQIPFXXXXXXXXXXXXXXXXXXXKQTKSLMKYSPEGISGSTLKIK 1597
            Y+L HPTEGI  E++QIPF                   ++ KS  KYSPEG+S S  KIK
Sbjct: 1322 YSLPHPTEGIDHESLQIPF---LQKILEFDQEELENNDEENKSNGKYSPEGVSNSMYKIK 1378

Query: 1598 IDPQNYCLNIEEGSFDIFSRKSLNQFPVKLTQDSKYGTMPKLKNTVEKFLNSKMGWKRAI 1657
            I P NY L+I+ GSFDIFSRKSLN++PVK+ +D +   + K KN +  FL S  GWK+ +
Sbjct: 1379 IHPGNYALDIQTGSFDIFSRKSLNKYPVKVNEDHESLKLNKKKNILNTFLESNNGWKKHL 1438

Query: 1658 SK 1659
             K
Sbjct: 1439 KK 1440

 Score =  179 bits (454), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 85/123 (69%), Positives = 97/123 (78%)

Query: 294 KEDNQYRPLNVKDALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIARVSSLF 353
           ++D  YRPLNVKDALSYLEQVK QFNSRPD+YN FLDIMKDFKSQ IDTPGVI RVS+LF
Sbjct: 205 EDDASYRPLNVKDALSYLEQVKQQFNSRPDIYNQFLDIMKDFKSQTIDTPGVIERVSTLF 264

Query: 354 HDYPSLIQGFNTFLPQGYRIECSSNPNLPITVITPMGTTTVSGVLETSVTENQNHQLQHS 413
             YPSLIQGFNTFLP GYRI+C SNPN PI V TP+G++T+  +  +    N N Q Q +
Sbjct: 265 RGYPSLIQGFNTFLPTGYRIDCPSNPNDPIKVTTPIGSSTLHEMTRSVQRANSNLQQQQA 324

Query: 414 LPQ 416
           L Q
Sbjct: 325 LSQ 327

 Score =  145 bits (367), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 80/141 (56%), Positives = 102/141 (72%), Gaps = 8/141 (5%)

Query: 538 RRTQDVEFSQAISYVNKIKNRFANQPYIYKHFLEILQTYQREQKPINEVYSQVTVLFQEA 597
           ++  DVEFSQAI+YVNKIKNRFA+QP IYK+FLEILQTYQREQKPINEVY+QVT+LFQ A
Sbjct: 363 KKPADVEFSQAINYVNKIKNRFADQPDIYKNFLEILQTYQREQKPINEVYAQVTILFQNA 422

Query: 598 PDLLEDFKKFLPDSSANN--NGSI---VTSQEENFMYANGFNQQQPHLTPHSEIQAQNLP 652
           PDLL+DFKKFLPDSS      G +   + +QE+   ++  +   +P   P   +  Q+LP
Sbjct: 423 PDLLDDFKKFLPDSSKEQQYTGQLPQQIPNQEQLEEFSGSY--ARPPNAPLDMVAQQSLP 480

Query: 653 PLGSFSTQPN-GVFPKQESQQ 672
           P+GSFS   N G+    +SQ+
Sbjct: 481 PIGSFSPPANTGISMHDQSQR 501

 Score = 51.6 bits (122), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 37/130 (28%), Positives = 64/130 (49%), Gaps = 16/130 (12%)

Query: 548 AISYVNKIKNRFANQPYIYKHFLEILQTYQREQKPINEVYSQVTVLFQEAPDLLEDFKKF 607
           A+SY+ ++K +F ++P IY  FL+I++ ++ +      V  +V+ LF+  P L++ F  F
Sbjct: 218 ALSYLEQVKQQFNSRPDIYNQFLDIMKDFKSQTIDTPGVIERVSTLFRGYPSLIQGFNTF 277

Query: 608 LP-----DSSANNN----------GSIVTSQEENFMYANGFNQQQPHLTPHSEIQAQNLP 652
           LP     D  +N N           S +     +   AN   QQQ  L+ ++ +Q   + 
Sbjct: 278 LPTGYRIDCPSNPNDPIKVTTPIGSSTLHEMTRSVQRANSNLQQQQALSQNNMMQQAQI- 336

Query: 653 PLGSFSTQPN 662
           P+GS S   N
Sbjct: 337 PIGSISNNAN 346

 Score = 50.8 bits (120), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 26/80 (32%), Positives = 50/80 (62%), Gaps = 3/80 (3%)

Query: 291 DSPKEDNQYRPLNVK--DALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIAR 348
           D  K+ N+ +P +V+   A++Y+ ++K +F  +PD+Y +FL+I++ ++ +      V A+
Sbjct: 356 DQAKQANK-KPADVEFSQAINYVNKIKNRFADQPDIYKNFLEILQTYQREQKPINEVYAQ 414

Query: 349 VSSLFHDYPSLIQGFNTFLP 368
           V+ LF + P L+  F  FLP
Sbjct: 415 VTILFQNAPDLLDDFKKFLP 434

>Ecym_3033 Chr3 complement(64660..69084) [4425 bp, 1474 aa] {ON}
            similar to Ashbya gossypii ACL004W
          Length = 1474

 Score = 1106 bits (2860), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 545/891 (61%), Positives = 673/891 (75%), Gaps = 31/891 (3%)

Query: 821  QQVMYEENAVRPEIDLDPSLVPIVPEPTQPIEDTLPLVEETNFFDKVKKYIGNKTIYAEF 880
            Q   Y E   RPEIDLDPSLVP++PEP +P+ED L LVEE +FFDK KKYIGNK IY EF
Sbjct: 556  QDTQYMETNARPEIDLDPSLVPVIPEPIKPLEDELNLVEEASFFDKAKKYIGNKQIYTEF 615

Query: 881  LKVLNLYSVDLLEVDELVEKIKYYLNDNEELFSWFKNFVGYVEKPKHIENIVHEKHKLDL 940
            LK+LNLYS DLL+ + LVEK+ +YL+   ELF WFK+FVGY EKPKHIENIVHEKH+LDL
Sbjct: 616  LKILNLYSQDLLDKERLVEKVGHYLSGCPELFDWFKSFVGYQEKPKHIENIVHEKHRLDL 675

Query: 941  DLCEACGPSYKKLPKTDTLMPCSGRDEMCWEILNDEWVGHPVWASEDSGFIAHRKINTKK 1000
            DLCEACGPSYK+LPK DT MPCSGRDEMCWE+LNDEWVGHPVWASEDSGFIAHRK   + 
Sbjct: 676  DLCEACGPSYKRLPKADTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYED 735

Query: 1001 PYLRLKKKVHEYDFYIESNLRTIQTLETIASKIANMTENEKCNFKLPDGLGHTTSTIYKK 1060
               +++++ HEYDFYIE+NLRTIQTLETIA+KIANMT  EK  FKLP GLGHT+ TIYKK
Sbjct: 736  TLFKIEEERHEYDFYIEANLRTIQTLETIANKIANMTPEEKATFKLPPGLGHTSVTIYKK 795

Query: 1061 VIRKVYDKERGFEIIDALHEYPAIAVPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVFF 1120
            VIRKVYDK+RG+EIIDALHEYPAI VP+VLKRLKQKDEEWRRAQREWNKVWRELEQKVFF
Sbjct: 796  VIRKVYDKDRGYEIIDALHEYPAITVPIVLKRLKQKDEEWRRAQREWNKVWRELEQKVFF 855

Query: 1121 KSLDHLGLTFKQADKKLLTTKQLISEISSIKVDQTHKRMHWLTPKPKSQLDFNLPDKDII 1180
            KSLDHLGLTFKQADKKLLT KQLISEISSIKVDQ +KR+H LTPK KSQLD +  D ++ 
Sbjct: 856  KSLDHLGLTFKQADKKLLTAKQLISEISSIKVDQNNKRIHPLTPKAKSQLDHDFTDPEVF 915

Query: 1181 FDILSFVEIFVEHTSTYSNPEKERLIDFMKYFTSLFFSIPLEEIKEAISKRDI------- 1233
            +DIL+   +F+E+ +TYS P+KERL DF K F SLF S P+ +I++A++KRD        
Sbjct: 916  YDILNLAIVFLENNNTYSAPDKERLKDFFKGFISLFCSYPVPQIEKALAKRDAASSSQSS 975

Query: 1234 ---TEKNDEKLEDKQKNGEEN-SKKRTSRDITLSLEDILQRTKYQRLKYGDDSDEVDGHG 1289
               TE   EK   +Q++G+    KKR   D    L D+L R K Q  K G +S   D   
Sbjct: 976  NSNTETYSEK---QQEDGDMKLPKKRNREDSDRLLRDVLFRNKQQ--KGGRNSPRGDSSI 1030

Query: 1290 NRHDDQKXXXXXXXXRQEAKKPWLLGTLVEEANAQGEIMHRNIFNMFSNTNMYIFIRHLT 1349
            +  + +         RQEAK PWLLG++V+EA+  G + +R  FN+F+NTN+Y+F RHL 
Sbjct: 1031 SA-EKESDMEEEEIIRQEAKNPWLLGSIVDEADNHGHVENRKTFNLFANTNIYVFFRHLA 1089

Query: 1350 TMYERLHEIKQMNDKVSREISGRKISKFAKDLNLISTQLTEMGLDFSEGDVYQQLLVLCK 1409
            T+YERL E+K+MND+V++EI+ RK+ +FAKDLNLISTQLT+MGLDF   D Y++LL L +
Sbjct: 1090 TIYERLVEVKKMNDEVTKEIANRKVVQFAKDLNLISTQLTDMGLDFKGEDAYEKLLQLSR 1149

Query: 1410 RLILGDLEHQWFEESLRQAFNNKAFKLYTLDKVTQALVKHAHTIISDLKTTEIMALFEKD 1469
             LI GDLEHQWFEESLRQA+ NKAFK+YT+DKV QALVKHAH II+D KT EIM LFEKD
Sbjct: 1150 SLIAGDLEHQWFEESLRQAYKNKAFKIYTVDKVIQALVKHAHAIITDNKTVEIMMLFEKD 1209

Query: 1470 RTKNSTSSKDQILYRLQTRARMTHNENMFRIEYNNTTKHICIQYIALDDLTVKDAKTLEE 1529
            RT  STS+KDQILYRLQ R+ M++ ENMFRIEYN  T H+CIQ++A+DDLT+++ K+L++
Sbjct: 1210 RTSLSTSTKDQILYRLQVRSNMSNIENMFRIEYNRLTAHVCIQFVAVDDLTLEEPKSLKD 1269

Query: 1530 KWKYYITSYALSHPTEGIFQENIQIPFXXXXXXXXXXXXXXXXXXXKQTKSLMKYSPEGI 1589
            KW+YY+TSY+LSHPTEGI  +N++ PF                          KYSPEG+
Sbjct: 1270 KWQYYLTSYSLSHPTEGISHDNLRSPFLEKIIESEEDIIEDKDE---------KYSPEGV 1320

Query: 1590 SGSTLKIKIDPQNYCLNIEEGSFDIFSRKSLNQFPVKLTQDSKYGTMPKLKNTVEKFLNS 1649
            + S LK+KIDP  Y + +E GS DIFSRK++N+FPV++  D +     +LK  +E+FLNS
Sbjct: 1321 ATSNLKVKIDPITYSMEVEFGSHDIFSRKAVNKFPVRV--DIRKKKSSELKLELERFLNS 1378

Query: 1650 KMGWKRAISKDQMESIESKWDHLSNNGNLEGYQEKSILKD---VNGTDISK 1697
              GWK+ +S  Q+  +E + + +  NGNLE Y + S +     V+G+D++K
Sbjct: 1379 NSGWKKDLSAKQIAEVEKRLEFVKLNGNLEEYSDDSAVASTSAVSGSDLAK 1429

 Score =  181 bits (459), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 83/99 (83%), Positives = 89/99 (89%)

Query: 294 KEDNQYRPLNVKDALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIARVSSLF 353
           ++ + YRPLNVKDALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVI RVS+LF
Sbjct: 155 QDGSSYRPLNVKDALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLF 214

Query: 354 HDYPSLIQGFNTFLPQGYRIECSSNPNLPITVITPMGTT 392
             YP+LIQGFNTFLPQGY IECSS+PN PI V TP GTT
Sbjct: 215 QGYPTLIQGFNTFLPQGYNIECSSDPNDPIKVTTPFGTT 253

 Score =  138 bits (347), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 65/76 (85%), Positives = 71/76 (93%)

Query: 538 RRTQDVEFSQAISYVNKIKNRFANQPYIYKHFLEILQTYQREQKPINEVYSQVTVLFQEA 597
           ++T DVEFS AISYVNKIK RFA+QP IYKHFLEILQTYQREQKPINEVY+QVTVLFQ A
Sbjct: 347 KKTGDVEFSHAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQNA 406

Query: 598 PDLLEDFKKFLPDSSA 613
           PDLL+DFKKFLPD+SA
Sbjct: 407 PDLLDDFKKFLPDASA 422

 Score = 54.7 bits (130), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 40/64 (62%)

Query: 307 ALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIARVSSLFHDYPSLIQGFNTF 366
           A+SY+ ++K +F  +PD+Y HFL+I++ ++ +      V A+V+ LF + P L+  F  F
Sbjct: 357 AISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQNAPDLLDDFKKF 416

Query: 367 LPQG 370
           LP  
Sbjct: 417 LPDA 420

 Score = 51.2 bits (121), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 40/62 (64%)

Query: 548 AISYVNKIKNRFANQPYIYKHFLEILQTYQREQKPINEVYSQVTVLFQEAPDLLEDFKKF 607
           A+SY+ ++K +F ++P +Y HFL+I++ ++ +      V  +V+ LFQ  P L++ F  F
Sbjct: 168 ALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFQGYPTLIQGFNTF 227

Query: 608 LP 609
           LP
Sbjct: 228 LP 229

>SAKL0E01540g Chr5 complement(114922..119169) [4248 bp, 1415 aa] {ON}
            similar to uniprot|Q75CF0 Ashbya gossypii ACL004W
            ACL004Wp and some similarites with YOL004W uniprot|P22579
            Saccharomyces cerevisiae YOL004W SIN3 DNA binding protein
            involved in transcriptional regulation
          Length = 1415

 Score = 1105 bits (2858), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 536/923 (58%), Positives = 690/923 (74%), Gaps = 25/923 (2%)

Query: 822  QVMYEENAVRPEIDLDPSLVPIVPEPTQPIEDTLPLVEETNFFDKVKKYIGNKTIYAEFL 881
            +V Y E   RPEIDLDPSLVP++PEP +P+E+ + LVEET+FFDK KK+IGNK IY EFL
Sbjct: 506  EVQYMEPVARPEIDLDPSLVPVIPEPIEPMENEVSLVEETSFFDKAKKFIGNKQIYTEFL 565

Query: 882  KVLNLYSVDLLEVDELVEKIKYYLNDNEELFSWFKNFVGYVEKPKHIENIVHEKHKLDLD 941
            K+LNLYS DLL+ DELVEK++YYL  N+ELF WFKNFVGY +KPKHIENIVHEKH+LDLD
Sbjct: 566  KILNLYSQDLLDRDELVEKVEYYLGGNKELFDWFKNFVGYEKKPKHIENIVHEKHRLDLD 625

Query: 942  LCEACGPSYKKLPKTDTLMPCSGRDEMCWEILNDEWVGHPVWASEDSGFIAHRKINTKKP 1001
            LCEACGPSYKKLPK DT MPCSGRDEMCWE+LNDEWVGHPVWASEDSGFIAHRK   ++ 
Sbjct: 626  LCEACGPSYKKLPKADTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEET 685

Query: 1002 YLRLKKKVHEYDFYIESNLRTIQTLETIASKIANMTENEKCNFKLPDGLGHTTSTIYKKV 1061
              +++++ HEYDFYIE+NLRTIQTLETIA+KIANMT  EK  FKL  GLGHT+ TIYKKV
Sbjct: 686  LFKIEEERHEYDFYIEANLRTIQTLETIANKIANMTPEEKATFKLSPGLGHTSVTIYKKV 745

Query: 1062 IRKVYDKERGFEIIDALHEYPAIAVPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVFFK 1121
            IRKVYDK+RGFEIIDALHE P+IAVP+VLKRLKQKDEEWRRAQREWNKVWRELEQKV++K
Sbjct: 746  IRKVYDKDRGFEIIDALHETPSIAVPIVLKRLKQKDEEWRRAQREWNKVWRELEQKVYYK 805

Query: 1122 SLDHLGLTFKQADKKLLTTKQLISEISSIKVDQTHKRMHWLTPKPKSQLDFNLPDKDIIF 1181
            SLDHLGLTFKQADKKLLTTKQL+SEIS+IKVDQ +KR+H LTPKPKSQLD++  D+++++
Sbjct: 806  SLDHLGLTFKQADKKLLTTKQLVSEISTIKVDQANKRIHPLTPKPKSQLDYHFKDREVLY 865

Query: 1182 DILSFVEIFVEHTSTYSNPEKERLIDFMKYFTSLFFSIPLEEIKEAISKRDITEKNDEKL 1241
            DIL+  ++F++  +TYSNP+KE++ DF+K F  LFFS P+ E++ A ++R    + D  +
Sbjct: 866  DILNLAKVFIDCNTTYSNPDKEKMFDFLKSFLVLFFSYPMYEVETAFARR----RGDIGV 921

Query: 1242 EDKQKN-GEEN---SKKRTSRDITLSLEDILQRTKYQRLK-YGDDSDEVDGHGNRHDDQK 1296
            +D ++N G+EN   S+KRT  +  L L+D+L+R KYQ+ + + ++    +         +
Sbjct: 922  QDGEENSGQENSDLSRKRTREEENL-LKDVLRRNKYQKGRNFAEEEPIPEESEFAEKTVE 980

Query: 1297 XXXXXXXXRQEAKKPWLLGTLVEEANAQGEIMHRNIFNMFSNTNMYIFIRHLTTMYERLH 1356
                    RQEAKKPWLLG++V+EAN  G + +R  FNMF+NTN+Y+F RHL T+Y RL 
Sbjct: 981  EKEEEEIIRQEAKKPWLLGSIVDEANEHGFVENRKTFNMFANTNIYVFFRHLATLYTRLS 1040

Query: 1357 EIKQMNDKVSREISGRKISKFAKDLNLISTQLTEMGLDFSEGDVYQQLLVLCKRLILGDL 1416
            E+K +N+ V+ EI  RK+ +FAKDLNLISTQL++MGLDF   D Y Q+L L KRLI GD+
Sbjct: 1041 EVKDINEAVTEEIKNRKVVQFAKDLNLISTQLSDMGLDFEGADAYGQVLTLSKRLIEGDI 1100

