Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0E031506.30ON1181186244e-85
TDEL0G043906.30ON1221185663e-76
ZYRO0C07502g6.30ON1221185654e-76
Kpol_1037.216.30ON1201185551e-74
NCAS0D021206.30ON1221185551e-74
Suva_15.1696.30ON1221185542e-74
Skud_15.1576.30ON1221185542e-74
CAGL0E02453g6.30ON1201185508e-74
YOL005C (RPB11)6.30ON1201185491e-73
Smik_15.1656.30ON1201185491e-73
KAFR0A051106.30ON1221185482e-73
KNAG0F029106.30ON1221185412e-72
NDAI0C026706.30ON1221185378e-72
TPHA0J004106.30ON1201185309e-71
ACL005C6.30ON1221185249e-70
SAKL0E01562g6.30ON1221185239e-70
Kwal_56.224726.30ON1221185143e-68
KLTH0C10934g6.30ON1221185116e-68
KLLA0C06160g6.30ON1211185041e-66
TPHA0B029202.163ON130921322e-10
CAGL0L03872g2.163ON137911262e-09
Kpol_165.22.163ON128921228e-09
KAFR0B045702.163ON131911183e-08
TBLA0B012902.163ON102861163e-08
KNAG0I020602.163ON134901165e-08
YNL113W (RPC19)2.163ON1421021168e-08
Smik_14.2142.163ON1421021151e-07
Ecym_54232.163ON127901141e-07
Suva_14.2252.163ON1421041141e-07
Skud_14.2182.163ON1561041133e-07
AFL220C2.163ON135901113e-07
ZYRO0B09878g2.163ON130901105e-07
NCAS0G025502.163ON1501021097e-07
SAKL0E10692g2.163ON131901062e-06
NDAI0F027502.163ON149691053e-06
KLLA0F23760g2.163ON127881034e-06
KLTH0D09350g2.163ON146711035e-06
TDEL0F011802.163ON129901018e-06
Kwal_26.84732.163ON15071992e-05
NCAS0C058604.15ON1868111730.17
YHL030W (ECM29)4.15ON186871720.22
Suva_6.58.2ON44286690.56
Smik_8.114.15ON186937671.1
Smik_6.288.2ON44443633.0
Suva_8.214.15ON186863633.1
Suva_4.1914.238ON178266633.8
YFL048C (EMP47)8.2ON44543624.2
Ecym_47207.353ON26143614.9
TDEL0D034003.286ON16199605.8
AGR316C5.161ON71380607.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0E03150
         (118 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0E03150 Chr5 complement(788457..788813) [357 bp, 118 aa] {ON...   244   4e-85
TDEL0G04390 Chr7 complement(794577..794945) [369 bp, 122 aa] {ON...   222   3e-76
ZYRO0C07502g Chr3 complement(567967..568335) [369 bp, 122 aa] {O...   222   4e-76
Kpol_1037.21 s1037 complement(44216..44578) [363 bp, 120 aa] {ON...   218   1e-74
NCAS0D02120 Chr4 complement(393640..394008) [369 bp, 122 aa] {ON...   218   1e-74
Suva_15.169 Chr15 complement(289702..290070) [369 bp, 122 aa] {O...   218   2e-74
Skud_15.157 Chr15 complement(275429..275797) [369 bp, 122 aa] {O...   218   2e-74
CAGL0E02453g Chr5 complement(233352..233714) [363 bp, 120 aa] {O...   216   8e-74
YOL005C Chr15 complement(315813..316175) [363 bp, 120 aa] {ON}  ...   216   1e-73
Smik_15.165 Chr15 complement(283099..283461) [363 bp, 120 aa] {O...   216   1e-73
KAFR0A05110 Chr1 complement(1014087..1014455) [369 bp, 122 aa] {...   215   2e-73
KNAG0F02910 Chr6 complement(551617..551985) [369 bp, 122 aa] {ON...   213   2e-72
NDAI0C02670 Chr3 (621282..621650) [369 bp, 122 aa] {ON} Anc_6.30...   211   8e-72
TPHA0J00410 Chr10 (95837..96199) [363 bp, 120 aa] {ON} Anc_6.30 ...   208   9e-71