Query: 1417 EHQWFEESLRQAFNNKAFKLYTLDKVTQALVKHAHTIISDLKTTEIMALFEKDRTKNSTS 1476
            EHQWFEESLRQA+ NKAFK+YT+DKV Q+LVKHAHTII+D KT EIM LFEKDRT  +TS
Sbjct: 1101 EHQWFEESLRQAYKNKAFKIYTIDKVVQSLVKHAHTIITDPKTVEIMILFEKDRTCLNTS 1160

Query: 1477 SKDQILYRLQTRARMTHNENMFRIEYNNTTKHICIQYIALDDLTVKDAKTLEEKWKYYIT 1536
            +K+QILYRLQ R+ MT  ENMFRIEYN  + H  IQ++A+DDLT+++ K+LE++WKYY+T
Sbjct: 1161 AKEQILYRLQVRSHMTTAENMFRIEYNRQSTHASIQFVAVDDLTLEEPKSLEDRWKYYVT 1220

Query: 1537 SYALSHPTEGIFQENIQIPFXXXXXXXXXXXXXXXXXXXKQTKSLMKYSPEGISGSTLKI 1596
            SY+LSHPTEGI  E +Q PF                          +YSPEG+S S LK+
Sbjct: 1221 SYSLSHPTEGISHEELQPPFLEKILEKEEEFQCENG----------EYSPEGVSSSNLKV 1270

Query: 1597 KIDPQNYCLNIEEGSFDIFSRKSLNQFPVKLTQDSKYGTMPKLKNTVEKFLNSKMGWKRA 1656
            KI+P+ Y L+++ GS+D FSRKS+N+FP+++  D+      +    +  +LN   GWKR 
Sbjct: 1271 KINPETYSLDVQPGSYDFFSRKSINKFPIEINNDTYKSKRGEKAKCLTSYLNGAKGWKRG 1330

Query: 1657 ISKDQMESIESKWDHLSNNGNLEGYQEKSILKDVNGTDISKISPMKTFTVTE----SANG 1712
            +   ++   +++ +++   G L G + K    D+   DI   +   TF+  +      + 
Sbjct: 1331 LVASKVLKAQTEIEYVKTKGTLVGLESKD-KNDIVKNDIDGENKSYTFSTGQLHDHEEDK 1389

Query: 1713 VPNDKADGEERGNDTTAEEVGNE 1735
              + + + E +GNDTT EE   E
Sbjct: 1390 PISHQEEPESKGNDTTTEEFEGE 1412

 Score =  177 bits (450), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 84/100 (84%), Positives = 89/100 (89%), Gaps = 2/100 (2%)

Query: 295 EDNQYRPLNVKDALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIARVSSLFH 354
           +D  YRPLNVKDALSYLEQVKFQFN+RPDVYNHFLDIMKDFKSQAIDTPGVI RVS+LF 
Sbjct: 154 QDPSYRPLNVKDALSYLEQVKFQFNNRPDVYNHFLDIMKDFKSQAIDTPGVIERVSNLFQ 213

Query: 355 DYPSLIQGFNTFLPQGYRIECSSNPN--LPITVITPMGTT 392
            YP+LIQGFNTFLPQGY+IECSSNPN   PI V TP GTT
Sbjct: 214 GYPNLIQGFNTFLPQGYKIECSSNPNDPHPIKVTTPFGTT 253

 Score =  136 bits (343), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 73/117 (62%), Positives = 80/117 (68%), Gaps = 13/117 (11%)

Query: 538 RRTQDVEFSQAISYVNKIKNRFANQPYIYKHFLEILQTYQREQKPINEVYSQVTVLFQEA 597
           ++  DVEFS AISYVNKIK RFA QP IYKHFLEILQTYQREQKPINEVY+QVTVLFQ A
Sbjct: 334 KKGGDVEFSHAISYVNKIKTRFAEQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQNA 393

Query: 598 PDLLEDFKKFLPDSSANNNGSIVTSQEENFMYANGFNQQQPHLTPHSEIQAQNLPPL 654
           PDLL+DFKKFLPD+SA  + +          Y        P   P      QNLPPL
Sbjct: 394 PDLLDDFKKFLPDASAPQSTTTPAPVNGGTFY--------PQAAPQ-----QNLPPL 437

 Score = 56.2 bits (134), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 44/73 (60%)

Query: 307 ALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIARVSSLFHDYPSLIQGFNTF 366
           A+SY+ ++K +F  +PD+Y HFL+I++ ++ +      V A+V+ LF + P L+  F  F
Sbjct: 344 AISYVNKIKTRFAEQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQNAPDLLDDFKKF 403

Query: 367 LPQGYRIECSSNP 379
           LP     + ++ P
Sbjct: 404 LPDASAPQSTTTP 416

 Score = 52.4 bits (124), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 41/62 (66%)

Query: 548 AISYVNKIKNRFANQPYIYKHFLEILQTYQREQKPINEVYSQVTVLFQEAPDLLEDFKKF 607
           A+SY+ ++K +F N+P +Y HFL+I++ ++ +      V  +V+ LFQ  P+L++ F  F
Sbjct: 166 ALSYLEQVKFQFNNRPDVYNHFLDIMKDFKSQAIDTPGVIERVSNLFQGYPNLIQGFNTF 225

Query: 608 LP 609
           LP
Sbjct: 226 LP 227

>NCAS0D02130 Chr4 (394326..398630) [4305 bp, 1434 aa] {ON} Anc_6.29
            YOL004W
          Length = 1434

 Score = 1100 bits (2846), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 532/864 (61%), Positives = 658/864 (76%), Gaps = 45/864 (5%)

Query: 827  ENAVRPEIDLDPSLVPIVPEPTQPIEDTLPLVEETNFFDKVKKYIGNKTIYAEFLKVLNL 886
            E  +RPEIDLDPS+VP++PEPT+P+E  + LVEETNFF+K KK+IG K +Y EFLK+LNL
Sbjct: 575  EAPIRPEIDLDPSIVPVIPEPTEPLEYNVSLVEETNFFEKAKKFIGTKQVYTEFLKILNL 634

Query: 887  YSVDLLEVDELVEKIKYYLNDNEELFSWFKNFVGYVEKPKHIENIVHEKHKLDLDLCEAC 946
            YS DLL  DEL  K++YYL  NEELF+WFKNFVG+ EKP  IENIVHEKHKLDLDLCEAC
Sbjct: 635  YSQDLLTTDELCVKVEYYLGSNEELFTWFKNFVGFQEKPLIIENIVHEKHKLDLDLCEAC 694

Query: 947  GPSYKKLPKTDTLMPCSGRDEMCWEILNDEWVGHPVWASEDSGFIAHRKINTKKPYLRLK 1006
            GPSYKKLPKTDT MPCSGRDEMCWE+LNDEWVGHPVWASEDSGFIAHRK   ++   + +
Sbjct: 695  GPSYKKLPKTDTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEESLFKTE 754

Query: 1007 KKVHEYDFYIESNLRTIQTLETIASKIANMTENEKCNFKLPDGLGHTTSTIYKKVIRKVY 1066
            ++ HEYDF IESNLRTIQTLETIA+KI NMT  EK NFKLP GLGHT+STIYKKVIRKVY
Sbjct: 755  EERHEYDFCIESNLRTIQTLETIANKIGNMTNEEKKNFKLPPGLGHTSSTIYKKVIRKVY 814

Query: 1067 DKERGFEIIDALHEYPAIAVPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVFFKSLDHL 1126
            DK+RGFEIID LHE PA+ VPVVLKRLKQKDEEWRRAQREWNKVWRELEQKV++KSLDHL
Sbjct: 815  DKDRGFEIIDLLHEEPALTVPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVYYKSLDHL 874

Query: 1127 GLTFKQADKKLLTTKQLISEISSIKVDQTHKRMHWLTPKPKSQLDFNLPDKDIIFDILSF 1186
            GLTFKQADKKLLTTKQL+SEISSIKVDQT+KR+HWLTPKPKSQL+F   D DI  DIL  
Sbjct: 875  GLTFKQADKKLLTTKQLLSEISSIKVDQTNKRIHWLTPKPKSQLEFQFDDNDIFVDILGL 934

Query: 1187 VEIFVEHTSTYSNPEKERLIDFMKYFTSLFFSIPLEEIKEAISKRDITEKNDEKLEDKQK 1246
              +F+ H+STYSNPEKER+ DF++ F SLFFSIPL+++ EA+S R         L++K+K
Sbjct: 935  TSVFINHSSTYSNPEKERMKDFLRVFVSLFFSIPLDKVNEALSDR------SHWLQEKEK 988

Query: 1247 NGEENSK---------------KRTSRDITLSLEDILQRTKYQRL-KYGDDSDEVDGH-- 1288
              +E+S+               K+   +I + L DIL++ KYQ++ K   +S+E +    
Sbjct: 989  KTKESSRNIDSTTSSSSSGSNSKKRPLNIDIPLADILRKHKYQKIRKQAKESNEENAQEE 1048

Query: 1289 ------GNRHDDQKXXXXXXXXRQEAKKPWLLGTLVEEANAQGEIMHRNIFNMFSNTNMY 1342
                  G+ +++           +E K+PWLLG ++E A+  G I +R +FNMF+NTN+Y
Sbjct: 1049 DDENIVGDSNEELNEQDENEIILEEIKRPWLLGNIIETASNHGTISNRKVFNMFANTNIY 1108

Query: 1343 IFIRHLTTMYERLHEIKQMNDKVSREISGRKISKFAKDLNLISTQLTEMGLDFSEGDVYQ 1402
            +F R  T +YERL+E+KQ+N+KV++E++ R+IS+FAKDLNLISTQL +MGLDF   + YQ
Sbjct: 1109 VFFRLWTVIYERLYEMKQINEKVTKEVNSRRISQFAKDLNLISTQLKDMGLDFVGVNSYQ 1168

Query: 1403 QLLVLCKRLILGDLEHQWFEESLRQAFNNKAFKLYTLDKVTQALVKHAHTIISDLKTTEI 1462
            +LLVL KRLI  D+EHQWFEESLRQAFNNKAFKLYT+DKV Q+LVKHAHTI+ D+KT+EI
Sbjct: 1169 ELLVLSKRLIQNDIEHQWFEESLRQAFNNKAFKLYTVDKVIQSLVKHAHTILGDVKTSEI 1228

Query: 1463 MALFEKDRTKNSTSSKDQILYRLQTRARMTHNENMFRIEYNNTTKHICIQYIALDDLTVK 1522
            M LFEKDR  +STS+K+QILYRLQTRA MT+ ENMFRIE+N    H+CIQYIAL+DLT+K
Sbjct: 1229 MVLFEKDRLCSSTSAKEQILYRLQTRAHMTNTENMFRIEFNEEKNHVCIQYIALEDLTIK 1288

Query: 1523 DAKTLEEKWKYYITSYALSHPTEGIFQENIQIPFXXXXXXXXXXXXXXXXXXXKQTKSLM 1582
              K++E+ W+YY+TSY+L HPTEG+ Q+ ++IPF                          
Sbjct: 1289 QPKSMEKNWEYYVTSYSLPHPTEGVPQDELKIPFLEKTLELEVDEEGDN----------- 1337

Query: 1583 KYSPEGISGSTLKIKIDPQNYCLNIEEGSFDIFSRKSLNQFPVKLTQDSKYGTMPKLKNT 1642
            K SPEG+S S LKIKIDP++Y L IE GSFD+FSRKS+N +P    +  K  ++ ++   
Sbjct: 1338 KSSPEGVSSSKLKIKIDPKSYALEIEPGSFDLFSRKSMNVYPTYSDETKKRKSIDQMT-- 1395

Query: 1643 VEKFLNSKMGWKRAISKDQMESIE 1666
              KFL+ K GWK+ ++     +IE
Sbjct: 1396 --KFLDGKNGWKKNLTTADSTNIE 1417

 Score =  179 bits (454), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 88/134 (65%), Positives = 103/134 (76%), Gaps = 5/134 (3%)

Query: 295 EDNQYRPLNVKDALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIARVSSLFH 354
           +D  YRPLNVKDALSYLEQVK+QF+ RPD+YN FLDIMKDFKSQ+IDTPGVI RVS+LF 
Sbjct: 203 QDLAYRPLNVKDALSYLEQVKYQFSQRPDIYNQFLDIMKDFKSQSIDTPGVIERVSALFR 262

Query: 355 DYPSLIQGFNTFLPQGYRIECSSNPNLPITVITPMGTTTVSG--VLE--TSVTENQNHQL 410
            YP L+QGFNTFLPQGYRIEC+++P+ PI V TPMGT+T+SG   +E  +S   N   Q 
Sbjct: 263 GYPMLVQGFNTFLPQGYRIECTTDPDGPIRVTTPMGTSTLSGGPAMEAPSSSESNLQQQQ 322

Query: 411 QHSLPQ-PSTTASA 423
            H  P  PS  AS 
Sbjct: 323 HHQSPTIPSLAAST 336

 Score =  143 bits (361), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 83/149 (55%), Positives = 100/149 (67%), Gaps = 13/149 (8%)

Query: 539 RTQDVEFSQAISYVNKIKNRFANQPYIYKHFLEILQTYQREQKPINEVYSQVTVLFQEAP 598
           +  +VEFSQAI+YVNKIKNRFA+QP IYK FLEILQTYQREQKPINEVYSQVTVLFQ AP
Sbjct: 354 KNAEVEFSQAINYVNKIKNRFADQPDIYKRFLEILQTYQREQKPINEVYSQVTVLFQHAP 413

Query: 599 DLLEDFKKFLPDSSANNNGSIV-----TSQEENFMYANGFNQQQPH---LTPHSEIQAQN 650
           DLL+DFKKFLP+SS   + S +       Q       N  +QQ  +     P+     QN
Sbjct: 414 DLLDDFKKFLPESSGTTSTSELPQNAGIQQRAAIPTPNPKHQQYGYPNNYYPNGTGTQQN 473

Query: 651 LPPLGSFSTQPNGVFPKQESQQIVPTSRF 679
           LPP+GSF+  PNG      S++  P ++F
Sbjct: 474 LPPIGSFAP-PNGT----ASREYAPGNQF 497

 Score = 48.5 bits (114), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 39/64 (60%)

Query: 307 ALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIARVSSLFHDYPSLIQGFNTF 366
           A++Y+ ++K +F  +PD+Y  FL+I++ ++ +      V ++V+ LF   P L+  F  F
Sbjct: 363 AINYVNKIKNRFADQPDIYKRFLEILQTYQREQKPINEVYSQVTVLFQHAPDLLDDFKKF 422

Query: 367 LPQG 370
           LP+ 
Sbjct: 423 LPES 426

 Score = 47.4 bits (111), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 39/62 (62%)

Query: 548 AISYVNKIKNRFANQPYIYKHFLEILQTYQREQKPINEVYSQVTVLFQEAPDLLEDFKKF 607
           A+SY+ ++K +F+ +P IY  FL+I++ ++ +      V  +V+ LF+  P L++ F  F
Sbjct: 215 ALSYLEQVKYQFSQRPDIYNQFLDIMKDFKSQSIDTPGVIERVSALFRGYPMLVQGFNTF 274

Query: 608 LP 609
           LP
Sbjct: 275 LP 276

>YOL004W Chr15 (316938..321548) [4611 bp, 1536 aa] {ON}  SIN3Component
            of the Sin3p-Rpd3p histone deacetylase complex, involved
            in transcriptional repression and activation of diverse
            processes, including mating-type switching and meiosis;
            involved in the maintenance of chromosomal integrity
          Length = 1536

 Score = 1100 bits (2844), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 537/875 (61%), Positives = 667/875 (76%), Gaps = 24/875 (2%)

Query: 813  APDINDHQQQ----------VMYEENAVRPEIDLDPSLVPIVPEPTQPIEDTLPLVEETN 862
            AP    HQQQ            Y +  VRPEIDLDPS+VP+VPEPT+PIE+ + L EE  
Sbjct: 608  APSSIQHQQQHPQSISPIANTQYGDIPVRPEIDLDPSIVPVVPEPTEPIENNISLNEEVT 667

Query: 863  FFDKVKKYIGNKTIYAEFLKVLNLYSVDLLEVDELVEKIKYYLNDNEELFSWFKNFVGYV 922
            FF+K K+YIGNK +Y EFLK+LNLYS D+L++D+LVEK+ +YL  N+ELF+WFKNFVGY 
Sbjct: 668  FFEKAKRYIGNKHLYTEFLKILNLYSQDILDLDDLVEKVDFYLGSNKELFTWFKNFVGYQ 727

Query: 923  EKPKHIENIVHEKHKLDLDLCEACGPSYKKLPKTDTLMPCSGRDEMCWEILNDEWVGHPV 982
            EK K IENIVHEKH+LDLDLCEA GPSYK+LPK+DT MPCSGRD+MCWE+LNDEWVGHPV
Sbjct: 728  EKTKCIENIVHEKHRLDLDLCEAFGPSYKRLPKSDTFMPCSGRDDMCWEVLNDEWVGHPV 787

Query: 983  WASEDSGFIAHRKINTKKPYLRLKKKVHEYDFYIESNLRTIQTLETIASKIANMTENEKC 1042
            WASEDSGFIAHRK   ++   +++++ HEYDFYIESNLRTIQ LETI +KI NMTENEK 
Sbjct: 788  WASEDSGFIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQCLETIVNKIENMTENEKA 847

Query: 1043 NFKLPDGLGHTTSTIYKKVIRKVYDKERGFEIIDALHEYPAIAVPVVLKRLKQKDEEWRR 1102
            NFKLP GLGHT+ TIYKKVIRKVYDKERGFEIIDALHE+PA+  PVVLKRLKQKDEEWRR
Sbjct: 848  NFKLPPGLGHTSMTIYKKVIRKVYDKERGFEIIDALHEHPAVTAPVVLKRLKQKDEEWRR 907

Query: 1103 AQREWNKVWRELEQKVFFKSLDHLGLTFKQADKKLLTTKQLISEISSIKVDQTHKRMHWL 1162
            AQREWNKVWRELEQKVFFKSLDHLGLTFKQADKKLLTTKQLISEISSIKVDQT+K++HWL
Sbjct: 908  AQREWNKVWRELEQKVFFKSLDHLGLTFKQADKKLLTTKQLISEISSIKVDQTNKKIHWL 967

Query: 1163 TPKPKSQLDFNLPDKDIIFDILSFVEIFVEHTSTYSNPEKERLIDFMKYFTSLFFSIPLE 1222
            TPKPKSQLDF+ PDK+I +DIL   + F+ HT+ YSNP+KERL D +KYF SLFFSI  E
Sbjct: 968  TPKPKSQLDFDFPDKNIFYDILCLADTFITHTTAYSNPDKERLKDLLKYFISLFFSISFE 1027

Query: 1223 EIKEAISKRDITEKNDEKLEDKQKNGEENSKKRTSRDITLSLEDILQRTKYQRLKYGDDS 1282
            +I+E++      ++N  +           S+KR  +   +SL DIL R++YQ+LK  +D 
Sbjct: 1028 KIEESLYSH---KQNVSESSGSDDGSSIASRKRPYQQ-EMSLLDILHRSRYQKLKRSNDE 1083

Query: 1283 DEV--DGHGNRHDDQKXXXXXXXXRQEAKKPWLLGTLVEEANAQGEIMHRNIFNMFSNTN 1340
            D           ++           +EAK PWL G LVEEAN+QG I +R+IFN+F+NTN
Sbjct: 1084 DGKVPQLSEPPEEEPNTIEEEELIDEEAKNPWLTGNLVEEANSQGIIQNRSIFNLFANTN 1143

Query: 1341 MYIFIRHLTTMYERLHEIKQMNDKVSREISGRKISKFAKDLNLISTQLTEMGLDFSEGDV 1400
            +YIF RH TT+YERL EIKQMN++V++EI+ R    FAKDL+L+S+QL+EMGLDF   D 
Sbjct: 1144 IYIFFRHWTTIYERLLEIKQMNERVTKEINTRSTVTFAKDLDLLSSQLSEMGLDFVGEDA 1203

Query: 1401 YQQLLVLCKRLILGDLEHQWFEESLRQAFNNKAFKLYTLDKVTQALVKHAHTIISDLKTT 1460
            Y+Q+L L +RLI GDLEHQWFEESLRQA+NNKAFKLYT+DKVTQ+LVKHAHT+++D KT 
Sbjct: 1204 YKQVLRLSRRLINGDLEHQWFEESLRQAYNNKAFKLYTIDKVTQSLVKHAHTLMTDAKTA 1263

Query: 1461 EIMALFEKDRTKNSTSSKDQILYRLQTRARMTHNENMFRIEYNNTTKHICIQYIALDDLT 1520
            EIMALF KDR  ++TS+KDQI+YRLQ R+ M++ ENMFRIE++  T H+ IQYIALDDLT
Sbjct: 1264 EIMALFVKDRNASTTSAKDQIIYRLQVRSHMSNTENMFRIEFDKRTLHVSIQYIALDDLT 1323

Query: 1521 VKDAKTLEEKWKYYITSYALSHPTEGIFQENIQIPFXXXXXXXXXXXXXXXXXXXKQTKS 1580
            +K+ K  E+KWKYY+TSYAL HPTEGI  E ++IPF                     T+ 
Sbjct: 1324 LKEPKADEDKWKYYVTSYALPHPTEGIPHEKLKIPFLERLIEFGQDIDG--------TEV 1375

Query: 1581 LMKYSPEGISGSTLKIKIDPQNYCLNIEEGSFDIFSRKSLNQFPVKLTQDSKYGTMPKLK 1640
              ++SPEGIS STLKIKI P  Y L+IE GS+D+F+RK+ N++P     +++ G + + K
Sbjct: 1376 DEEFSPEGISVSTLKIKIQPITYQLHIENGSYDVFTRKATNKYPTIANDNTQKGMVSQKK 1435

Query: 1641 NTVEKFLNSKMGWKRAISKDQMESIESKWDHLSNN 1675
              + KFL+  +G +  + + Q  S++ KW++L ++
Sbjct: 1436 ELISKFLDCAVGLRNNLDEAQKLSMQKKWENLKDS 1470

 Score =  296 bits (757), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 191/399 (47%), Positives = 222/399 (55%), Gaps = 89/399 (22%)

Query: 296 DNQYRPLNVKDALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIARVSSLFHD 355
           D  YRPLNVKDALSYLEQVKFQF+SRPD+YN FLDIMKDFKSQAIDTPGVI RVS+LF  
Sbjct: 213 DADYRPLNVKDALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRG 272

Query: 356 YPSLIQGFNTFLPQGYRIECSSNPNLPITVITPMGTTTVSGVLETSVTENQNHQLQHSLP 415
           YP LIQGFNTFLPQGYRIECSSNP+ PI V TPMGTTTV+  +  S     + Q   S P
Sbjct: 273 YPILIQGFNTFLPQGYRIECSSNPDDPIRVTTPMGTTTVNNNISPSGRGTTDAQELGSFP 332

Query: 416 QPSTTASASNVDSKVSSISGIMGPSNITEXXXXXXXXXXXXLINVNDSAPISGSISSTVP 475
           +              S  +G+  PSN+                +   S P+  + SS +P
Sbjct: 333 E--------------SDGNGVQQPSNVP--MVPSSVYQSEQNQDQQQSLPLLAT-SSGLP 375

Query: 476 SNVEPTNMXXXXXXXXXXXXXLPNTNTPKSXXXXXXXXXXXXXXXFPMVSSVSPPLQELP 535
           S  +P                +P                       P   S+ P  QE  
Sbjct: 376 SIQQP---------------EMP------------------AHRQIPQSQSLVP--QE-- 398

Query: 536 EQRRTQDVEFSQAISYVNKIKNRFANQPYIYKHFLEILQTYQREQKPINEVYSQVTVLFQ 595
           + ++  DVEFSQAISYVNKIK RFA+QP IYKHFLEILQTYQREQKPINEVY+QVT LFQ
Sbjct: 399 DAKKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTHLFQ 458

Query: 596 EAPDLLEDFKKFLPDSSANNN------------------------------GSIVTSQEE 625
            APDLLEDFKKFLPDSSA+ N                                    Q++
Sbjct: 459 NAPDLLEDFKKFLPDSSASANQQVQHAQQHAQQQHEAQMHAQAQAQAQAQAQVEQQKQQQ 518

Query: 626 NFMY-ANGFNQQQPHLTPHSEIQAQNLPPLGSFSTQPNG 663
            F+Y A+G+         +  I  QNLPP+GSFS   NG
Sbjct: 519 QFLYPASGYYGH----PSNRGIPQQNLPPIGSFSPPTNG 553

>ACL004W Chr3 (347727..351860) [4134 bp, 1377 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YOL004W (SIN3)
          Length = 1377

 Score = 1095 bits (2832), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 528/870 (60%), Positives = 653/870 (75%), Gaps = 20/870 (2%)

Query: 821  QQVMYEENAVRPEIDLDPSLVPIVPEPTQPIEDTLPLVEETNFFDKVKKYIGNKTIYAEF 880
            Q V Y E  VRPEIDLDPSLVP++PEP +P+ED L LVEE  FFDK KK+IGNK IY EF
Sbjct: 462  QDVQYMEPTVRPEIDLDPSLVPVIPEPIKPLEDELNLVEEATFFDKAKKFIGNKQIYTEF 521

Query: 881  LKVLNLYSVDLLEVDELVEKIKYYLNDNEELFSWFKNFVGYVEKPKHIENIVHEKHKLDL 940
            LK+LNLYS DLLE ++LVE + +YL+ + ELF WFK+FVGY E+PKHIEN++HEKH+LDL
Sbjct: 522  LKILNLYSQDLLEKEKLVEDVSHYLSGSPELFDWFKSFVGYQERPKHIENVIHEKHRLDL 581

Query: 941  DLCEACGPSYKKLPKTDTLMPCSGRDEMCWEILNDEWVGHPVWASEDSGFIAHRKINTKK 1000
            DLCEACGPSYK+LPK DT MPCSGRDEMCWE+LNDEWVGHPVWASEDSGFIAHRK   + 
Sbjct: 582  DLCEACGPSYKRLPKADTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYED 641

Query: 1001 PYLRLKKKVHEYDFYIESNLRTIQTLETIASKIANMTENEKCNFKLPDGLGHTTSTIYKK 1060
               +++++ HEYDFYIE+NLRTIQTLETIA+KIANMT  EK  FKLP GLGHT+ TIYKK
Sbjct: 642  TLFKIEEERHEYDFYIEANLRTIQTLETIANKIANMTPEEKAAFKLPPGLGHTSVTIYKK 701

Query: 1061 VIRKVYDKERGFEIIDALHEYPAIAVPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVFF 1120
            VIRKVYDK+RGFEIIDALHE+PAI VP+VLKRLKQKDEEWRRAQREWNKVWRELEQKVF+
Sbjct: 702  VIRKVYDKDRGFEIIDALHEHPAITVPLVLKRLKQKDEEWRRAQREWNKVWRELEQKVFY 761

Query: 1121 KSLDHLGLTFKQADKKLLTTKQLISEISSIKVDQTHKRMHWLTPKPKSQLDFNLPDKDII 1180
            KSLDHLGLTFKQADKKLLT KQLISEISSIKVDQ++KR+H LTPK KSQL ++  + ++ 
Sbjct: 762  KSLDHLGLTFKQADKKLLTAKQLISEISSIKVDQSNKRIHPLTPKAKSQLSYDFKEPEVF 821

Query: 1181 FDILSFVEIFVEHTSTYSNPEKERLIDFMKYFTSLFFSIPLEEIKEAISKRDITEKNDEK 1240
             DILS V +F+ + +TYS  + ERL DF K F SLFFS PL EI+E + KR         
Sbjct: 822  QDILSLVMVFLANNNTYSPSDNERLKDFFKGFISLFFSYPLHEIEEGLLKRSSQNGTISH 881

Query: 1241 LEDKQKNGEE------NSKKRTSRDITLSLEDILQRTKYQRLKYGDDSDEVDGHGNRHDD 1294
             +D +K+ E+      +++KR   D    L DIL R K Q++  G  +D+      +  D
Sbjct: 882  GDDTRKSKEDPKTEKHSARKRVRDDTEHLLRDILYRNKQQKVNKGPQNDQSSEEFEKESD 941

Query: 1295 QKXXXXXXXXRQEAKKPWLLGTLVEEANAQGEIMHRNIFNMFSNTNMYIFIRHLTTMYER 1354
                      RQEAKKPWLLG++V+EA+  G +  R  FNMF+NTN+Y+F RHLTTMYER
Sbjct: 942  ---IEEKEIVRQEAKKPWLLGSIVDEADNHGHVSDRVTFNMFANTNIYVFFRHLTTMYER 998

Query: 1355 LHEIKQMNDKVSREISGRKISKFAKDLNLISTQLTEMGLDFSEGDVYQQLLVLCKRLILG 1414
            L E+K++N +V++EIS RK+ +FAKDLNLISTQLT+MGLDF   D Y++LL L + LI G
Sbjct: 999  LVEVKKINGEVTKEISNRKVVQFAKDLNLISTQLTDMGLDFKGADAYEELLRLSRSLISG 1058

Query: 1415 DLEHQWFEESLRQAFNNKAFKLYTLDKVTQALVKHAHTIISDLKTTEIMALFEKDRTKNS 1474
            +LEHQWFEESLRQA+ NKAFKLYT+DKV QALVKHAHTI+ D KT EIM LF+ DRT  S
Sbjct: 1059 ELEHQWFEESLRQAYKNKAFKLYTIDKVIQALVKHAHTILMDHKTVEIMLLFDNDRTSTS 1118

Query: 1475 TSSKDQILYRLQTRARMTHNENMFRIEYNNTTKHICIQYIALDDLTVKDAKTLEEKWKYY 1534
            TS+KDQILYRLQ R+ M++ ENMFRIEYN TT H  IQ++A++DLT+ + K+L +KW+YY
Sbjct: 1119 TSTKDQILYRLQVRSNMSNIENMFRIEYNTTTSHASIQFVAVEDLTLDEPKSLRDKWQYY 1178

Query: 1535 ITSYALSHPTEGIFQENIQIPFXXXXXXXXXXXXXXXXXXXKQTKSLMKYSPEGISGSTL 1594
            +TSY+LSHPTEGI  +N++ PF                          +YSPEG++ S +
Sbjct: 1179 LTSYSLSHPTEGISHDNLRTPFLEKIIERDEGYIDDGDE---------RYSPEGVASSNM 1229

Query: 1595 KIKIDPQNYCLNIEEGSFDIFSRKSLNQFPVKLTQDSKYGTMPKLKNTVEKFLNSKMGWK 1654
            K+KIDP  Y + +E G  DIFSRKS+N+FP ++  D K     +LK  +E FLN + GWK
Sbjct: 1230 KVKIDPLTYSMEVEPGCHDIFSRKSVNKFPTRV--DVKKKKSAELKLVLEGFLNGERGWK 1287

Query: 1655 RAISKDQMESIESKWDHLSNNGNLEGYQEK 1684
            R ++  +    E + +++ NNG L+ Y E+
Sbjct: 1288 RGLTTKRTAEAERRLEYVKNNGTLDDYAEE 1317

 Score =  177 bits (449), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 90/147 (61%), Positives = 104/147 (70%), Gaps = 9/147 (6%)

Query: 293 PKEDNQ-YRPLNVKDALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIARVSS 351
           P +D   YRPLNVKDALSYLEQVKFQF+SRPDVYNHFLDIMKDFKSQAIDTPGVI RVS+
Sbjct: 122 PAQDGSAYRPLNVKDALSYLEQVKFQFSSRPDVYNHFLDIMKDFKSQAIDTPGVIERVST 181

Query: 352 LFHDYPSLIQGFNTFLPQGYRIECSSNPNLPITVITPMGTTTVSGVLETSVTENQNH--- 408
           LFH YP+LIQGFNTFLP GY IEC S+PN PI V TP G  T+  +  T    N  H   
Sbjct: 182 LFHGYPALIQGFNTFLPHGYNIECPSDPNDPIKVTTPFG--TIGEIPITGAGGNHAHGAN 239

Query: 409 ---QLQHSLPQPSTTASASNVDSKVSS 432
              +LQ +   P+   SA    + +++
Sbjct: 240 TEPRLQSTQNVPTVYRSAEGSPAAIAT 266

 Score =  154 bits (389), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 84/130 (64%), Positives = 94/130 (72%), Gaps = 13/130 (10%)

Query: 538 RRTQDVEFSQAISYVNKIKNRFANQPYIYKHFLEILQTYQREQKPINEVYSQVTVLFQEA 597
           ++  DVEFS AISYVNKIK RFA QP IYKHFLEILQTYQREQKPINEVY+QVTVLFQ A
Sbjct: 279 KKAGDVEFSHAISYVNKIKTRFAEQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQNA 338

Query: 598 PDLLEDFKKFLPDSSANN-------NGSIVTSQEENFMYA-NGFNQQQPHLTPHSEIQAQ 649
           PDLL+DFKKFLPDSSA         NG++V      F +A +G  Q  P   P   +  Q
Sbjct: 339 PDLLDDFKKFLPDSSAPQLQSHQQINGAMVAP---GFGHAQSGLQQALPGTQPL--MHQQ 393

Query: 650 NLPPLGSFST 659
           NLPPLG+FST
Sbjct: 394 NLPPLGNFST 403

 Score = 57.8 bits (138), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 36/133 (27%), Positives = 66/133 (49%), Gaps = 3/133 (2%)

Query: 307 ALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIARVSSLFHDYPSLIQGFNTF 366
           A+SY+ ++K +F  +PD+Y HFL+I++ ++ +      V A+V+ LF + P L+  F  F
Sbjct: 289 AISYVNKIKTRFAEQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQNAPDLLDDFKKF 348

Query: 367 LPQGYRIECSSNPNLPITVITPMGTTTVSGVLETSVTENQNHQLQHSLPQPSTTASASNV 426
           LP     +  S+  +   ++ P      SG L+ ++   Q    Q +LP     ++    
Sbjct: 349 LPDSSAPQLQSHQQINGAMVAPGFGHAQSG-LQQALPGTQPLMHQQNLPPLGNFSTPG-- 405

Query: 427 DSKVSSISGIMGP 439
           D    S+  + GP
Sbjct: 406 DHHPMSLPSVQGP 418

 Score = 51.2 bits (121), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 40/62 (64%)

Query: 548 AISYVNKIKNRFANQPYIYKHFLEILQTYQREQKPINEVYSQVTVLFQEAPDLLEDFKKF 607
           A+SY+ ++K +F+++P +Y HFL+I++ ++ +      V  +V+ LF   P L++ F  F
Sbjct: 137 ALSYLEQVKFQFSSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFHGYPALIQGFNTF 196

Query: 608 LP 609
           LP
Sbjct: 197 LP 198

>Smik_15.166 Chr15 (284165..288865) [4701 bp, 1566 aa] {ON} YOL004W
            (REAL)
          Length = 1566

 Score = 1090 bits (2818), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 529/852 (62%), Positives = 648/852 (76%), Gaps = 14/852 (1%)

Query: 825  YEENAVRPEIDLDPSLVPIVPEPTQPIEDTLPLVEETNFFDKVKKYIGNKTIYAEFLKVL 884
            Y +  VRPEIDLDPS+VP+VPEPT+PIED + L EE  FF+K K+YIGNK +Y EFLK+L
Sbjct: 662  YGDVPVRPEIDLDPSIVPVVPEPTEPIEDNISLNEEVTFFEKAKRYIGNKHLYTEFLKIL 721

Query: 885  NLYSVDLLEVDELVEKIKYYLNDNEELFSWFKNFVGYVEKPKHIENIVHEKHKLDLDLCE 944
            NLYS D+L++D+LVEK+ +YL  N+ELFSWFKNFVGY E+ K IENIVHEKH+LDLDLCE
Sbjct: 722  NLYSQDILDLDDLVEKVDFYLGSNKELFSWFKNFVGYQERTKFIENIVHEKHRLDLDLCE 781

Query: 945  ACGPSYKKLPKTDTLMPCSGRDEMCWEILNDEWVGHPVWASEDSGFIAHRKINTKKPYLR 1004
            A GPSYK+LPK+DT MPCSGRD+MCWE+LNDEWVGHPVWASEDSGFIAHRK   ++   +
Sbjct: 782  AFGPSYKRLPKSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFK 841

Query: 1005 LKKKVHEYDFYIESNLRTIQTLETIASKIANMTENEKCNFKLPDGLGHTTSTIYKKVIRK 1064
            ++++ HEYDFYIESNLRTIQ LETI +KI NMTENEK NFKLP GLGHT+ TIYKKVIRK
Sbjct: 842  IEEERHEYDFYIESNLRTIQCLETIVNKIENMTENEKVNFKLPPGLGHTSMTIYKKVIRK 901

Query: 1065 VYDKERGFEIIDALHEYPAIAVPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVFFKSLD 1124
            VYDKERGFEIIDALHE+PA+  PVVLKRLKQKDEEWRRAQREWNKVWRELEQKVFFKSLD
Sbjct: 902  VYDKERGFEIIDALHEHPAVTAPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVFFKSLD 961

Query: 1125 HLGLTFKQADKKLLTTKQLISEISSIKVDQTHKRMHWLTPKPKSQLDFNLPDKDIIFDIL 1184
            HLGLTFKQADKKLLTTKQLISEISSIKVDQT+K++HWLTPKPKSQLDF+ PDK+I  DIL
Sbjct: 962  HLGLTFKQADKKLLTTKQLISEISSIKVDQTNKKIHWLTPKPKSQLDFDFPDKNIFCDIL 1021