ACL005C Chr3 complement(346569..346937) [369 bp, 122 aa] {ON} Sy...   206   9e-70
SAKL0E01562g Chr5 (120177..120545) [369 bp, 122 aa] {ON} highly ...   206   9e-70
Kwal_56.22472 s56 (144443..144811) [369 bp, 122 aa] {ON} YOL005C...   202   3e-68
KLTH0C10934g Chr3 complement(900683..901051) [369 bp, 122 aa] {O...   201   6e-68
KLLA0C06160g Chr3 complement(543239..543604) [366 bp, 121 aa] {O...   198   1e-66
TPHA0B02920 Chr2 (666060..666452) [393 bp, 130 aa] {ON} Anc_2.16...    55   2e-10
CAGL0L03872g Chr12 complement(447274..447687) [414 bp, 137 aa] {...    53   2e-09
Kpol_165.2 s165 complement(2511..2897) [387 bp, 128 aa] {ON} com...    52   8e-09
KAFR0B04570 Chr2 complement(949880..950275) [396 bp, 131 aa] {ON...    50   3e-08
TBLA0B01290 Chr2 (274238..274546) [309 bp, 102 aa] {ON} Anc_2.16...    49   3e-08
KNAG0I02060 Chr9 complement(401412..401816) [405 bp, 134 aa] {ON...    49   5e-08
YNL113W Chr14 (412771..413199) [429 bp, 142 aa] {ON}  RPC19RNA p...    49   8e-08
Smik_14.214 Chr14 (392413..392841) [429 bp, 142 aa] {ON} YNL113W...    49   1e-07
Ecym_5423 Chr5 complement(871715..872098) [384 bp, 127 aa] {ON} ...    49   1e-07
Suva_14.225 Chr14 (409562..409990) [429 bp, 142 aa] {ON} YNL113W...    49   1e-07
Skud_14.218 Chr14 (402879..403349) [471 bp, 156 aa] {ON} YNL113W...    48   3e-07
AFL220C Chr6 complement(25281..25688) [408 bp, 135 aa] {ON} Synt...    47   3e-07
ZYRO0B09878g Chr2 complement(771644..772036) [393 bp, 130 aa] {O...    47   5e-07
NCAS0G02550 Chr7 (456827..457279) [453 bp, 150 aa] {ON} Anc_2.16...    47   7e-07
SAKL0E10692g Chr5 complement(891637..892032) [396 bp, 131 aa] {O...    45   2e-06
NDAI0F02750 Chr6 complement(673843..674292) [450 bp, 149 aa] {ON...    45   3e-06
KLLA0F23760g Chr6 complement(2218555..2218938) [384 bp, 127 aa] ...    44   4e-06
KLTH0D09350g Chr4 complement(776115..776555) [441 bp, 146 aa] {O...    44   5e-06
TDEL0F01180 Chr6 (211106..211495) [390 bp, 129 aa] {ON} Anc_2.16...    44   8e-06
Kwal_26.8473 s26 complement(800017..800469) [453 bp, 150 aa] {ON...    43   2e-05
NCAS0C05860 Chr3 complement(1204693..1210299) [5607 bp, 1868 aa]...    33   0.17 
YHL030W Chr8 (40084..45690) [5607 bp, 1868 aa] {ON}  ECM29Scaffo...    32   0.22 
Suva_6.5 Chr6 complement(12340..13668) [1329 bp, 442 aa] {ON} YF...    31   0.56 
Smik_8.11 Chr8 (23753..29362) [5610 bp, 1869 aa] {ON} YHL030W (R...    30   1.1  
Smik_6.28 Chr6 complement(54289..55623) [1335 bp, 444 aa] {ON} Y...    29   3.0  
Suva_8.21 Chr8 (41705..47311) [5607 bp, 1868 aa] {ON} YHL030W (R...    29   3.1  
Suva_4.191 Chr4 (335199..340547) [5349 bp, 1782 aa] {ON} YDL058W...    29   3.8  
YFL048C Chr6 complement(38843..40180) [1338 bp, 445 aa] {ON}  EM...    28   4.2  
Ecym_4720 Chr4 complement(1412286..1413065,1413130..1413135) [78...    28   4.9  
TDEL0D03400 Chr4 (632541..633026) [486 bp, 161 aa] {ON} Anc_3.286      28   5.8  
AGR316C Chr7 complement(1323148..1325289) [2142 bp, 713 aa] {ON}...    28   7.9  

>TBLA0E03150 Chr5 complement(788457..788813) [357 bp, 118 aa] {ON}
           Anc_6.30 YOL005C
          Length = 118

 Score =  244 bits (624), Expect = 4e-85,   Method: Compositional matrix adjust.
 Identities = 118/118 (100%), Positives = 118/118 (100%)

Query: 1   MNAPDRFESFLLGEGESKLQIEPDTKAPNTVVITFEKEDHTLGNLIKSELLHDPKVLFAA 60
           MNAPDRFESFLLGEGESKLQIEPDTKAPNTVVITFEKEDHTLGNLIKSELLHDPKVLFAA
Sbjct: 1   MNAPDRFESFLLGEGESKLQIEPDTKAPNTVVITFEKEDHTLGNLIKSELLHDPKVLFAA 60

Query: 61  YKVEHPLFARFKMRIQTVEGYDPKDALRKACNSIIKKLGILKTNFETEWNLQTLASDD 118
           YKVEHPLFARFKMRIQTVEGYDPKDALRKACNSIIKKLGILKTNFETEWNLQTLASDD
Sbjct: 61  YKVEHPLFARFKMRIQTVEGYDPKDALRKACNSIIKKLGILKTNFETEWNLQTLASDD 118

>TDEL0G04390 Chr7 complement(794577..794945) [369 bp, 122 aa] {ON}
           Anc_6.30 YOL005C
          Length = 122

 Score =  222 bits (566), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 106/118 (89%), Positives = 111/118 (94%)

Query: 1   MNAPDRFESFLLGEGESKLQIEPDTKAPNTVVITFEKEDHTLGNLIKSELLHDPKVLFAA 60
           MNAPDRFE FLLGEGESKL+IEPDTKAPN VVITFEKEDHTLGNLI+SELL+D KVLFAA
Sbjct: 1   MNAPDRFELFLLGEGESKLKIEPDTKAPNAVVITFEKEDHTLGNLIRSELLNDTKVLFAA 60

Query: 61  YKVEHPLFARFKMRIQTVEGYDPKDALRKACNSIIKKLGILKTNFETEWNLQTLASDD 118
           YKVEHPLFARFKMRIQTVEGYDPKDAL+ ACN II KL +LKTNFETEWNLQTLASDD
Sbjct: 61  YKVEHPLFARFKMRIQTVEGYDPKDALKNACNGIINKLAVLKTNFETEWNLQTLASDD 118

>ZYRO0C07502g Chr3 complement(567967..568335) [369 bp, 122 aa] {ON}
           highly similar to uniprot|P38902 Saccharomyces
           cerevisiae YOL005C
          Length = 122

 Score =  222 bits (565), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 102/118 (86%), Positives = 113/118 (95%)

Query: 1   MNAPDRFESFLLGEGESKLQIEPDTKAPNTVVITFEKEDHTLGNLIKSELLHDPKVLFAA 60
           MNAPDRFE FLLGEGESKL+++PDTKAPN +V+TFEKEDHTLGNLI++ELL+DPKVLFAA
Sbjct: 1   MNAPDRFELFLLGEGESKLRVDPDTKAPNAIVVTFEKEDHTLGNLIRAELLNDPKVLFAA 60