Query: 1185 SFVEIFVEHTSTYSNPEKERLIDFMKYFTSLFFSIPLEEIKEAISKRDITEKNDEKLEDK 1244
               + F+ HT+ YSNP+KERL D +KYF SLFFSI LEEI+E++       K        
Sbjct: 1022 YLADSFISHTTAYSNPDKERLKDLLKYFISLFFSISLEEIEESLQ----AYKQSVSESSG 1077

Query: 1245 QKNGEENSKKRTSRDITLSLEDILQRTKYQRLKYGDDSDEVDGHGNRHDD--QKXXXXXX 1302
              +G  +  ++ S    ++L DIL R++YQ+LK   D D      +   D          
Sbjct: 1078 SDDGGSSVSRKRSYQQEMTLLDILHRSRYQKLKRSKDEDGKVPQLSEAPDEESNIIEEEE 1137

Query: 1303 XXRQEAKKPWLLGTLVEEANAQGEIMHRNIFNMFSNTNMYIFIRHLTTMYERLHEIKQMN 1362
               +EAK PWL G LVEEAN+QG I +R IFN+F+NTN+YIF RH TT+YERL EIKQMN
Sbjct: 1138 LINEEAKNPWLTGNLVEEANSQGMIQNRGIFNLFANTNIYIFFRHWTTIYERLLEIKQMN 1197

Query: 1363 DKVSREISGRKISKFAKDLNLISTQLTEMGLDFSEGDVYQQLLVLCKRLILGDLEHQWFE 1422
            +KV++EI+ R    FAKDL+L+S QL+EMGLDF   D Y+Q+L L +RLI GDLEHQWFE
Sbjct: 1198 EKVTKEINTRSTVTFAKDLDLLSNQLSEMGLDFIGEDAYKQVLKLSRRLINGDLEHQWFE 1257

Query: 1423 ESLRQAFNNKAFKLYTLDKVTQALVKHAHTIISDLKTTEIMALFEKDRTKNSTSSKDQIL 1482
            ESLRQA+NN+AFKLYT+DKVTQ+LVKHAHT+++D KT EIMALF KDR   +TS+K QI+
Sbjct: 1258 ESLRQAYNNRAFKLYTIDKVTQSLVKHAHTLMTDAKTAEIMALFVKDRNVTTTSAKGQII 1317

Query: 1483 YRLQTRARMTHNENMFRIEYNNTTKHICIQYIALDDLTVKDAKTLEEKWKYYITSYALSH 1542
            YRLQ R+ M++ ENMFRIE++  T H+ IQYIALDDLT+K+ K  E+KWKYY+TSYAL H
Sbjct: 1318 YRLQVRSHMSNTENMFRIEFDKRTLHVSIQYIALDDLTLKEPKEDEDKWKYYVTSYALPH 1377

Query: 1543 PTEGIFQENIQIPFXXXXXXXXXXXXXXXXXXXKQTKSLMKYSPEGISGSTLKIKIDPQN 1602
            PTEG+  E ++IPF                          K+SPEGIS STLKIKI P  
Sbjct: 1378 PTEGVLHEKLKIPFLERLIEFGQDIDGKDVDE--------KFSPEGISVSTLKIKIQPTT 1429

Query: 1603 YCLNIEEGSFDIFSRKSLNQFPVKLTQDSKYGTMPKLKNTVEKFLNSKMGWKRAISKDQM 1662
            Y L+IE GS+D+F+RKS N++P     D+    + + K  + +FL+  +  +  +++ Q 
Sbjct: 1430 YKLDIENGSYDVFTRKSANKYPTVANDDTHKEVVVQKKELISRFLDCAVHLRNDLNESQK 1489

Query: 1663 ESIESKWDHLSN 1674
             S++ K++ L +
Sbjct: 1490 ISMQEKFESLKD 1501

 Score =  180 bits (456), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 83/96 (86%), Positives = 88/96 (91%)

Query: 299 YRPLNVKDALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIARVSSLFHDYPS 358
           YRPLNVKDALSYLEQVKFQF+SRPD+YN FLDIMKDFKSQAIDTPGVI RVS+LF  YP 
Sbjct: 229 YRPLNVKDALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRGYPI 288

Query: 359 LIQGFNTFLPQGYRIECSSNPNLPITVITPMGTTTV 394
           LIQGFNTFLPQGYRIECS+NP+ PI V TPMGTTTV
Sbjct: 289 LIQGFNTFLPQGYRIECSTNPDDPIRVTTPMGTTTV 324

 Score =  139 bits (350), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 69/87 (79%), Positives = 75/87 (86%)

Query: 530 PLQELPEQRRTQDVEFSQAISYVNKIKNRFANQPYIYKHFLEILQTYQREQKPINEVYSQ 589
           PL    + ++  DVEFSQAISYVNKIK RFA+QP IYKHFLEILQTYQREQKPINEVY+Q
Sbjct: 406 PLAVQEDVKKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQ 465

Query: 590 VTVLFQEAPDLLEDFKKFLPDSSANNN 616
           VT LFQ APDLLEDFKKFLPDSSA+ N
Sbjct: 466 VTHLFQNAPDLLEDFKKFLPDSSASAN 492

 Score = 56.2 bits (134), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 41/62 (66%)

Query: 307 ALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIARVSSLFHDYPSLIQGFNTF 366
           A+SY+ ++K +F  +PD+Y HFL+I++ ++ +      V A+V+ LF + P L++ F  F
Sbjct: 424 AISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTHLFQNAPDLLEDFKKF 483

Query: 367 LP 368
           LP
Sbjct: 484 LP 485

 Score = 46.2 bits (108), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 40/62 (64%)

Query: 548 AISYVNKIKNRFANQPYIYKHFLEILQTYQREQKPINEVYSQVTVLFQEAPDLLEDFKKF 607
           A+SY+ ++K +F+++P IY  FL+I++ ++ +      V  +V+ LF+  P L++ F  F
Sbjct: 237 ALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRGYPILIQGFNTF 296

Query: 608 LP 609
           LP
Sbjct: 297 LP 298

>NDAI0C02660 Chr3 complement(615526..620499) [4974 bp, 1657 aa] {ON}
            Anc_6.29 YOL004W
          Length = 1657

 Score = 1087 bits (2811), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 533/874 (60%), Positives = 657/874 (75%), Gaps = 28/874 (3%)

Query: 824  MYEENAVRPEIDLDPSLVPIVPEPTQPIEDTLPLVEETNFFDKVKKYIGNKTIYAEFLKV 883
            +  E   RPEIDLDPS+VPI+PEPT+PIE+ + LVEET+FF+KVKK+I +K IY EFLKV
Sbjct: 710  LISEAPTRPEIDLDPSIVPIIPEPTEPIENNITLVEETSFFEKVKKFISSKPIYMEFLKV 769

Query: 884  LNLYSVDLLEVDELVEKIKYYLNDNEELFSWFKNFVGYVEKPKHIENIVHEKHKLDLDLC 943
            LNLYS DLL  +ELV ++ YY+  N+ELF WFK FVGY E P  IENI+HEKHKLDLDLC
Sbjct: 770  LNLYSQDLLSTNELVTRVDYYIGSNKELFDWFKTFVGYSEIPSTIENIIHEKHKLDLDLC 829

Query: 944  EACGPSYKKLPKTDTLMPCSGRDEMCWEILNDEWVGHPVWASEDSGFIAHRKINTKKPYL 1003
            EA GPSYKKLPKTDT MPCSGRD MCWE+LNDEWVGHPVWASEDSGFIAHRK   ++   
Sbjct: 830  EAYGPSYKKLPKTDTFMPCSGRDAMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLF 889

Query: 1004 RLKKKVHEYDFYIESNLRTIQTLETIASKIANMTENEKCNFKLPDGLGHTTSTIYKKVIR 1063
            +++++ HEYDF+IESNLRTIQTLETIA+KI NMT  EK NFKLP GLGHT+STIYKKVIR
Sbjct: 890  KIEEERHEYDFHIESNLRTIQTLETIANKINNMTAEEKKNFKLPVGLGHTSSTIYKKVIR 949

Query: 1064 KVYDKERGFEIIDALHEYPAIAVPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVFFKSL 1123
            KVYDKERGFEIIDALHE+PA AVP++L+RLK+KDEEWRRAQREWNKVWRELEQKV++KSL
Sbjct: 950  KVYDKERGFEIIDALHEHPAFAVPIILRRLKEKDEEWRRAQREWNKVWRELEQKVYYKSL 1009

Query: 1124 DHLGLTFKQADKKLLTTKQLISEISSIKVDQTHKRMHWLTPKPKSQLDFNLPDKDIIFDI 1183
            DHLGLTFKQADKKLLTTKQLISEISSI+VDQ +KR+HWLTPKPKSQLDF   D DI+ DI
Sbjct: 1010 DHLGLTFKQADKKLLTTKQLISEISSIQVDQNNKRIHWLTPKPKSQLDFTFNDHDILVDI 1069

Query: 1184 LSFVEIFVEHTSTYSNPEKERLIDFMKYFTSLFFSIPLEEIKEAISKRDITEKNDEKLED 1243
            L    +F++HTSTYSN EKERL DF++ F  LFFSIP  EI + +S      KNDEK E 
Sbjct: 1070 LDLANVFIDHTSTYSNSEKERLKDFLRVFIGLFFSIPSSEIDKKLSG-----KNDEKFEK 1124

Query: 1244 -----KQKNGEENSKKRTSRDITLSLEDILQRTKYQRLKYGDDSDEVDGHGNRHDDQKXX 1298
                    +    S K+ S ++ + L D+L++ KYQ++K     +E++ + N +D++   
Sbjct: 1125 GSSSSSSTSNSTPSAKKRSLELDIPLADVLRKYKYQKIK-EKVINELENNSNEYDERDEE 1183

Query: 1299 XXXXXXR-------------QEAKKPWLLGTLVEEANAQGEIMHRNIFNMFSNTNMYIFI 1345
                  R             +E KKPWLLG+++++ +  G I +R+IFN+F+NTN+Y+F 
Sbjct: 1184 FDEELKRQQQEQEEEDHMIDEEMKKPWLLGSVIDKTSEHGLIENRHIFNLFANTNIYVFF 1243

Query: 1346 RHLTTMYERLHEIKQMNDKVSREISGRKISKFAKDLNLISTQLTEMGLDFSEGDVYQQLL 1405
            RH TT+YERL E+KQ+NDKV+REI+ RK++ FAKDL LISTQLT MGLDF   D Y++LL
Sbjct: 1244 RHWTTIYERLLELKQINDKVTREINSRKVTPFAKDLGLISTQLTMMGLDFKTSDSYKELL 1303

Query: 1406 VLCKRLILGDLEHQWFEESLRQAFNNKAFKLYTLDKVTQALVKHAHTIISDLKTTEIMAL 1465
             L KRLI  D+EHQWFEESLRQA+NNKAFKLYT DKV QALVKHA++I++D K +EIMAL
Sbjct: 1304 NLTKRLIKNDIEHQWFEESLRQAYNNKAFKLYTADKVIQALVKHANSILTDSKASEIMAL 1363

Query: 1466 FEKDRTKNSTSSKDQILYRLQTRARMTHNENMFRIEYNNTTKHICIQYIALDDLTVKDAK 1525
            FEKDR ++ST+++DQI+YRLQTR  MT+ ENMFRIE+N  T H+CIQYIA++DLT+K + 
Sbjct: 1364 FEKDRLRSSTTTRDQIIYRLQTRTHMTNTENMFRIEFNENTNHVCIQYIAVEDLTLKPSP 1423

Query: 1526 TLEEKWKYYITSYALSHPTEGIFQENIQIPFXXXXXXXXXXXXXXXXXXXKQTKSLMKYS 1585
            T +E W+YY+TSYAL HPTEG+ QE +++PF                   ++ + + K S
Sbjct: 1424 TTKETWEYYVTSYALPHPTEGVPQEGLKVPFLEKNLNLELENAQDLDNETEKNEFIEKIS 1483

Query: 1586 PEGISGSTLKIKIDPQNYCLNIEEGSFDIFSRKSLNQFPVKLTQDSKYGTMPKLKN-TVE 1644
            PEGIS S LKIKID + Y L++E GSFD+FSRKSLN+FP   T   K  +  K K+    
Sbjct: 1484 PEGISTSKLKIKIDQETYNLDVEPGSFDVFSRKSLNKFP---TDAKKIESSIKEKSEAFN 1540

Query: 1645 KFLNSKMGWKRAISKDQMESIESKWDHLSNNGNL 1678
            KFL+SK GW      DQ+  IE  W      G  
Sbjct: 1541 KFLSSKRGWNNQFKPDQVAGIEEGWKKFQETGEF 1574

 Score =  167 bits (424), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 77/104 (74%), Positives = 87/104 (83%)

Query: 294 KEDNQYRPLNVKDALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIARVSSLF 353
           +ED +YRPLNVKDALSYLEQVK QFNS+P +YN FLDIMKDFKSQ IDTPGVI RVS+LF
Sbjct: 265 EEDPEYRPLNVKDALSYLEQVKVQFNSQPVIYNQFLDIMKDFKSQTIDTPGVIERVSTLF 324

Query: 354 HDYPSLIQGFNTFLPQGYRIECSSNPNLPITVITPMGTTTVSGV 397
             YP LIQGFNTFLPQGY I CS NP+ P+ V TPMGT+T + +
Sbjct: 325 KGYPVLIQGFNTFLPQGYTIHCSDNPDDPVRVTTPMGTSTYTNL 368

 Score =  135 bits (341), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 76/135 (56%), Positives = 93/135 (68%), Gaps = 20/135 (14%)

Query: 542 DVEFSQAISYVNKIKNRFANQPYIYKHFLEILQTYQREQKPINEVYSQVTVLFQEAPDLL 601
           +VEFSQAI+YVNKIK R+A+QP+IYKHFLEILQTYQRE+KPI+EVY QVTVLF +APDLL
Sbjct: 464 EVEFSQAINYVNKIKTRYADQPFIYKHFLEILQTYQREEKPISEVYEQVTVLFNDAPDLL 523

Query: 602 EDFKKFLPDSSANNN------------------GSIVTSQEENFMYANGFNQQQPHLTPH 643
           EDFKKFLP++ ANN                    SI   Q+ + +Y   F+   P  +  
Sbjct: 524 EDFKKFLPETPANNQPVQQPHAHPQLQQLQPRIPSISQQQQPSQLYP--FSNNGPVPSGF 581

Query: 644 SEIQAQNLPPLGSFS 658
            +I  QNLPP+GSFS
Sbjct: 582 YQIPQQNLPPIGSFS 596

 Score = 50.4 bits (119), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 41/63 (65%)

Query: 307 ALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIARVSSLFHDYPSLIQGFNTF 366
           A++Y+ ++K ++  +P +Y HFL+I++ ++ +      V  +V+ LF+D P L++ F  F
Sbjct: 470 AINYVNKIKTRYADQPFIYKHFLEILQTYQREEKPISEVYEQVTVLFNDAPDLLEDFKKF 529

Query: 367 LPQ 369
           LP+
Sbjct: 530 LPE 532

 Score = 48.9 bits (115), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 45/78 (57%), Gaps = 3/78 (3%)

Query: 532 QELPEQRRTQDVEFSQAISYVNKIKNRFANQPYIYKHFLEILQTYQREQKPINEVYSQVT 591
           +E PE R    +    A+SY+ ++K +F +QP IY  FL+I++ ++ +      V  +V+
Sbjct: 265 EEDPEYR---PLNVKDALSYLEQVKVQFNSQPVIYNQFLDIMKDFKSQTIDTPGVIERVS 321

Query: 592 VLFQEAPDLLEDFKKFLP 609
            LF+  P L++ F  FLP
Sbjct: 322 TLFKGYPVLIQGFNTFLP 339

 Score = 35.0 bits (79), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 31/59 (52%), Gaps = 1/59 (1%)

Query: 862 NFFDKVK-KYIGNKTIYAEFLKVLNLYSVDLLEVDELVEKIKYYLNDNEELFSWFKNFV 919
           N+ +K+K +Y     IY  FL++L  Y  +   + E+ E++    ND  +L   FK F+
Sbjct: 472 NYVNKIKTRYADQPFIYKHFLEILQTYQREEKPISEVYEQVTVLFNDAPDLLEDFKKFL 530

>Suva_15.171 Chr15 (291325..296010) [4686 bp, 1561 aa] {ON} YOL004W
            (REAL)
          Length = 1561

 Score = 1083 bits (2802), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 527/850 (62%), Positives = 649/850 (76%), Gaps = 14/850 (1%)

Query: 825  YEENAVRPEIDLDPSLVPIVPEPTQPIEDTLPLVEETNFFDKVKKYIGNKTIYAEFLKVL 884
            Y +  VRPEIDLDPS+VP+VPEPT+PIED + L EE  FF+K K+YIGNK +Y EFLK+L
Sbjct: 654  YGDVPVRPEIDLDPSIVPVVPEPTEPIEDNISLNEEVTFFEKAKRYIGNKHLYTEFLKIL 713

Query: 885  NLYSVDLLEVDELVEKIKYYLNDNEELFSWFKNFVGYVEKPKHIENIVHEKHKLDLDLCE 944
            NLYS D+L++D+LVEK+ +YL  N+ELFSWFKNFVGY EK K IEN+VHEKH+LDLDLCE
Sbjct: 714  NLYSQDILDLDDLVEKVDFYLGSNKELFSWFKNFVGYQEKIKSIENVVHEKHRLDLDLCE 773

Query: 945  ACGPSYKKLPKTDTLMPCSGRDEMCWEILNDEWVGHPVWASEDSGFIAHRKINTKKPYLR 1004
            A GPSYK+LPK+DT MPCSGRD+MCWE+LNDEWVGHPVWASEDSGFIAHRK   ++   +
Sbjct: 774  AFGPSYKRLPKSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFK 833

Query: 1005 LKKKVHEYDFYIESNLRTIQTLETIASKIANMTENEKCNFKLPDGLGHTTSTIYKKVIRK 1064
            ++++ HEYDFYIESNLRTIQ LETI +KI NMTENEK NFKLP GLGHT+ TIYKKVIRK
Sbjct: 834  IEEERHEYDFYIESNLRTIQCLETIVNKIENMTENEKANFKLPPGLGHTSMTIYKKVIRK 893

Query: 1065 VYDKERGFEIIDALHEYPAIAVPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVFFKSLD 1124
            VYDKERGFEIIDALHE+PA+  PVVLKRLKQKDEEWRRAQREWNKVWRELEQKV+FKSLD
Sbjct: 894  VYDKERGFEIIDALHEHPAVTAPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVYFKSLD 953

Query: 1125 HLGLTFKQADKKLLTTKQLISEISSIKVDQTHKRMHWLTPKPKSQLDFNLPDKDIIFDIL 1184
            HLGLTFKQADKKLLTTKQLISEISSIKVDQT+K++HWLTPKPKSQLDF+ PDKDI +DIL
Sbjct: 954  HLGLTFKQADKKLLTTKQLISEISSIKVDQTNKKIHWLTPKPKSQLDFDFPDKDIFYDIL 1013