Query: 61  YKVEHPLFARFKMRIQTVEGYDPKDALRKACNSIIKKLGILKTNFETEWNLQTLASDD 118
           YKVEHPLFARFKMRIQT+EGYDPKDAL+ ACN II KLG+LKTNFETEWNLQTLASDD
Sbjct: 61  YKVEHPLFARFKMRIQTMEGYDPKDALKNACNGIINKLGVLKTNFETEWNLQTLASDD 118

>Kpol_1037.21 s1037 complement(44216..44578) [363 bp, 120 aa] {ON}
           complement(44216..44578) [363 nt, 121 aa]
          Length = 120

 Score =  218 bits (555), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 104/118 (88%), Positives = 111/118 (94%)

Query: 1   MNAPDRFESFLLGEGESKLQIEPDTKAPNTVVITFEKEDHTLGNLIKSELLHDPKVLFAA 60
           MNAPD+FE FLLGEGESKL IEPDTKAPN VVITFEKEDHTLGNLI+SELL+D KVLFAA
Sbjct: 1   MNAPDKFELFLLGEGESKLNIEPDTKAPNAVVITFEKEDHTLGNLIRSELLNDSKVLFAA 60

Query: 61  YKVEHPLFARFKMRIQTVEGYDPKDALRKACNSIIKKLGILKTNFETEWNLQTLASDD 118
           YKVEHPLFARFK+RIQTVE YDPKDAL+ ACN+II KLGILKTNFETEWNLQTLASD+
Sbjct: 61  YKVEHPLFARFKLRIQTVENYDPKDALKNACNNIINKLGILKTNFETEWNLQTLASDE 118

>NCAS0D02120 Chr4 complement(393640..394008) [369 bp, 122 aa] {ON}
           Anc_6.30 YOL005C
          Length = 122

 Score =  218 bits (555), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 102/118 (86%), Positives = 111/118 (94%)

Query: 1   MNAPDRFESFLLGEGESKLQIEPDTKAPNTVVITFEKEDHTLGNLIKSELLHDPKVLFAA 60
           MNAPDRFE FLLGEGESKLQI+PDTKAPN VVITFEKEDHTLGNLI+SELL+D +VLFAA
Sbjct: 1   MNAPDRFELFLLGEGESKLQIDPDTKAPNAVVITFEKEDHTLGNLIRSELLNDSRVLFAA 60

Query: 61  YKVEHPLFARFKMRIQTVEGYDPKDALRKACNSIIKKLGILKTNFETEWNLQTLASDD 118
           YKVEHP FARFK+RIQTVEGYDPKDAL+ ACNSII KLG+LK NFETEWNLQTLA+D+
Sbjct: 61  YKVEHPFFARFKLRIQTVEGYDPKDALKNACNSIISKLGVLKGNFETEWNLQTLAADE 118

>Suva_15.169 Chr15 complement(289702..290070) [369 bp, 122 aa] {ON}
           YOL005C (REAL)
          Length = 122

 Score =  218 bits (554), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 103/118 (87%), Positives = 110/118 (93%)

Query: 1   MNAPDRFESFLLGEGESKLQIEPDTKAPNTVVITFEKEDHTLGNLIKSELLHDPKVLFAA 60
           MNAPDRFE FLLGEGESKL+IEPDTKAPN VVITFEKEDHTLGNLI++ELL+D KVLFAA
Sbjct: 1   MNAPDRFELFLLGEGESKLKIEPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAA 60

Query: 61  YKVEHPLFARFKMRIQTVEGYDPKDALRKACNSIIKKLGILKTNFETEWNLQTLASDD 118
           YKVEHP FARFK+RIQT EGYDPKDAL+ ACNSII KLG LKTNFETEWNLQTLA+DD
Sbjct: 61  YKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTLAADD 118

>Skud_15.157 Chr15 complement(275429..275797) [369 bp, 122 aa] {ON}
           YOL005C (REAL)
          Length = 122

 Score =  218 bits (554), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 103/118 (87%), Positives = 110/118 (93%)