Query: 1185 SFVEIFVEHTSTYSNPEKERLIDFMKYFTSLFFSIPLEEIKEAISKRDITEKNDEKLEDK 1244
               + F+ HT+ YSNP+KERL D + YF SLFFSIPLE+I+EA+      ++N       
Sbjct: 1014 YLADSFIAHTTAYSNPDKERLKDLLNYFISLFFSIPLEKIEEALQS---YKQNLSDSSGS 1070

Query: 1245 QKNGEENSKKRTSRDITLSLEDILQRTKYQRLKYGDDSDEVDGHGNRHDD--QKXXXXXX 1302
                    +KR  +   +SL DIL R+KYQ+LK  +D D      +   D          
Sbjct: 1071 DDGDSSTPRKRPYQQ-EMSLLDILHRSKYQKLKRSNDEDGKVPQLSEPLDEESNAIEEEE 1129

Query: 1303 XXRQEAKKPWLLGTLVEEANAQGEIMHRNIFNMFSNTNMYIFIRHLTTMYERLHEIKQMN 1362
               +EAK PWL G LVEEAN+QG I +RNIFN+F+N+N+YIF RH TT+YERL EIKQMN
Sbjct: 1130 LINEEAKNPWLTGNLVEEANSQGIIQNRNIFNLFANSNIYIFFRHWTTIYERLLEIKQMN 1189

Query: 1363 DKVSREISGRKISKFAKDLNLISTQLTEMGLDFSEGDVYQQLLVLCKRLILGDLEHQWFE 1422
            +KV++EIS R +  FAKDL+L+S+QL+EMGLDF+  D Y+Q+L L +RLI G+LEHQWFE
Sbjct: 1190 EKVTKEISKRSMVTFAKDLDLLSSQLSEMGLDFNGEDAYKQVLKLSRRLINGELEHQWFE 1249

Query: 1423 ESLRQAFNNKAFKLYTLDKVTQALVKHAHTIISDLKTTEIMALFEKDRTKNSTSSKDQIL 1482
            E LRQA+NNKAFKLYT+DKV Q LVKHAHT+++D KT EIMALF KDR  ++TS+KDQI+
Sbjct: 1250 EGLRQAYNNKAFKLYTIDKVIQLLVKHAHTLMTDAKTAEIMALFVKDRNASTTSAKDQII 1309

Query: 1483 YRLQTRARMTHNENMFRIEYNNTTKHICIQYIALDDLTVKDAKTLEEKWKYYITSYALSH 1542
            YRLQ R+ M++ ENMFR+E++    H+ +QYIALDDLT+K+ +  E+KWKYY+TSYAL H
Sbjct: 1310 YRLQARSYMSNTENMFRMEFDRRNLHVSVQYIALDDLTLKEPRADEDKWKYYVTSYALPH 1369

Query: 1543 PTEGIFQENIQIPFXXXXXXXXXXXXXXXXXXXKQTKSLMKYSPEGISGSTLKIKIDPQN 1602
            PTEGI  E ++IPF                          K+SPEG+S STLKIKI P  
Sbjct: 1370 PTEGISHEKLKIPFLERLIEYGQDTDGREVDE--------KFSPEGLSVSTLKIKIQPVT 1421

Query: 1603 YCLNIEEGSFDIFSRKSLNQFPVKLTQDSKYGTMPKLKNTVEKFLNSKMGWKRAISKDQM 1662
            Y L+IE GS+D+F+RK+ N++P     D     + K    + KFL++ +  +  +++ + 
Sbjct: 1422 YKLHIESGSYDVFTRKAANKYPTVANDDIHKEMVVKKTGLISKFLDNAIRLRNDLNETKK 1481

Query: 1663 ESIESKWDHL 1672
             S++ K D L
Sbjct: 1482 LSMQEKLDSL 1491

 Score =  276 bits (705), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 168/326 (51%), Positives = 196/326 (60%), Gaps = 59/326 (18%)

Query: 295 EDNQYRPLNVKDALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIARVSSLFH 354
           ED  YRPLNVKDALSYLEQVKFQFNSRPD+YN FLDIMKDFKSQAIDTPGVI RVS+LF 
Sbjct: 63  EDPDYRPLNVKDALSYLEQVKFQFNSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFR 122

Query: 355 DYPSLIQGFNTFLPQGYRIECSSNPNLPITVITPMGTTTVSGVLETSVTENQNHQLQHSL 414
            YP LIQGFNTFLPQGYRIECS+NP+       P+  TT  G   T+V  N +   + +L
Sbjct: 123 GYPILIQGFNTFLPQGYRIECSTNPD------DPIRVTTPMGT--TTVNNNVSPPARSAL 174

Query: 415 -PQPSTTASASNVDSKVSSISGIMGPSNITEXXXXXXXXXXXXLINVNDSAPISGSISST 473
            PQ  ++   ++  +   S +  M PS                  NV  S          
Sbjct: 175 EPQEPSSLPEADGSTIPQSHNVPMVPS------------------NVYHSEQSQDQQQQP 216

Query: 474 VPSNVEPTNMXXXXXXXXXXXXXLPNTNTPKSXXXXXXXXXXXXXXXFPMVSSVSPPLQE 533
           +P    P+               LP+ + P+                 P+  S   PL  
Sbjct: 217 LPLLANPSG--------------LPSIHQPE----------------LPIPQS--QPLTA 244

Query: 534 LPEQRRTQDVEFSQAISYVNKIKNRFANQPYIYKHFLEILQTYQREQKPINEVYSQVTVL 593
             + ++  DVEFSQAISYVNKIK RFA+QP IYKHFLEILQTYQREQKPINEVY+QVT L
Sbjct: 245 QEDVKKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTHL 304

Query: 594 FQEAPDLLEDFKKFLPDSSANNNGSI 619
           FQ APDLLEDFKKFLPDSSA+ N  +
Sbjct: 305 FQNAPDLLEDFKKFLPDSSASANEQV 330

>KNAG0F02920 Chr6 (552441..556919) [4479 bp, 1492 aa] {ON} Anc_6.29
            YOL004W
          Length = 1492

 Score = 1083 bits (2801), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 521/841 (61%), Positives = 639/841 (75%), Gaps = 22/841 (2%)

Query: 830  VRPEIDLDPSLVPIVPEPTQPIEDTLPLVEETNFFDKVKKYIGNKTIYAEFLKVLNLYSV 889
            VRPEIDLDPS+VP+VPEPT+PIE+ L L EET+FF+KVKK IGN+ IY EFLKVLNL+S 
Sbjct: 608  VRPEIDLDPSIVPVVPEPTEPIENNLSLSEETSFFEKVKKNIGNRQIYIEFLKVLNLFSQ 667

Query: 890  DLLEVDELVEKIKYYLNDNEELFSWFKNFVGYVEKPKHIENIVHEKHKLDLDLCEACGPS 949
            DL+ VDELV K++ YL    ELF WFKNFVGY +KPK IEN++HEKH+LDLDLCEA GPS
Sbjct: 668  DLIAVDELVTKVENYLAGQPELFEWFKNFVGYQDKPKIIENVIHEKHRLDLDLCEAYGPS 727

Query: 950  YKKLPKTDTLMPCSGRDEMCWEILNDEWVGHPVWASEDSGFIAHRKINTKKPYLRLKKKV 1009
            YKKLPK+DT MPCSGRD+MCWE+LNDEWVGHPVWASEDSGFIAHRK   ++   +++++ 
Sbjct: 728  YKKLPKSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEER 787

Query: 1010 HEYDFYIESNLRTIQTLETIASKIANMTENEKCNFKLPDGLGHTTSTIYKKVIRKVYDKE 1069
            HEYDFYIESNLRTIQTLETIASKIANMTE EK  FKLP GLGHT+ TIYKK+IRKVYDKE
Sbjct: 788  HEYDFYIESNLRTIQTLETIASKIANMTEEEKNMFKLPPGLGHTSLTIYKKIIRKVYDKE 847

Query: 1070 RGFEIIDALHEYPAIAVPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVFFKSLDHLGLT 1129
            RGFEIID LHE+PAI VP+VLKRLKQKDEEWRRAQREWNKVWRELEQKV+FKSLDHLGLT
Sbjct: 848  RGFEIIDELHEHPAITVPIVLKRLKQKDEEWRRAQREWNKVWRELEQKVYFKSLDHLGLT 907

Query: 1130 FKQADKKLLTTKQLISEISSIKVDQTHKRMHWLTPKPKSQLDFNLPDKDIIFDILSFVEI 1189
            FKQADKKLLTTKQLISEISSIKVDQ +KRMHWLTPKPK QLD+   D DIIFDI+   ++
Sbjct: 908  FKQADKKLLTTKQLISEISSIKVDQNNKRMHWLTPKPKKQLDYQFNDMDIIFDIVGLTDV 967

Query: 1190 FVEHTSTYSNPEKERLIDFMKYFTSLFFSIPLEEIKEAI-SKRDITEKNDEKLEDKQKNG 1248
            FV+H STYSNP+KERL D  + F SLFF IP + I  A+ +K D  +  D K E      
Sbjct: 968  FVDHCSTYSNPDKERLKDLFRVFISLFFFIPRDLISAALDTKSDEGKSTDTKFEKA---- 1023

Query: 1249 EENSKKRTSRDITLSLEDILQRTKYQRLKYGDDSDEVDGHGNRHDDQ---KXXXXXXXXR 1305
             ++SKKR   D+ LSL DIL R KYQ+LK G      +G G   DD              
Sbjct: 1024 -DDSKKRPRPDVELSLSDILHRAKYQKLKNG------EGLGMSEDDDEEKLAKEAEEMSE 1076

Query: 1306 QEAKKPWLLGTLVEEANAQGEIMHRNIFNMFSNTNMYIFIRHLTTMYERLHEIKQMNDKV 1365
            + A KPWL+G +VE AN+ G +  R ++N+F NTN+YIFIRH +T+Y RL E+KQM+++V
Sbjct: 1077 KNASKPWLVGDIVERANSHGLVTDRAVYNLFGNTNVYIFIRHWSTLYGRLLELKQMDERV 1136

Query: 1366 SREISGRKISKFAKDLNLISTQLTEMGLDFSEGDVYQQLLVLCKRLILGDLEHQWFEESL 1425
            ++EI+ RK+ +FA+DLNL+STQL +MGLDF   + YQ+ L L KRLI  +LEHQWFEESL
Sbjct: 1137 TKEINNRKVVQFAEDLNLLSTQLRDMGLDFDGKNAYQETLKLSKRLIRNELEHQWFEESL 1196

Query: 1426 RQAFNNKAFKLYTLDKVTQALVKHAHTIISDLKTTEIMALFEKDRTKNSTSSKDQILYRL 1485
            RQA+NNKAFKLYT+DKV  +LVKHAHT+++D K++E+M LFEKDR ++ST  KDQILYRL
Sbjct: 1197 RQAYNNKAFKLYTVDKVVHSLVKHAHTLMTDNKSSELMELFEKDRLQSSTCVKDQILYRL 1256

Query: 1486 QTRARMTHNENMFRIEYNNTTKHICIQYIALDDLTVKDAKTLEEKWKYYITSYALSHPTE 1545
             TR+ M+  ENMFR++YN  T+H+ IQYI LDD+T++DAK   E+W YY+TSYAL HPTE
Sbjct: 1257 LTRSHMSSTENMFRVQYNKDTRHVSIQYIGLDDVTLEDAKDDNERWNYYMTSYALPHPTE 1316

Query: 1546 GIFQENIQIPFXXXXXXXXXXXXXXXXXXXKQTKSLMKYSPEGISGSTLKIKIDPQNYCL 1605
            GI Q+ + +PF                          +Y+P G S S LKI IDP+ Y L
Sbjct: 1317 GIMQDKLVVPFLERILEFENDMLDVEAGSD-------RYNPVGTSYSKLKINIDPKTYKL 1369

Query: 1606 NIEEGSFDIFSRKSLNQFPVKLTQDSKYGTMPKLKNTVEKFLNSKMGWKRAISKDQMESI 1665
             I++GS+DIFSR S+N++P++         + K K T +KFL+ + GWK+ +S D + ++
Sbjct: 1370 IIQDGSYDIFSRSSINEYPIRPDSKGYVQMVEKRKETAQKFLDGRFGWKKDLSDDVINTV 1429

Query: 1666 E 1666
            E
Sbjct: 1430 E 1430

 Score =  174 bits (442), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 92/149 (61%), Positives = 104/149 (69%), Gaps = 20/149 (13%)

Query: 296 DNQYRPLNVKDALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIARVSSLFHD 355
           D+ YRPLNVKDALSYLEQVK QFNSRP +YN FLDIMKDFKSQ IDTPGVI RVS+LF  
Sbjct: 215 DSPYRPLNVKDALSYLEQVKLQFNSRPYIYNQFLDIMKDFKSQNIDTPGVIERVSTLFKG 274

Query: 356 YPSLIQGFNTFLPQGYRIECSSNPNLPITVITPMGTTTVSGVLETSVTENQ--------- 406
           +P+LIQGFNTFLPQGYRIECSSNPN PI V TPMG   +  V  + +T +Q         
Sbjct: 275 FPALIQGFNTFLPQGYRIECSSNPNEPIKVTTPMG--VLENVRGSDITADQQPAIGQLPT 332

Query: 407 -NHQLQHSLPQ--------PSTTASASNV 426
               +Q SLP         PST A+A+ V
Sbjct: 333 TQSPIQASLPPPQSAHLHLPSTVAAATTV 361

 Score =  154 bits (389), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 82/138 (59%), Positives = 95/138 (68%), Gaps = 7/138 (5%)

Query: 536 EQRRTQDVEFSQAISYVNKIKNRFANQPYIYKHFLEILQTYQREQKPINEVYSQVTVLFQ 595
           E ++  DVEFSQAISYVNKIKNRF++QP IYK+FLEILQTYQREQKPINEVY+QVTVLF 
Sbjct: 372 EPKKANDVEFSQAISYVNKIKNRFSDQPDIYKNFLEILQTYQREQKPINEVYAQVTVLFH 431

Query: 596 EAPDLLEDFKKFLPDSSANNNGSIVTSQEENFMYANG-------FNQQQPHLTPHSEIQA 648
            APDLL+DFKKFLPDSSA+N      S     +Y+         +N    +  P      
Sbjct: 432 NAPDLLDDFKKFLPDSSASNEQQPKQSPYSPQVYSGADMARGYMYNNTGVYYPPQVNQPQ 491

Query: 649 QNLPPLGSFSTQPNGVFP 666
            NLPP+GSFS   NGV P
Sbjct: 492 SNLPPIGSFSPPANGVAP 509

 Score = 57.0 bits (136), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 49/163 (30%), Positives = 79/163 (48%), Gaps = 15/163 (9%)

Query: 523 MVSSVSPPLQELPEQRRTQDVEFSQAISYVNKIKNRFANQPYIYKHFLEILQTYQREQKP 582
           MV+SVS     +    R  +V+   A+SY+ ++K +F ++PYIY  FL+I++ ++ +   
Sbjct: 203 MVASVSAMGGGIDSPYRPLNVK--DALSYLEQVKLQFNSRPYIYNQFLDIMKDFKSQNID 260

Query: 583 INEVYSQVTVLFQEAPDLLEDFKKFLP-----DSSANNNGSIVTSQE----ENFMYANGF 633
              V  +V+ LF+  P L++ F  FLP     + S+N N  I  +      EN   ++  
Sbjct: 261 TPGVIERVSTLFKGFPALIQGFNTFLPQGYRIECSSNPNEPIKVTTPMGVLENVRGSDIT 320

Query: 634 NQQQPHL----TPHSEIQAQNLPPLGSFSTQPNGVFPKQESQQ 672
             QQP +    T  S IQA   PP  +    P+ V      QQ
Sbjct: 321 ADQQPAIGQLPTTQSPIQASLPPPQSAHLHLPSTVAAATTVQQ 363

 Score = 55.1 bits (131), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 26/79 (32%), Positives = 49/79 (62%), Gaps = 3/79 (3%)

Query: 290 QDSPKEDNQYRPLNVKDALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIARV 349
           ++ PK+ N    +    A+SY+ ++K +F+ +PD+Y +FL+I++ ++ +      V A+V
Sbjct: 370 ENEPKKAND---VEFSQAISYVNKIKNRFSDQPDIYKNFLEILQTYQREQKPINEVYAQV 426

Query: 350 SSLFHDYPSLIQGFNTFLP 368
           + LFH+ P L+  F  FLP
Sbjct: 427 TVLFHNAPDLLDDFKKFLP 445

 Score = 35.4 bits (80), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 22/83 (26%), Positives = 43/83 (51%), Gaps = 2/83 (2%)

Query: 526 SVSPPLQELPEQRRTQDVEFSQAISYVNKIKNRFANQPYIYKHFLEILQTYQREQKPINE 585
           S+ P + E P +    ++  S+  S+  K+K    N+  IY  FL++L  + ++   ++E
Sbjct: 617 SIVPVVPE-PTEPIENNLSLSEETSFFEKVKKNIGNR-QIYIEFLKVLNLFSQDLIAVDE 674

Query: 586 VYSQVTVLFQEAPDLLEDFKKFL 608
           + ++V       P+L E FK F+
Sbjct: 675 LVTKVENYLAGQPELFEWFKNFV 697

>Skud_15.158 Chr15 (276509..281176) [4668 bp, 1555 aa] {ON} YOL004W
            (REAL)
          Length = 1555

 Score = 1069 bits (2765), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 526/851 (61%), Positives = 644/851 (75%), Gaps = 24/851 (2%)

Query: 813  APDINDHQQQ----------VMYEENAVRPEIDLDPSLVPIVPEPTQPIEDTLPLVEETN 862
            AP     QQQ          + Y +  VRPEIDLDPS+VP+VPEPT+PIED + L EE  
Sbjct: 626  APSTFQQQQQNPPSISPITDLQYGDVPVRPEIDLDPSIVPVVPEPTEPIEDNISLNEEVT 685

Query: 863  FFDKVKKYIGNKTIYAEFLKVLNLYSVDLLEVDELVEKIKYYLNDNEELFSWFKNFVGYV 922
            FF+K K+YIGNK +Y EFLK+LNLYS D+L++D+LVEK+ +YL  N+ELFSWFKNFVGY 
Sbjct: 686  FFEKAKRYIGNKHLYTEFLKILNLYSQDILDLDDLVEKVDFYLGSNKELFSWFKNFVGYQ 745

Query: 923  EKPKHIENIVHEKHKLDLDLCEACGPSYKKLPKTDTLMPCSGRDEMCWEILNDEWVGHPV 982
            EK K IENIVHEKH+LDLDLCEA GPSYK+LPK+DT MPCSGRD+MCWEILNDEWVGHPV
Sbjct: 746  EKTKCIENIVHEKHRLDLDLCEAFGPSYKRLPKSDTFMPCSGRDDMCWEILNDEWVGHPV 805