Query: 1   MNAPDRFESFLLGEGESKLQIEPDTKAPNTVVITFEKEDHTLGNLIKSELLHDPKVLFAA 60
           MNAPDRFE FLLGEGESKL+IEPDTKAPN VVITFEKEDHTLGNLI++ELL+D KVLFAA
Sbjct: 1   MNAPDRFELFLLGEGESKLKIEPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAA 60

Query: 61  YKVEHPLFARFKMRIQTVEGYDPKDALRKACNSIIKKLGILKTNFETEWNLQTLASDD 118
           YKVEHP FARFK+RIQT EGYDPKDAL+ ACNSII KLG LKTNFETEWNLQTLA+DD
Sbjct: 61  YKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTLAADD 118

>CAGL0E02453g Chr5 complement(233352..233714) [363 bp, 120 aa] {ON}
           highly similar to uniprot|P38902 Saccharomyces
           cerevisiae YOL005c RPB11 DNA-directed RNA polymerase II
          Length = 120

 Score =  216 bits (550), Expect = 8e-74,   Method: Compositional matrix adjust.
 Identities = 102/118 (86%), Positives = 111/118 (94%)

Query: 1   MNAPDRFESFLLGEGESKLQIEPDTKAPNTVVITFEKEDHTLGNLIKSELLHDPKVLFAA 60
           MNAPDRFE FLLGEGESKL+I+PDTKAPN VVITFEKEDHTLGNLI++ELL+D KVLFAA
Sbjct: 1   MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDNKVLFAA 60

Query: 61  YKVEHPLFARFKMRIQTVEGYDPKDALRKACNSIIKKLGILKTNFETEWNLQTLASDD 118
           YKVEHP FARFK+RIQTVEGYDPKDALR AC+SII KLG LK+NFETEWNLQTLA+DD
Sbjct: 61  YKVEHPFFARFKLRIQTVEGYDPKDALRNACSSIINKLGALKSNFETEWNLQTLAADD 118

>YOL005C Chr15 complement(315813..316175) [363 bp, 120 aa] {ON}
           RPB11RNA polymerase II subunit B12.5; part of central
           core; similar to Rpc19p and bacterial alpha subunit
          Length = 120

 Score =  216 bits (549), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 102/118 (86%), Positives = 110/118 (93%)

Query: 1   MNAPDRFESFLLGEGESKLQIEPDTKAPNTVVITFEKEDHTLGNLIKSELLHDPKVLFAA 60
           MNAPDRFE FLLGEGESKL+I+PDTKAPN VVITFEKEDHTLGNLI++ELL+D KVLFAA
Sbjct: 1   MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAA 60

Query: 61  YKVEHPLFARFKMRIQTVEGYDPKDALRKACNSIIKKLGILKTNFETEWNLQTLASDD 118
           YKVEHP FARFK+RIQT EGYDPKDAL+ ACNSII KLG LKTNFETEWNLQTLA+DD
Sbjct: 61  YKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTLAADD 118

>Smik_15.165 Chr15 complement(283099..283461) [363 bp, 120 aa] {ON}
           YOL005C (REAL)
          Length = 120

 Score =  216 bits (549), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 102/118 (86%), Positives = 110/118 (93%)

Query: 1   MNAPDRFESFLLGEGESKLQIEPDTKAPNTVVITFEKEDHTLGNLIKSELLHDPKVLFAA 60
           MNAPDRFE FLLGEGESKL+I+PDTKAPN VVITFEKEDHTLGNLI++ELL+D KVLFAA
Sbjct: 1   MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAA 60

Query: 61  YKVEHPLFARFKMRIQTVEGYDPKDALRKACNSIIKKLGILKTNFETEWNLQTLASDD 118
           YKVEHP FARFK+RIQT EGYDPKDAL+ ACNSII KLG LKTNFETEWNLQTLA+DD
Sbjct: 61  YKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTLATDD 118

>KAFR0A05110 Chr1 complement(1014087..1014455) [369 bp, 122 aa] {ON}
           Anc_6.30 YOL005C
          Length = 122

 Score =  215 bits (548), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 100/118 (84%), Positives = 112/118 (94%)

Query: 1   MNAPDRFESFLLGEGESKLQIEPDTKAPNTVVITFEKEDHTLGNLIKSELLHDPKVLFAA 60
           MNAPDRFE FLLGEGESKL+I+PDTK+PN VVITFEKEDHTLGNLI++ELL+D KVLFAA
Sbjct: 1   MNAPDRFELFLLGEGESKLKIDPDTKSPNAVVITFEKEDHTLGNLIRAELLNDTKVLFAA 60

Query: 61  YKVEHPLFARFKMRIQTVEGYDPKDALRKACNSIIKKLGILKTNFETEWNLQTLASDD 118
           YKVEHP FARFK+R+QT+EGYDPK+AL+ ACNSII KLGILKTNFETEWNLQTLASD+
Sbjct: 61  YKVEHPFFARFKLRVQTIEGYDPKEALKNACNSIINKLGILKTNFETEWNLQTLASDE 118

>KNAG0F02910 Chr6 complement(551617..551985) [369 bp, 122 aa] {ON}
           Anc_6.30 YOL005C
          Length = 122

 Score =  213 bits (541), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 99/118 (83%), Positives = 109/118 (92%)

Query: 1   MNAPDRFESFLLGEGESKLQIEPDTKAPNTVVITFEKEDHTLGNLIKSELLHDPKVLFAA 60
           MNAPDRFE FLLG+GESKL I+PDTK+PN +VITF KEDHTLGNLI++ELL+D KVLFAA
Sbjct: 1   MNAPDRFELFLLGDGESKLVIDPDTKSPNAIVITFNKEDHTLGNLIRAELLNDSKVLFAA 60

Query: 61  YKVEHPLFARFKMRIQTVEGYDPKDALRKACNSIIKKLGILKTNFETEWNLQTLASDD 118
           YKVEHP FARFK+RIQTVEGYDPKDAL+ ACN II KLGILKTNFETEWNLQTLA+DD
Sbjct: 61  YKVEHPFFARFKLRIQTVEGYDPKDALKNACNGIINKLGILKTNFETEWNLQTLATDD 118

>NDAI0C02670 Chr3 (621282..621650) [369 bp, 122 aa] {ON} Anc_6.30
           YOL005C
          Length = 122

 Score =  211 bits (537), Expect = 8e-72,   Method: Compositional matrix adjust.
 Identities = 101/118 (85%), Positives = 109/118 (92%)

Query: 1   MNAPDRFESFLLGEGESKLQIEPDTKAPNTVVITFEKEDHTLGNLIKSELLHDPKVLFAA 60
           MNAPDRFE FLLGEGESKL I+PDTKAPN VVITF+KEDHTLGNLI+SELL+D KVLFAA
Sbjct: 1   MNAPDRFELFLLGEGESKLTIDPDTKAPNAVVITFQKEDHTLGNLIRSELLNDGKVLFAA 60

Query: 61  YKVEHPLFARFKMRIQTVEGYDPKDALRKACNSIIKKLGILKTNFETEWNLQTLASDD 118
           YKVEHP FA FK+RIQTVEGYDPK AL+ ACN+II KLGILKTNFETEWNLQTLASD+
Sbjct: 61  YKVEHPFFANFKLRIQTVEGYDPKLALKNACNNIINKLGILKTNFETEWNLQTLASDE 118

>TPHA0J00410 Chr10 (95837..96199) [363 bp, 120 aa] {ON} Anc_6.30
           YOL005C
          Length = 120

 Score =  208 bits (530), Expect = 9e-71,   Method: Compositional matrix adjust.
 Identities = 100/118 (84%), Positives = 108/118 (91%)

Query: 1   MNAPDRFESFLLGEGESKLQIEPDTKAPNTVVITFEKEDHTLGNLIKSELLHDPKVLFAA 60
           MNAPDRFE FLL EG+SKLQIE DTKA N VVITFEKEDHTLGNLI++ELL+D KVLFAA
Sbjct: 1   MNAPDRFELFLLDEGQSKLQIEQDTKAANAVVITFEKEDHTLGNLIRNELLNDEKVLFAA 60