Query: 983  WASEDSGFIAHRKINTKKPYLRLKKKVHEYDFYIESNLRTIQTLETIASKIANMTENEKC 1042
            WASEDSGFIAHRK   ++   +++++ HEYDFYIESNLRTIQ LETI +KI NMTE+EK 
Sbjct: 806  WASEDSGFIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQCLETIVNKIENMTESEKS 865

Query: 1043 NFKLPDGLGHTTSTIYKKVIRKVYDKERGFEIIDALHEYPAIAVPVVLKRLKQKDEEWRR 1102
            +FKLP GLGHT+ TIYKKVIRKVYDKERGFEIIDALHE+PA+  PVVLKRLKQKDEEWRR
Sbjct: 866  DFKLPPGLGHTSMTIYKKVIRKVYDKERGFEIIDALHEHPAVTAPVVLKRLKQKDEEWRR 925

Query: 1103 AQREWNKVWRELEQKVFFKSLDHLGLTFKQADKKLLTTKQLISEISSIKVDQTHKRMHWL 1162
            AQREWNKVWRELEQKVFFKSLDHLGLTFKQADKKLLTTKQLISEI+SIKVDQT+K++HWL
Sbjct: 926  AQREWNKVWRELEQKVFFKSLDHLGLTFKQADKKLLTTKQLISEINSIKVDQTNKKIHWL 985

Query: 1163 TPKPKSQLDFNLPDKDIIFDILSFVEIFVEHTSTYSNPEKERLIDFMKYFTSLFFSIPLE 1222
            TPKPKSQLDF+ PDKDI +DIL   + F+ HT+ YSNP+KERL D +KYF SLFFSIPLE
Sbjct: 986  TPKPKSQLDFDFPDKDIFYDILYLADSFISHTTAYSNPDKERLKDLLKYFISLFFSIPLE 1045

Query: 1223 EIKEAISKRDITEKNDEKLEDKQKNGEENSKKRTSRDITLSLEDILQRTKYQRLKYGDDS 1282
            +I++A+      ++N  +       G   S+KR  +   +SL DIL R +YQ+LK  +D 
Sbjct: 1046 KIEKALQ---FHKENVSESSGSDDGGSSTSRKRPYQQ-EMSLLDILHRNRYQKLKRSNDE 1101

Query: 1283 DEVDGHGNRHDD--QKXXXXXXXXRQEAKKPWLLGTLVEEANAQGEIMHRNIFNMFSNTN 1340
            +      +   D             +EA+ PWL G LVEEAN+QG I +R+IFN+F+NTN
Sbjct: 1102 EGKIPQLSEPLDEESNTIEEEELISEEARNPWLTGNLVEEANSQGIIQNRSIFNLFANTN 1161

Query: 1341 MYIFIRHLTTMYERLHEIKQMNDKVSREISGRKISKFAKDLNLISTQLTEMGLDFSEGDV 1400
            +YIF RH TT+YERL EIKQMN K+++E++ R    FAKDL+L+S QL EMGLDF   D 
Sbjct: 1162 IYIFFRHWTTIYERLLEIKQMNGKITKEVNTRSTVTFAKDLDLLSNQLPEMGLDFIGEDA 1221

Query: 1401 YQQLLVLCKRLILGDLEHQWFEESLRQAFNNKAFKLYTLDKVTQALVKHAHTIISDLKTT 1460
            Y+Q+L L +RLI GDLEHQWFEESLRQA+NNKAFKLYT+DKVTQ+LVKHAHT+++D+KT 
Sbjct: 1222 YKQVLRLSRRLINGDLEHQWFEESLRQAYNNKAFKLYTIDKVTQSLVKHAHTLMADVKTA 1281

Query: 1461 EIMALFEKDRTKNSTSSKDQILYRLQTRARMTHNENMFRIEYNNTTKHICIQYIALDDLT 1520
            EIMALF KDR   +TS+KDQI+YRLQ R+ M++ ENMFRIE N  + H+ +QYIALDDLT
Sbjct: 1282 EIMALFVKDRNAFTTSAKDQIIYRLQVRSYMSNIENMFRIELNKRSLHVSVQYIALDDLT 1341

Query: 1521 VKDAKTLEEKWKYYITSYALSHPTEGIFQENIQIPFXXXXXXXXXXXXXXXXXXXKQTKS 1580
            +K+ K  E+KWKYY+TSY L HPTEGI  E ++IPF                        
Sbjct: 1342 LKEPKADEDKWKYYVTSYGLPHPTEGISHEKLKIPFLERLIEFGQDTDGREVDE------ 1395

Query: 1581 LMKYSPEGISGSTLKIKIDPQNYCLNIEEGSFDIFSRKSLNQFPVKLTQDSKYGTMPKLK 1640
              ++SPEGIS STL+IKI P  Y L+IE GS+D+F+RK++N++P     D     + +  
Sbjct: 1396 --EFSPEGISLSTLRIKIQPITYKLHIENGSYDVFTRKAVNKYPTIANDDVHKEMVVQKT 1453

Query: 1641 NTVEKFLNSKM 1651
              + +FL + +
Sbjct: 1454 ALISRFLENAI 1464

 Score =  295 bits (754), Expect = 5e-80,   Method: Compositional matrix adjust.
 Identities = 173/329 (52%), Positives = 201/329 (61%), Gaps = 62/329 (18%)

Query: 290 QDSPKEDNQYRPLNVKDALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIARV 349
           ++S  ED  YRPLNVKDALSYLEQVKFQF+SRPD+YN FLDIMKDFKSQAIDTPGVI RV
Sbjct: 215 ENSNDEDPDYRPLNVKDALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERV 274

Query: 350 SSLFHDYPSLIQGFNTFLPQGYRIECSSNPNLPITVITPMGTTTVSGVLETSVTENQNHQ 409
           S+LF  YP LIQGFNTFLPQGYRIECS+NP+ PI V TPMGTTTV+  +  S     + Q
Sbjct: 275 STLFRGYPILIQGFNTFLPQGYRIECSTNPDDPIRVTTPMGTTTVNNNVSPSGRGTVDGQ 334

Query: 410 LQHSLPQPSTTASASNVDSKVSSISGI-MGPSNITEXXXXXXXXXXXXLINVNDSAPISG 468
              SL +P   A        +     + M PSN+                +   S P+S 
Sbjct: 335 EPSSLSEPDGNA--------IQPFHNLPMVPSNVYRSEQSQ---------DQKQSLPLSA 377

Query: 469 ---SISSTVPSNVEPTNMXXXXXXXXXXXXXLPNTNTPKSXXXXXXXXXXXXXXXFPMVS 525
               +SS  P  + P +                                        ++ 
Sbjct: 378 NSVGLSSIHPPEIPPHHQ---------------------------------------ILQ 398

Query: 526 SVSPPLQELPEQRRTQDVEFSQAISYVNKIKNRFANQPYIYKHFLEILQTYQREQKPINE 585
             S P+QE  + ++  DVEFSQAISYVNKIK RFA+QP IYKHFLEILQTYQREQKPINE
Sbjct: 399 GQSLPVQE--DAKKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINE 456

Query: 586 VYSQVTVLFQEAPDLLEDFKKFLPDSSAN 614
           VY+QVT LFQ APDLLEDFKKFLPDSSA+
Sbjct: 457 VYAQVTHLFQNAPDLLEDFKKFLPDSSAS 485

>KLLA0C06182g Chr3 (544281..548840) [4560 bp, 1519 aa] {ON} similar to
            uniprot|Q75CF0 Ashbya gossypii ACL004W ACL004Wp and
            weakly similar to YOL004W uniprot|P22579 Saccharomyces
            cerevisiae YOL004W SIN3 DNA binding protein involved in
            transcriptional regulation
          Length = 1519

 Score = 1058 bits (2735), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 513/855 (60%), Positives = 640/855 (74%), Gaps = 21/855 (2%)

Query: 826  EENAVRPEIDLDPSLVPIVPEPTQPIEDTLPLVEETNFFDKVKKYIGNKTIYAEFLKVLN 885
            E    RPEIDLDPSLVP+VPEP QP ED + L +E  FF++VK++IGNK +YAEFLK+LN
Sbjct: 657  EAPMARPEIDLDPSLVPVVPEPIQPPEDAIALGDEVTFFERVKRFIGNKQVYAEFLKILN 716

Query: 886  LYSVDLLEVDELVEKIKYYLNDNEELFSWFKNFVGYVEKPKHIENIVHEKHKLDLDLCEA 945
            LYS DLL   ELV K+++YL+ ++ELF WFK+FVGY EKPKHIENIVHEKH+LDLDLCEA
Sbjct: 717  LYSQDLLTTSELVSKVEFYLHSSKELFDWFKSFVGYQEKPKHIENIVHEKHRLDLDLCEA 776

Query: 946  CGPSYKKLPKTDTLMPCSGRDEMCWEILNDEWVGHPVWASEDSGFIAHRKINTKKPYLRL 1005
            CGPSYKKLPK DT MPCSGRDEMCWE+LNDEWVGHPVWASEDSGFIAHRK   +    ++
Sbjct: 777  CGPSYKKLPKDDTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEDTLFKV 836

Query: 1006 KKKVHEYDFYIESNLRTIQTLETIASKIANMTENEKCNFKLPDGLGHTTSTIYKKVIRKV 1065
            +++ HEYDFYIESNLRTIQTLETIA+KIANMT  EK NFKLP GLGHT+ TIYKKV+RKV
Sbjct: 837  EEERHEYDFYIESNLRTIQTLETIANKIANMTNEEKNNFKLPPGLGHTSLTIYKKVVRKV 896

Query: 1066 YDKERGFEIIDALHEYPAIAVPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVFFKSLDH 1125
            YDK+RGFEIIDALHE+PA+ VP+VLKRLKQKDEEWRRAQREWNKVWRELEQKV++KSLDH
Sbjct: 897  YDKDRGFEIIDALHEHPAVTVPIVLKRLKQKDEEWRRAQREWNKVWRELEQKVYYKSLDH 956

Query: 1126 LGLTFKQADKKLLTTKQLISEISSIKVDQTHKRMHWLTPKPKSQLDFNLPDKDIIFDILS 1185
            LGLTFKQADKKLLTTKQL+SEISSIKVDQT+KR+H LTPKPKSQLDF + D+++++DIL 
Sbjct: 957  LGLTFKQADKKLLTTKQLLSEISSIKVDQTNKRIHPLTPKPKSQLDFEINDREVLYDILD 1016

Query: 1186 FVEIFVEHTSTYSNPEKERLIDFMKYFTSLFFSIPLEEIKEAISKRDITEKNDEKLEDKQ 1245
             V  FV+  ++YSN +K +L  F K F SLFFS P++++ EA+S+R      +   ED  
Sbjct: 1017 LVFTFVKTNASYSNSDKIKLDHFFKAFISLFFSYPIKDVNEAVSERSSITDQENGEEDSN 1076

Query: 1246 KNGEENSKKRT-SRDITLSLEDILQRTKYQRLKYGDDSDEVDGHGNRHDDQKXXXXXXXX 1304
            K+  E S KRT S + +  ++DIL+RTK  +    +++       +  +D+         
Sbjct: 1077 KSDSEKSNKRTLSDEDSYLMKDILRRTKNAKTSNSEENQNSSSVKSNEEDETELLA---- 1132

Query: 1305 RQEAKKPWLLGTLVEEANAQGEIMHRNIFNMFSNTNMYIFIRHLTTMYERLHEIKQMNDK 1364
             +EA KPWLLG+L++EAN  G +  R+IFN+F+NT +Y+F RHL T+YERL E+K+++ +
Sbjct: 1133 -KEAAKPWLLGSLIDEANNSGIVSDRHIFNLFTNTTIYVFFRHLNTLYERLLEVKKIDAE 1191

Query: 1365 VSREISGRKISKFAKDLNLISTQLTEMGLDFSEGDVYQQLLVLCKRLILGDLEHQWFEES 1424
            V+ EI  RKI +FA DLNLISTQL +MGL F +   Y +LL L KRLI GDL+HQWFEES
Sbjct: 1192 VTDEIKNRKIVQFASDLNLISTQLADMGLAFKDTKAYGELLRLSKRLITGDLDHQWFEES 1251

Query: 1425 LRQAFNNKAFKLYTLDKVTQALVKHAHTIISDLKTTEIMALFEKDRTKNSTSSKDQILYR 1484
            LRQA+ NKAFK+YT+DKV Q+LVKHAH+II+D K   +M LFE+DR K  T++KDQILYR
Sbjct: 1252 LRQAYKNKAFKIYTIDKVVQSLVKHAHSIITDPKNAMVMVLFEQDRLKRDTTAKDQILYR 1311

Query: 1485 LQTRARMTHNENMFRIEYNNTTKHICIQYIALDDLTVKDAKTLEEKWKYYITSYALSHPT 1544
            L+ R  M  +ENMFRIEYN  + H+ IQY+A+DDLT+K+ + ++EKW YY+TSY+LSHPT
Sbjct: 1312 LKVRNTMGESENMFRIEYNTDSSHVSIQYVAVDDLTLKEPQNMKEKWDYYVTSYSLSHPT 1371

Query: 1545 EGIFQENIQIPFXXXXXXXXXXXXXXXXXXXKQTKSLMKYSPEGISGSTLKIKIDPQNYC 1604
            EGI QE+I  PF                          K+SPEG+S S LK+ I P+ Y 
Sbjct: 1372 EGITQEDISQPFLGKIIEKEAEYLDDEEQND-------KFSPEGVSQSKLKVNIHPETYE 1424

Query: 1605 LNIEEGSFDIFSRKSLNQFPVKLTQDSKYGTMPKLKNTVEKFLNSKMGWKRAISKDQMES 1664
            L  E GS D+F+RKS+N+FP      S   T P  K  ++KFLNS  GWK+ +S + +  
Sbjct: 1425 LTFECGSTDVFTRKSVNKFP------SSQSTQPASK--MDKFLNSSKGWKKNLSTEIIGR 1476

Query: 1665 IESKWDHLSNNGNLE 1679
             ESK   L   G LE
Sbjct: 1477 AESKMKILKEQGKLE 1491

 Score =  179 bits (455), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 89/129 (68%), Positives = 99/129 (76%), Gaps = 10/129 (7%)

Query: 299 YRPLNVKDALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIARVSSLFHDYPS 358
           YRPLNVKDALSYLEQVKFQF+SRPDVYNHFLDIMKDFKSQAIDTPGVI RV++LF  +P+
Sbjct: 201 YRPLNVKDALSYLEQVKFQFSSRPDVYNHFLDIMKDFKSQAIDTPGVIQRVTTLFQGFPN 260

Query: 359 LIQGFNTFLPQGYRIECSSNPNLPITVITPMGTTT-VSGVLETSV---------TENQNH 408
           LIQGFNTFLP GY+IECS+NPN PI V TP GTT  VS    T            ENQN 
Sbjct: 261 LIQGFNTFLPHGYKIECSTNPNDPIKVTTPFGTTGEVSAGPPTQYQLAPVAGQNVENQNI 320

Query: 409 QLQHSLPQP 417
           ++Q  + QP
Sbjct: 321 EMQQQVSQP 329

 Score =  134 bits (338), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 65/92 (70%), Positives = 77/92 (83%)

Query: 523 MVSSVSPPLQELPEQRRTQDVEFSQAISYVNKIKNRFANQPYIYKHFLEILQTYQREQKP 582
           +V++    L  LP Q++T +VEFS AISYVNKIK RFA+QP IYK FLEILQTYQREQKP
Sbjct: 405 IVAAGGGMLGALPGQQKTGEVEFSHAISYVNKIKTRFADQPDIYKQFLEILQTYQREQKP 464

Query: 583 INEVYSQVTVLFQEAPDLLEDFKKFLPDSSAN 614
           I+EVY+QVT+LFQ  PDLL+DFKKFLPDSS +
Sbjct: 465 IHEVYAQVTILFQNNPDLLDDFKKFLPDSSVS 496

 Score = 54.7 bits (130), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 42/62 (67%)

Query: 548 AISYVNKIKNRFANQPYIYKHFLEILQTYQREQKPINEVYSQVTVLFQEAPDLLEDFKKF 607
           A+SY+ ++K +F+++P +Y HFL+I++ ++ +      V  +VT LFQ  P+L++ F  F
Sbjct: 209 ALSYLEQVKFQFSSRPDVYNHFLDIMKDFKSQAIDTPGVIQRVTTLFQGFPNLIQGFNTF 268

Query: 608 LP 609
           LP
Sbjct: 269 LP 270

 Score = 51.2 bits (121), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 39/62 (62%)

Query: 307 ALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIARVSSLFHDYPSLIQGFNTF 366
           A+SY+ ++K +F  +PD+Y  FL+I++ ++ +      V A+V+ LF + P L+  F  F
Sbjct: 430 AISYVNKIKTRFADQPDIYKQFLEILQTYQREQKPIHEVYAQVTILFQNNPDLLDDFKKF 489

Query: 367 LP 368
           LP
Sbjct: 490 LP 491

 Score = 33.5 bits (75), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 16/66 (24%), Positives = 33/66 (50%), Gaps = 1/66 (1%)

Query: 543 VEFSQAISYVNKIKNRFANQPYIYKHFLEILQTYQREQKPINEVYSQVTVLFQEAPDLLE 602
           +     +++  ++K RF     +Y  FL+IL  Y ++    +E+ S+V      + +L +
Sbjct: 686 IALGDEVTFFERVK-RFIGNKQVYAEFLKILNLYSQDLLTTSELVSKVEFYLHSSKELFD 744

Query: 603 DFKKFL 608
            FK F+
Sbjct: 745 WFKSFV 750

>CAGL0E02475g Chr5 (236580..241061) [4482 bp, 1493 aa] {ON} similar to
            uniprot|P22579 Saccharomyces cerevisiae YOL004w SIN3
            transcription regulatory protein
          Length = 1493

 Score = 1053 bits (2722), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 504/876 (57%), Positives = 655/876 (74%), Gaps = 34/876 (3%)

Query: 827  ENAVRPEIDLDPSLVPIVPEPTQPIEDTLPLVEETNFFDKVKKYIGNKTIYAEFLKVLNL 886
            E  VRPEIDLDPSLVP+VPEPT+PIE++L L+EETNFF++VKK IGNK IY EFLK+LNL
Sbjct: 590  ELVVRPEIDLDPSLVPVVPEPTEPIENSLNLMEETNFFERVKKSIGNKQIYNEFLKILNL 649

Query: 887  YSVDLLEVDELVEKIKYYLNDNEELFSWFKNFVGYVEKPKHIENIVHEKHKLDLDLCEAC 946
            +S+DLL VDELV+K++YY+  N+ELF WFK FVGY +KPK IENIVHEKHKLDLDLCEA 
Sbjct: 650  FSLDLLTVDELVDKVEYYIGANKELFDWFKVFVGYQDKPKRIENIVHEKHKLDLDLCEAY 709

Query: 947  GPSYKKLPKTDTLMPCSGRDEMCWEILNDEWVGHPVWASEDSGFIAHRKINTKKPYLRLK 1006
            GPSYKKLPKTDT MPCSGRD+MCWE+LNDEWVGHPVWASEDSGFIAHRK   ++   +++
Sbjct: 710  GPSYKKLPKTDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIE 769

Query: 1007 KKVHEYDFYIESNLRTIQTLETIASKIANMTENEKCNFKLPDGLGHTTSTIYKKVIRKVY 1066
            ++ HEYD+YIESNLRTIQTLETIA+KIANMT+ EK  F+LP GLGHT+ TIYKKVIRKVY
Sbjct: 770  EERHEYDYYIESNLRTIQTLETIANKIANMTDAEKAQFRLPPGLGHTSMTIYKKVIRKVY 829

Query: 1067 DKERGFEIIDALHEYPAIAVPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVFFKSLDHL 1126
            DKERGFEIIDALH YPAI+VP++L+RLKQKDEEWRRAQREWNK+WR+LEQKV+FKSLDHL
Sbjct: 830  DKERGFEIIDALHNYPAISVPIILRRLKQKDEEWRRAQREWNKIWRDLEQKVYFKSLDHL 889

Query: 1127 GLTFKQADKKLLTTKQLISEISSIKVDQTHKRMHWLTPKPKSQLDFNLPDKDIIFDILSF 1186
            GLTFKQADKKLLTTKQLISEI+ IKVDQ  KR+HWLTPKPK+QLD++ PD DI+FDI++ 
Sbjct: 890  GLTFKQADKKLLTTKQLISEINGIKVDQNSKRIHWLTPKPKNQLDYDFPDYDILFDIIAL 949

Query: 1187 VEIFVEHTSTYSNPEKERLIDFMKYFTSLFFSIPLEEIKEAISKRDITEKND-------- 1238
              +F  +T+ YSNP+KER+ D ++ F S FFSIPL+E+ +A+ +R  ++ N+        
Sbjct: 950  GFVFTINTNLYSNPDKERIKDMLRVFVSQFFSIPLKEVSDALERRGFSDDNNNDSDKGSG 1009

Query: 1239 --EKLEDKQKNGEEN--SKKRTSRDITLSLEDILQRTKYQRLKYGDDSDEVDGHGNRHDD 1294
              +++ ++    E++  S K+   D  L++ DIL +TK Q+ K    + E+DG  +  +D
Sbjct: 1010 KMDQIAEEIGETEQDTSSSKKRPFDNDLNMSDILHKTKQQKTKM---NKEMDGSKSPSED 1066

Query: 1295 QKXXXXXXXXR-----QEAKKPWLLGTLVEEANAQGEIMHRNIFNMFSNTNMYIFIRHLT 1349
                             E +K WL+G +V+ AN +  + +RNI+N+F+NTN+YIF RHL 
Sbjct: 1067 LGTDRNVGTIEDSGSLSEHRKQWLVGDVVDSANKETPMDNRNIYNLFANTNIYIFFRHLV 1126

Query: 1350 TMYERLHEIKQMNDKVSREISGRKISKFAKDLNLISTQLTEMGLDFSEGDVYQQLLVLCK 1409
            T+YERL E+KQ+ND++++EI  R+++ FAKDL LISTQL+E+GLDF+  D YQQLL L K
Sbjct: 1127 TLYERLSEVKQINDEINKEIKSRRVTTFAKDLGLISTQLSELGLDFNSSDAYQQLLTLSK 1186

Query: 1410 RLILGDLEHQWFEESLRQAFNNKAFKLYTLDKVTQALVKHAHTIISDLKTTEIMALFEKD 1469
            RLI GD+EHQWFEES+RQA+NN+AFKLYT+DKV Q+ VKHAHT+ISD KT+EIM LFE  
Sbjct: 1187 RLIEGDIEHQWFEESIRQAYNNRAFKLYTIDKVVQSFVKHAHTLISDSKTSEIMLLFENQ 1246

Query: 1470 RTKNSTSSKDQILYRLQTRARMTHNENMFRIEYNNTTKHICIQYIALDDLTVKDAKTLEE 1529
            R    T++KDQILYR+Q R+ M+  ENMFRIEY    +H  IQYIALDDLT+K AK+ EE
Sbjct: 1247 RNNTLTTTKDQILYRIQCRSHMSSTENMFRIEYKREKRHASIQYIALDDLTLKTAKSPEE 1306

Query: 1530 KWKYYITSYALSHPTEGIFQENIQIPFXXXXXXXXXXXXXXXXXXXKQTKSLMKYSPEGI 1589
             W YY+TSY+LS+PTEG+  EN+++PF                   K   +   YS  GI
Sbjct: 1307 AWNYYVTSYSLSNPTEGVPHENLEVPF-------LEKVIEFDQEYSKDNGNNSTYSLAGI 1359

Query: 1590 SGSTLKIKIDPQNYCLNIEEGSFDIFSRKSLNQFPVKLTQDSKYGTMPKLKNTVEKFLNS 1649
            S S L I ID + Y L ++ GS D++SR ++ ++P+  + +S+   + +    + K L+ 
Sbjct: 1360 SKSNLHIDIDREKYNLILQGGSSDVYSRATIQKYPIVASDESRAANISEKTQEIRKVLSH 1419

Query: 1650 KMGWKRAISKDQMESIESKWDHLSNNGNLEGYQEKS 1685
              G       +  + +  K++++  NG ++GY  +S
Sbjct: 1420 YDG-------NSNDDVNEKFNYILANGTIDGYVRQS 1448

 Score =  177 bits (448), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 83/103 (80%), Positives = 91/103 (88%), Gaps = 2/103 (1%)

Query: 299 YRPLNVKDALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIARVSSLFHDYPS 358
           YRPLNVKDALSYLEQVKFQF++RPD+YN FLDIMKDFKSQ IDTPGVI RVSSLF  YP+
Sbjct: 185 YRPLNVKDALSYLEQVKFQFHTRPDIYNLFLDIMKDFKSQTIDTPGVIERVSSLFKGYPN 244

Query: 359 LIQGFNTFLPQGYRIECSSNPNLPITVITPMGTTTVSGVLETS 401
           LIQGFNTFLPQGYRIECS+NPN PI V TPMG++T   VL T+
Sbjct: 245 LIQGFNTFLPQGYRIECSNNPNDPIKVTTPMGSSTT--VLNTA 285

 Score =  143 bits (360), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 85/172 (49%), Positives = 104/172 (60%), Gaps = 25/172 (14%)

Query: 532 QELPEQRRTQDVEFSQAISYVNKIKNRFANQPYIYKHFLEILQTYQREQKPINEVYSQVT 591
           Q     ++  DVEFSQAI+YVNKIK RFA+QP IYK FLEILQTYQREQKPI+EVY+QVT
Sbjct: 326 QNFGSAKKPADVEFSQAITYVNKIKTRFADQPDIYKQFLEILQTYQREQKPIHEVYAQVT 385

Query: 592 VLFQEAPDLLEDFKKFLPDSSANN---------------NGSIVTSQEENFMYANGFNQQ 636
           +LFQ APDLL+DFKKFLPDSSA+                +  +  + E     A+G N Q
Sbjct: 386 ILFQNAPDLLDDFKKFLPDSSASGSEETQVQQQQHYQSLSDKMGGNAEAANYAASGMNAQ 445

Query: 637 QPHLTP----------HSEIQAQNLPPLGSFSTQPNGVFPKQESQQIVPTSR 678
             +  P           ++ Q QNLPP+GSFS   NG F  Q  Q   P ++
Sbjct: 446 TGYYEPVKGGVSYNTQQNQHQQQNLPPIGSFSPPTNGPFVDQTQQSANPETQ 497

 Score = 50.8 bits (120), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 44/71 (61%), Gaps = 2/71 (2%)

Query: 300 RPLNVK--DALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIARVSSLFHDYP 357
           +P +V+   A++Y+ ++K +F  +PD+Y  FL+I++ ++ +      V A+V+ LF + P
Sbjct: 333 KPADVEFSQAITYVNKIKTRFADQPDIYKQFLEILQTYQREQKPIHEVYAQVTILFQNAP 392

Query: 358 SLIQGFNTFLP 368
            L+  F  FLP
Sbjct: 393 DLLDDFKKFLP 403

 Score = 47.8 bits (112), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 46/83 (55%)

Query: 527 VSPPLQELPEQRRTQDVEFSQAISYVNKIKNRFANQPYIYKHFLEILQTYQREQKPINEV 586
           VS P Q   +    + +    A+SY+ ++K +F  +P IY  FL+I++ ++ +      V
Sbjct: 172 VSGPAQTQGDPMSYRPLNVKDALSYLEQVKFQFHTRPDIYNLFLDIMKDFKSQTIDTPGV 231

Query: 587 YSQVTVLFQEAPDLLEDFKKFLP 609
             +V+ LF+  P+L++ F  FLP
Sbjct: 232 IERVSSLFKGYPNLIQGFNTFLP 254

>KLTH0C10956g Chr3 (901384..905685) [4302 bp, 1433 aa] {ON} similar to
            uniprot|P22579 Saccharomyces cerevisiae YOL004W SIN3 DNA
            binding protein involved in transcriptional regulation
          Length = 1433

 Score = 1041 bits (2692), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 516/923 (55%), Positives = 671/923 (72%), Gaps = 41/923 (4%)

Query: 821  QQVMYEENAVRPEIDLDPSLVPIVPEPTQPIEDTLPLVEETNFFDKVKKYIGNKTIYAEF 880
            Q V + E   RPEIDLDPSLVP++PEP +P+E+ L L+EET+FFD+ KKY+GNK +Y EF
Sbjct: 544  QDVQFIEPTSRPEIDLDPSLVPVIPEPIKPLENDLTLIEETSFFDRAKKYMGNKQVYTEF 603

Query: 881  LKVLNLYSVDLLEVDELVEKIKYYLNDNEELFSWFKNFVGYVEKPKHIENIVHEKHKLDL 940
            LK+LNL+S DL+  +ELV+K+++YL  + ELF WFK+FV YVEKPKHIEN++HEKH+LDL
Sbjct: 604  LKILNLFSQDLIGTEELVDKVEHYLGGSPELFDWFKSFVNYVEKPKHIENVIHEKHRLDL 663

Query: 941  DLCEACGPSYKKLPKTDTLMPCSGRDEMCWEILNDEWVGHPVWASEDSGFIAHRKINTKK 1000
            DLCEAC PSYKKLPK DT MPCSGRDEMCWE+LNDEWVGHPVWASEDSGFIAHRK   ++
Sbjct: 664  DLCEACFPSYKKLPKADTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEE 723

Query: 1001 PYLRLKKKVHEYDFYIESNLRTIQTLETIASKIANMTENEKCNFKLPDGLGHTTSTIYKK 1060
               +++++ HEYD+YIE+NLRTIQ LETIA+KI+NMT  EK  FKLP GLGHT+ TIYKK
Sbjct: 724  TLFKIEEERHEYDYYIEANLRTIQLLETIANKISNMTPEEKQAFKLPPGLGHTSMTIYKK 783

Query: 1061 VIRKVYDKERGFEIIDALHEYPAIAVPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVFF 1120
            VIRKVYDK+RGFEIIDALHE PA++VP++LKRLKQKDEEWRRAQREWNKVWRELEQKVF+
Sbjct: 784  VIRKVYDKDRGFEIIDALHENPAVSVPIILKRLKQKDEEWRRAQREWNKVWRELEQKVFY 843

Query: 1121 KSLDHLGLTFKQADKKLLTTKQLISEISSIKVDQTHKRMHWLTPKPKSQLDFNLPDKDII 1180
            KSLDHLGLTFKQADKKLLT KQLISEISSIKVDQT+KR++  TPKPKSQLD++L DK ++
Sbjct: 844  KSLDHLGLTFKQADKKLLTAKQLISEISSIKVDQTNKRIYPFTPKPKSQLDYDLKDKGVL 903

Query: 1181 FDILSFVEIFVEHTSTYSNPEKERLIDFMKYFTSLFFSIPLEEIKEAISKRDITEKNDEK 1240
            FDIL  V  F++H+STYSNP+KE+L  F K F S+FFSI  +EI+ +             
Sbjct: 904  FDILCLVNNFIDHSSTYSNPDKEKLAAFFKGFLSVFFSISYQEIENSTPA---------- 953

Query: 1241 LEDKQKNGEENSKKRTSRDITLSLEDILQRTKYQRLKYGDDSDEVDGHGNRHDDQ----- 1295
              D       N +KR   +    L+++L R+K++  K  D S E D      DDQ     
Sbjct: 954  --DSDAVSNSNPRKRL-WESEQPLKELL-RSKHKHHKKRDTSAEDDSIS---DDQNSPEK 1006

Query: 1296 --KXXXXXXXXRQEAKKPWLLGTLVEEANAQGEIMHRNIFNMFSNTNMYIFIRHLTTMYE 1353
              +        RQEAKKPWLLG +++EAN  G + +R IFN+F+NTN+Y+F RHLTTMY+
Sbjct: 1007 SPQEIEDEEVIRQEAKKPWLLGNILDEANDHGYVSNRKIFNLFANTNVYVFFRHLTTMYQ 1066

Query: 1354 RLHEIKQMNDKVSREISGRKISKFAKDLNLISTQLTEMGLDFSEGDVYQQLLVLCKRLIL 1413
            RL E+K MN++V+REI+ R + +FAKDLNL+STQL++MGLDF   D Y QLL LCKRLI 
Sbjct: 1067 RLSEVKNMNEEVTREINSRNVVQFAKDLNLVSTQLSDMGLDFKGKDAYDQLLTLCKRLIR 1126

Query: 1414 GDLEHQWFEESLRQAFNNKAFKLYTLDKVTQALVKHAHTIISDLKTTEIMALFEKDRTKN 1473
             D++HQWFEESLRQA+ NKAFK+YT+DKV Q+LVKHAH+II+D K+ EIM LFEKDR   
Sbjct: 1127 NDMDHQWFEESLRQAYKNKAFKIYTVDKVIQSLVKHAHSIITDAKSAEIMILFEKDRRCT 1186

Query: 1474 STSSKDQILYRLQTRARMTHNENMFRIEYNNTTKHICIQYIALDDLTVKDAKTLEEKWKY 1533
            +TS+K+QILYRLQ R+ M   ENMFR+E N  + H+CIQY+A+DDLT+K+ ++L+++W Y
Sbjct: 1187 ATSTKEQILYRLQVRSYMGLTENMFRVEINKDSCHVCIQYVAIDDLTLKEPESLKDRWHY 1246

Query: 1534 YITSYALSHPTEGIFQENIQIPFXXXXXXXXXXXXXXXXXXXKQTKSLMKYSPEGISGST 1593
            Y+TSYALSHPTEGI  E I++PF                   +  +   + SP G S S 
Sbjct: 1247 YLTSYALSHPTEGIPHEEIKVPF----------LEKTLQDDEEADEGSEERSPSGHSLSN 1296

Query: 1594 LKIKIDPQNYCLNIEEGSFDIFSRKSLNQFPVKLTQDSKYGTMPKLKNTVEKFLNSKMGW 1653
            L+I+++P++Y L IE GS DIF+R ++N+F      +S      + + T+   L+   GW
Sbjct: 1297 LRIQVNPESYELQIEPGSKDIFTRFAVNRFLNSSENNSNTDLKEEKRKTLMSQLDGSRGW 1356

Query: 1654 KRAISKDQMESIESKWDHLSNNGNLEGYQEKSILKDVNGTDISKISPMKTFTVTESANGV 1713
            K+ +S++ ++   +  +++  +G  E   +   L  V GT      P    +V + A+ +
Sbjct: 1357 KKGMSQELVDKTLTALNYVRLHGKHESLNKNPAL--VQGTR----DPRHESSVAKEASSL 1410

Query: 1714 PNDKADGEERGNDTTAEEV-GNE 1735
             +   D E +  +TTAE++ GNE
Sbjct: 1411 ESHADDTELKAGETTAEDIQGNE 1433

 Score =  156 bits (395), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 74/97 (76%), Positives = 81/97 (83%), Gaps = 2/97 (2%)

Query: 295 EDNQYRPLNVKDALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIARVSSLFH 354
           +D  YRPLN KDALSYLEQVKFQFN+RPDVYNHFLDIMKD+KSQAIDT GVI R+S+LF 
Sbjct: 138 QDPSYRPLNFKDALSYLEQVKFQFNNRPDVYNHFLDIMKDYKSQAIDTLGVIERISTLFK 197

Query: 355 DYPSLIQGFNTFLPQGYRIECSSNPNLP--ITVITPM 389
            YP LIQG NTFLPQGY+IEC+ NPN P  I V TP 
Sbjct: 198 GYPILIQGLNTFLPQGYKIECTLNPNDPHSIKVTTPF 234

 Score =  136 bits (343), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 82/154 (53%), Positives = 96/154 (62%), Gaps = 28/154 (18%)

Query: 538 RRTQDVEFSQAISYVNKIKNRFANQPYIYKHFLEILQTYQREQKPINEVYSQVTVLFQEA 597
           R + DVEFS AISYVNKIK RFA+QP IYKHFLEILQTYQREQKPI+EVY+QVT LFQ A
Sbjct: 329 RPSGDVEFSHAISYVNKIKTRFADQPEIYKHFLEILQTYQREQKPIHEVYAQVTSLFQNA 388

Query: 598 PDLLEDFKKFLPDSSANNNGSIVTSQEENFM---------------YANG---FNQQQPH 639
           PDLL+DFKKFLPD++A +    +  Q++                  Y N     +Q+Q H
Sbjct: 389 PDLLDDFKKFLPDATAAHEQQQLLLQQQQQQQQQLQQQQIQQHQSHYQNASQDLDQRQQH 448

Query: 640 -------LTPHSEIQ---AQNLPPLGSFSTQPNG 663
                    P  + Q    QNLPPLGSFS   NG
Sbjct: 449 THQPFGNTVPFYQTQQGRPQNLPPLGSFSPPING 482

 Score = 55.1 bits (131), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 41/62 (66%)

Query: 307 ALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIARVSSLFHDYPSLIQGFNTF 366
           A+SY+ ++K +F  +P++Y HFL+I++ ++ +      V A+V+SLF + P L+  F  F
Sbjct: 339 AISYVNKIKTRFADQPEIYKHFLEILQTYQREQKPIHEVYAQVTSLFQNAPDLLDDFKKF 398

Query: 367 LP 368
           LP
Sbjct: 399 LP 400

 Score = 51.6 bits (122), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 39/143 (27%), Positives = 66/143 (46%), Gaps = 21/143 (14%)