Query: 61  YKVEHPLFARFKMRIQTVEGYDPKDALRKACNSIIKKLGILKTNFETEWNLQTLASDD 118
           YKVEHPLFARFK+RIQT E YDPKDAL+ ACN+II KLGILKTNF+TEWNLQTLASDD
Sbjct: 61  YKVEHPLFARFKLRIQTEENYDPKDALKMACNNIINKLGILKTNFDTEWNLQTLASDD 118

>ACL005C Chr3 complement(346569..346937) [369 bp, 122 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL005C
           (RPB11)
          Length = 122

 Score =  206 bits (524), Expect = 9e-70,   Method: Compositional matrix adjust.
 Identities = 96/118 (81%), Positives = 107/118 (90%)

Query: 1   MNAPDRFESFLLGEGESKLQIEPDTKAPNTVVITFEKEDHTLGNLIKSELLHDPKVLFAA 60
           MNAPDRFE FLL EGESKL+IEPDTKA N V+ITFEKEDHTLGN+I++ELL D +VLFAA
Sbjct: 1   MNAPDRFELFLLPEGESKLKIEPDTKAANAVIITFEKEDHTLGNIIRAELLEDERVLFAA 60

Query: 61  YKVEHPLFARFKMRIQTVEGYDPKDALRKACNSIIKKLGILKTNFETEWNLQTLASDD 118
           YKVEHPLFARF+MRIQT EGYDPK+AL+ ACNSII KL  LK+NFETEWNLQTLAS+D
Sbjct: 61  YKVEHPLFARFRMRIQTAEGYDPKEALKNACNSIINKLATLKSNFETEWNLQTLASED 118

>SAKL0E01562g Chr5 (120177..120545) [369 bp, 122 aa] {ON} highly
           similar to uniprot|P38902 Saccharomyces cerevisiae
           YOL005C
          Length = 122

 Score =  206 bits (523), Expect = 9e-70,   Method: Compositional matrix adjust.
 Identities = 97/118 (82%), Positives = 108/118 (91%)

Query: 1   MNAPDRFESFLLGEGESKLQIEPDTKAPNTVVITFEKEDHTLGNLIKSELLHDPKVLFAA 60
           MNAPDRFE FLL EGESKL IEPDTKAPN V+ITFEKEDHTLGNLI++ELL D +VLFAA
Sbjct: 1   MNAPDRFELFLLPEGESKLNIEPDTKAPNAVIITFEKEDHTLGNLIRAELLEDQRVLFAA 60

Query: 61  YKVEHPLFARFKMRIQTVEGYDPKDALRKACNSIIKKLGILKTNFETEWNLQTLASDD 118
           YKVEHPLFARFKMRIQTVEGYDPKDAL+ ACN+II KL  L++NFETEW+LQTLAS++
Sbjct: 61  YKVEHPLFARFKMRIQTVEGYDPKDALKNACNNIITKLAQLQSNFETEWSLQTLASEE 118

>Kwal_56.22472 s56 (144443..144811) [369 bp, 122 aa] {ON} YOL005C
           (RPB11) - RNA polymerase II subunit, homologous to S.
           pombe Rpb11p subunit [contig 185] FULL
          Length = 122

 Score =  202 bits (514), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 94/118 (79%), Positives = 106/118 (89%)

Query: 1   MNAPDRFESFLLGEGESKLQIEPDTKAPNTVVITFEKEDHTLGNLIKSELLHDPKVLFAA 60
           MNAPDRFE FLL EGE+KL+I+PDTKAPN V++TFEKEDHTL NLI++ELL D  VLFAA
Sbjct: 1   MNAPDRFELFLLPEGEAKLKIDPDTKAPNAVIVTFEKEDHTLANLIRAELLEDKGVLFAA 60