Query: 543 VEFSQAISYVNKIKNRFANQPYIYKHFLEILQTYQREQKPINEVYSQVTVLFQEAPDLLE 602
           + F  A+SY+ ++K +F N+P +Y HFL+I++ Y+ +      V  +++ LF+  P L++
Sbjct: 145 LNFKDALSYLEQVKFQFNNRPDVYNHFLDIMKDYKSQAIDTLGVIERISTLFKGYPILIQ 204

Query: 603 DFKKFLPDS-------SANNNGSI-VTSQEEN--------FMYANGFNQQQPHLTPHSEI 646
               FLP         + N+  SI VT+  +N            NG  +  P L P  ++
Sbjct: 205 GLNTFLPQGYKIECTLNPNDPHSIKVTTPFDNARELNLATMATGNGIVEGHPSLMPSDDV 264

Query: 647 QAQNLPPLGSFSTQPNGVFPKQE 669
               L        +P  V PK E
Sbjct: 265 SPPKL-----VGHEPAAVQPKLE 282

>Kwal_56.22462 s56 complement(139779..144404) [4626 bp, 1541 aa] {ON}
            YOL004W (SIN3) - DNA binding protein involved in
            transcriptional regulation [contig 185] FULL
          Length = 1541

 Score = 1029 bits (2661), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 508/921 (55%), Positives = 660/921 (71%), Gaps = 35/921 (3%)

Query: 819  HQQQVMYEENAVRPEIDLDPSLVPIVPEPTQPIEDTLPLVEETNFFDKVKKYIGNKTIYA 878
            + Q V Y E   RPEIDLDPSLVP++PEP +P+E+   L+EET+FFDK KKY+GNK +Y 
Sbjct: 652  YSQDVQYMEPTSRPEIDLDPSLVPVIPEPIRPLENDSTLIEETSFFDKAKKYMGNKQVYT 711

Query: 879  EFLKVLNLYSVDLLEVDELVEKIKYYLNDNEELFSWFKNFVGYVEKPKHIENIVHEKHKL 938
            EFLK+LNL+S DL++ DELV+K+++YL  N ELF WFK+FV YVE+PKHIEN+VHEKH+L
Sbjct: 712  EFLKILNLFSQDLIDTDELVDKVEHYLGGNSELFDWFKSFVNYVERPKHIENVVHEKHRL 771

Query: 939  DLDLCEACGPSYKKLPKTDTLMPCSGRDEMCWEILNDEWVGHPVWASEDSGFIAHRKINT 998
            DLDLCEAC PSYKKLPK DT MPC GRDEMCWE+LNDEWVGHPVWASEDSGFIAHRK   
Sbjct: 772  DLDLCEACCPSYKKLPKADTFMPCCGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQY 831

Query: 999  KKPYLRLKKKVHEYDFYIESNLRTIQTLETIASKIANMTENEKCNFKLPDGLGHTTSTIY 1058
            ++   +++++ HEYD+YIE+NLRTIQ LETIA+KI+NMT  EK  FKLP GLGHT++TIY
Sbjct: 832  EETLFKIEEERHEYDYYIEANLRTIQLLETIANKISNMTVEEKKTFKLPPGLGHTSTTIY 891

Query: 1059 KKVIRKVYDKERGFEIIDALHEYPAIAVPVVLKRLKQKDEEWRRAQREWNKVWRELEQKV 1118
            KKVIRKVYDK+RGFEIIDALHE PA++VP+VL+RLKQKDEEWRRAQREWNKVWRELEQKV
Sbjct: 892  KKVIRKVYDKDRGFEIIDALHENPAVSVPIVLRRLKQKDEEWRRAQREWNKVWRELEQKV 951

Query: 1119 FFKSLDHLGLTFKQADKKLLTTKQLISEISSIKVDQTHKRMHWLTPKPKSQLDFNLPDKD 1178
            F+KSLDHLGLTFKQADKKLLT KQLISEISSIK+DQ +KR++  T KPKSQLDF++ DK 
Sbjct: 952  FYKSLDHLGLTFKQADKKLLTAKQLISEISSIKIDQANKRIYPFTSKPKSQLDFDISDKG 1011

Query: 1179 IIFDILSFVEIFVEHTSTYSNPEKERLIDFMKYFTSLFFSIPLEEIKEAISKRDITEKND 1238
            ++FDIL+ V+ F++H++TYSNP+KE+L  F + F S+FFSIPL            T+ ++
Sbjct: 1012 VLFDILNLVDTFIDHSTTYSNPDKEKLSAFFRGFLSIFFSIPL------------TDLDN 1059

Query: 1239 EKLEDKQKNGEENSKKRTSRDITLSLEDILQRTKYQRLKYG---DDSDEVDGHGNRHDDQ 1295
               E K +NG  +S ++ SRD      D+L+    Q  K     +D    D         
Sbjct: 1060 PSEEHKVENG--DSTRKRSRDDDQFFRDLLKSKHKQAKKKTSQQEDESTSDDQDTAAKTS 1117

Query: 1296 KXXXXXXXXRQEAKKPWLLGTLVEEANAQGEIMHRNIFNMFSNTNMYIFIRHLTTMYERL 1355
                     R +AKKPWLLG +++EAN  G + +R  +NMF+NTN+Y+F RHLTTMY+RL
Sbjct: 1118 PDLEYEEAVRLDAKKPWLLGNILDEANNHGFVSNRKTYNMFANTNIYVFFRHLTTMYQRL 1177

Query: 1356 HEIKQMNDKVSREISGRKISKFAKDLNLISTQLTEMGLDFSEGDVYQQLLVLCKRLILGD 1415
             E K +N++V++EI+ RK+ +FAKDLNL STQL++MGLDF   D Y+QLL LCKRLI  D
Sbjct: 1178 SEAKNINEEVTKEINSRKVVQFAKDLNLASTQLSDMGLDFKGADAYEQLLALCKRLIQSD 1237

Query: 1416 LEHQWFEESLRQAFNNKAFKLYTLDKVTQALVKHAHTIISDLKTTEIMALFEKDRTKNST 1475
            +EHQWFEESLRQA+ NKAFK+YT+DKV Q+LVKHAH+II+D KT EIM LFEKDR   +T
Sbjct: 1238 IEHQWFEESLRQAYKNKAFKIYTVDKVIQSLVKHAHSIITDAKTAEIMILFEKDRKAPTT 1297

Query: 1476 SSKDQILYRLQTRARMTHNENMFRIEYNNTTKHICIQYIALDDLTVKDAKTLEEKWKYYI 1535
            S+++QILYRLQ R+ M   ENMFRIE N+T+ H+ IQ++A+DDLT+    +L+++W+YY+
Sbjct: 1298 STREQILYRLQVRSCMGLTENMFRIELNSTSAHVSIQFVAVDDLTLNQPNSLKDQWQYYL 1357

Query: 1536 TSYALSHPTEGIFQENIQIPFXXXXXXXXXXXXXXXXXXXKQTKSLMKYSPEGISGSTLK 1595
            TSY+LSHPTEG+  E I+ PF                      +    YSP G S S L+
Sbjct: 1358 TSYSLSHPTEGVPHEEIKAPF----------LEKTLRDDGDSDEDSEWYSPGGQSVSQLR 1407

Query: 1596 IKIDPQNYCLNIEEGSFDIFSRKSLNQFPVKLTQDSKYGTMPKLKNTVEKFLNSKMGWKR 1655
            I+I+P++Y L IE  S D+F+R ++N+ P K+ + S       ++ ++   +NS+ GWK+
Sbjct: 1408 IQINPESYALQIEPNSKDLFTRSTVNKHPTKIGEASGRDAK-TMQKSLADMVNSEHGWKK 1466

Query: 1656 AISKDQMESIESKWDHLSNNGNLEGYQEKSILKDVNGTDISKISPMKTFTVTESANGVPN 1715
             +  + +   ES  + +   G LE     S    V     +    +     TE     P 
Sbjct: 1467 GLQNESIGKAESIINFVKARGFLEKATTVSPDPKVEKEHSASNGAIPEGATTEK----PG 1522

Query: 1716 DKADGEERGNDTTAEEV-GNE 1735
            D  D + R ++TTAE++ GNE
Sbjct: 1523 D--DTDLRADETTAEDIQGNE 1541

 Score =  161 bits (408), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 76/100 (76%), Positives = 84/100 (84%), Gaps = 2/100 (2%)

Query: 295 EDNQYRPLNVKDALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIARVSSLFH 354
           +D  YRPLN KDALSYLEQVKFQFN+RPDVYNHFLDIMKD+KSQAIDT GVI R+S+LF 
Sbjct: 245 QDASYRPLNFKDALSYLEQVKFQFNNRPDVYNHFLDIMKDYKSQAIDTLGVIERISTLFK 304

Query: 355 DYPSLIQGFNTFLPQGYRIECSSNPNLP--ITVITPMGTT 392
            YP LIQG NTFLPQGY+IEC+SNP+ P  I V TP  TT
Sbjct: 305 GYPVLIQGLNTFLPQGYKIECTSNPHDPHSIKVTTPFDTT 344

 Score =  134 bits (336), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 79/158 (50%), Positives = 93/158 (58%), Gaps = 32/158 (20%)

Query: 538 RRTQDVEFSQAISYVNKIKNRFANQPYIYKHFLEILQTYQREQKPINEVYSQVTVLFQEA 597
           R   DVEFS AISYVNKIK RFA+QP IYKHFLEILQTYQREQKPI+EVY+QVT LFQ A
Sbjct: 435 RPNGDVEFSHAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPIHEVYTQVTSLFQNA 494

Query: 598 PDLLEDFKKFLPDSSANNNGSIVTSQEENFMYANGF-----------------------N 634
           PDLL+DFKKFLPD++A +       Q++                                
Sbjct: 495 PDLLDDFKKFLPDATAAHEQHQQLLQQQQQQQQLQHQIQLQQQQSQQYQSFQSSPQELDQ 554

Query: 635 QQQPHLTP---------HSEIQAQNLPPLGSFSTQPNG 663
           +QQ   +P         H + +AQNLPPLG+FS   NG
Sbjct: 555 RQQQSNSPFNHPASFYQHQQARAQNLPPLGNFSPPING 592

 Score = 55.1 bits (131), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 40/62 (64%)

Query: 307 ALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIARVSSLFHDYPSLIQGFNTF 366
           A+SY+ ++K +F  +PD+Y HFL+I++ ++ +      V  +V+SLF + P L+  F  F
Sbjct: 445 AISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPIHEVYTQVTSLFQNAPDLLDDFKKF 504

Query: 367 LP 368
           LP
Sbjct: 505 LP 506

 Score = 51.2 bits (121), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 41/67 (61%)

Query: 543 VEFSQAISYVNKIKNRFANQPYIYKHFLEILQTYQREQKPINEVYSQVTVLFQEAPDLLE 602
           + F  A+SY+ ++K +F N+P +Y HFL+I++ Y+ +      V  +++ LF+  P L++
Sbjct: 252 LNFKDALSYLEQVKFQFNNRPDVYNHFLDIMKDYKSQAIDTLGVIERISTLFKGYPVLIQ 311

Query: 603 DFKKFLP 609
               FLP
Sbjct: 312 GLNTFLP 318

>CAGL0J11594g Chr10 complement(1126896..1129709) [2814 bp, 937 aa]
            {ON} weakly similar to uniprot|P22579 Saccharomyces
            cerevisiae YOL004w SIN3 transcription regulatory protein
          Length = 937

 Score =  209 bits (532), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 123/377 (32%), Positives = 196/377 (51%), Gaps = 45/377 (11%)

Query: 863  FFDKVKKYIGNKTIYAEFLKVLNLYSVDLLEVDELVEKIKYYLNDNEELFSWFKNFVGYV 922
            F    +  + +++IY EFLK++NL++  L++++   ++   +   +  L + F N +   
Sbjct: 206  FLIYFRNLVYDESIYPEFLKLMNLFAQSLIDLNTFTKRAYIFFGSHNGLKTAFGNIMSEY 265

Query: 923  EKPKHIENIVHEKHKLDL---------DLCEACGPSYKKLPKTDTLMPCSGRDEMCWEIL 973
            +        +H++ K  L         D     GPSYK+L   +T   C GRD +C E+L
Sbjct: 266  KD-------IHQRMKPTLKSNDFDDIEDFSTESGPSYKRLSGFETRASCHGRDRLCHEVL 318

Query: 974  NDEWVGHPVWASEDSGFIAHRKINTKKPYLRLKKKVHEYDFYIESNLRTIQTLETIASKI 1033
            NDEWVGHPVWASE+ GFIAH+K   ++   +++++ HEYDF++ S          +   I
Sbjct: 319  NDEWVGHPVWASEEVGFIAHKKNQYEETLFKVEEERHEYDFFLLS----------VEHLI 368

Query: 1034 ANMTENEKCNFKLPDGLGH-------------TTSTIYKKVIRKVYDKERGFEIIDALHE 1080
               TE EK + +L    G              + ++I +KVIR++Y  E G  +IDA+  
Sbjct: 369  VKFTEYEK-SLQLSKDDGRRRNRVSSPKEPMISLNSITEKVIRRLYGIEHGNILIDAIKT 427

Query: 1081 YPAIAVPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVFFKSLDHLGLTFKQADKKLLTT 1140
             P   VP +LK  K+K ++W  A+ EWNK WRE+EQK ++KSLDHLGL FK A+K+ L  
Sbjct: 428  NPEKVVPTILKTAKEKYQQWNSAKNEWNKAWREVEQKAYYKSLDHLGLPFKNAEKRFLND 487

Query: 1141 KQLISEISSIKVDQTHKRMHWLTPKPKSQLDFNLPDKDIIFDILSFVEIFVEHTSTYSNP 1200
            KQL+ E  S K D+  K  +        +  +   DK +++D+   +   +   S+ S  
Sbjct: 488  KQLLLEYKSEKQDKLLKEHY-----DNYEYKYEFFDKSVLYDVKDIILCGLRSNSSTSES 542

Query: 1201 EKERLIDFMKYFTSLFF 1217
            +K       + F  L F
Sbjct: 543  QKNLYCQIFEAFFDLLF 559

 Score =  110 bits (275), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 91/335 (27%), Positives = 157/335 (46%), Gaps = 18/335 (5%)

Query: 1326 EIMHRNIFNMFSNTNMYIFIRHLTTMYERLHEIKQMNDKVSREI--SGRKISKFAKDLNL 1383
            E  +R   N+F + N+     ++ T+YER +++K     + +++    R+ S  AK L L
Sbjct: 616  EFSNRQNINIFCDINIMSLFHYIQTLYERYNDVKIAETTILKDLRTKKRRPSLLAKSLKL 675

Query: 1384 ISTQLTEMGLDFSEGDVYQQLLVLCKRLILGDLEHQWFEESLRQAFNNKAFKLYTLDKVT 1443
            +  QL++ GL+  + D Y+ +    K+ + G+L+HQWFEESLR  F NKA+KLYT+D+V 
Sbjct: 676  LPMQLSDNGLELGQDDGYEWIKTTSKKFLSGNLDHQWFEESLRINFENKAYKLYTIDRVI 735

Query: 1444 QALVKHAHTIISDLKTTEIMALFEKDRTKNSTSSKDQILYRLQTRARMTHNENMFRIEYN 1503
            + ++    TI       +I+ L   +  K +T+   Q+ YR + R  M    +MFR+E  
Sbjct: 736  RNILGVITTISQTPSLLQILDLLVDNMKKLTTTKLQQLTYRTKVRMLMDGVGDMFRLEIV 795

Query: 1504 NTTKHICIQYIALDDLTVKDAKTLEEKWKYYITSYALSHPTEGIFQENIQIPFXXXXXXX 1563
              +  I  QYI +DDL        + +   Y   Y  +  T+ +  + +  P+       
Sbjct: 796  RDSNAIYGQYIGVDDLLHAQLDKNKLEHSLYCQEYLSADATKYLDTDGLNTPY------- 848

Query: 1564 XXXXXXXXXXXXKQTKSLMKYSPEGISGSTLKIKIDPQNYCLNIEEGSFDIFSRKSLNQF 1623
                        K+ +  + +    I    L + I+P +Y ++I  GS DI S   + + 
Sbjct: 849  ------YSLNLLKREEQNIPFMNGNIYKPHLSVNINPLDYVVDIAPGSIDICSSTHITKL 902

Query: 1624 PVKLTQDSKYGTMPKLKNTVEKFLNSKMGWKRAIS 1658
               L + S+   M  L + + K  N K    R I 
Sbjct: 903  KSSL-KSSRKTQMASLISKIAK--NRKQQRARTIG 934

>SAKL0G07612g Chr7 (634753..635964) [1212 bp, 403 aa] {ON} similar
           to uniprot|Q05515 Saccharomyces cerevisiae YDR346C SVF1
           Protein with a potential role in cell survival pathways
           required for the diauxic growth shift expression in
           mammalian cells increases survival under conditions
           inducing apoptosis
          Length = 403

 Score = 33.9 bits (76), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 41/73 (56%), Gaps = 5/73 (6%)

Query: 522 PMVSSVSPPLQELPEQRRTQDVEFSQAISYVNKIKNRFAN-QPYIYKHFLEILQTYQREQ 580
           P+ ++VS PL++L E+    DV  S+  S+V  I +  A  +PYIY++F E+  T    Q
Sbjct: 321 PLKATVSGPLRDLVERI---DV-MSEIPSFVKNIVSGVAGTKPYIYQYFNEMALTIDEGQ 376

Query: 581 KPINEVYSQVTVL 593
           K     + +VT +
Sbjct: 377 KIDGLGWCEVTFI 389

>Kpol_1064.53 s1064 (95468..96937) [1470 bp, 489 aa] {ON}
           (95468..96937) [1470 nt, 490 aa]
          Length = 489

 Score = 33.9 bits (76), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 37/72 (51%), Gaps = 3/72 (4%)

Query: 867 VKKYIGNKTIYAEFLKVLNLYSVDLLEVDELVEKIKYYLNDNEELFSWFKNFVGY---VE 923
           ++ Y G K +Y ++LKVLN    D   V + VE       ++ ++  +  N + Y    E
Sbjct: 77  IQLYTGLKNMYQDYLKVLNQLKQDKAAVRDEVEASDDKPEESSDVLEYIVNELPYQQPTE 136

Query: 924 KPKHIENIVHEK 935
           + K+I+N +H K
Sbjct: 137 RKKYIDNFIHSK 148

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.313    0.130    0.373 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 170,002,652
Number of extensions: 7852200
Number of successful extensions: 29843
Number of sequences better than 10.0: 121
Number of HSP's gapped: 31019
Number of HSP's successfully gapped: 216
Length of query: 1739
Length of database: 53,481,399
Length adjustment: 124
Effective length of query: 1615
Effective length of database: 39,262,815
Effective search space: 63409446225
Effective search space used: 63409446225
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 73 (32.7 bits)