Query: 61  YKVEHPLFARFKMRIQTVEGYDPKDALRKACNSIIKKLGILKTNFETEWNLQTLASDD 118
           YKVEHPLFA+FKMRIQT EGYDPKDAL+ ACN II KLG L++NFETEWNLQTLAS+D
Sbjct: 61  YKVEHPLFAQFKMRIQTAEGYDPKDALKNACNGIISKLGQLQSNFETEWNLQTLASED 118

>KLTH0C10934g Chr3 complement(900683..901051) [369 bp, 122 aa] {ON}
           highly similar to uniprot|P38902 Saccharomyces
           cerevisiae YOL005C
          Length = 122

 Score =  201 bits (511), Expect = 6e-68,   Method: Compositional matrix adjust.
 Identities = 94/118 (79%), Positives = 106/118 (89%)

Query: 1   MNAPDRFESFLLGEGESKLQIEPDTKAPNTVVITFEKEDHTLGNLIKSELLHDPKVLFAA 60
           MNAPDRFE FLL EGE+KL+I+PDTKAPN V++TFEKEDHTL NLI+ ELL D  VLFAA
Sbjct: 1   MNAPDRFELFLLPEGEAKLKIDPDTKAPNAVIVTFEKEDHTLANLIRGELLEDKGVLFAA 60

Query: 61  YKVEHPLFARFKMRIQTVEGYDPKDALRKACNSIIKKLGILKTNFETEWNLQTLASDD 118
           YKVEHPLFA+FK+RIQTVEGYDPKDAL+ ACN II KLG L++NFETEWNLQTLAS+D
Sbjct: 61  YKVEHPLFAQFKLRIQTVEGYDPKDALKNACNGIISKLGQLQSNFETEWNLQTLASED 118

>KLLA0C06160g Chr3 complement(543239..543604) [366 bp, 121 aa] {ON}
           highly similar to uniprot|P38902 Saccharomyces
           cerevisiae YOL005C
          Length = 121

 Score =  198 bits (504), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 92/118 (77%), Positives = 106/118 (89%)

Query: 1   MNAPDRFESFLLGEGESKLQIEPDTKAPNTVVITFEKEDHTLGNLIKSELLHDPKVLFAA 60
           MNAPDRFE FLL EGESKL++E DTKA + +++TFEKEDHTLGNLI++ELL D  VLFAA
Sbjct: 1   MNAPDRFELFLLPEGESKLKVEQDTKASSAIIVTFEKEDHTLGNLIRAELLEDEGVLFAA 60

Query: 61  YKVEHPLFARFKMRIQTVEGYDPKDALRKACNSIIKKLGILKTNFETEWNLQTLASDD 118
           YKVEHPLFA+FKMRIQTVEGYDPKDAL+ ACNSII KL  L++NFETEWNLQTLA++D
Sbjct: 61  YKVEHPLFAKFKMRIQTVEGYDPKDALKNACNSIINKLAQLQSNFETEWNLQTLATED 118

>TPHA0B02920 Chr2 (666060..666452) [393 bp, 130 aa] {ON} Anc_2.163
           YNL113W
          Length = 130

 Score = 55.5 bits (132), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 50/92 (54%), Gaps = 2/92 (2%)

Query: 16  ESKLQIEPDTKAPNTVVITFE--KEDHTLGNLIKSELLHDPKVLFAAYKVEHPLFARFKM 73
           E K++I P+  +P+    +F+  +EDHTLGN ++  ++ +P+V F  Y + HP      +
Sbjct: 32  EDKIKILPNATSPDGTSASFQISEEDHTLGNALRHIIMKNPEVEFCGYSIPHPSETLLNL 91

Query: 74  RIQTVEGYDPKDALRKACNSIIKKLGILKTNF 105
           RIQT       +AL+K    ++    +++  F
Sbjct: 92  RIQTYGNTTAVEALQKGLKDLMDMCDVVEEKF 123

>CAGL0L03872g Chr12 complement(447274..447687) [414 bp, 137 aa] {ON}
           similar to uniprot|P28000 Saccharomyces cerevisiae
           YNL113w RPC19 DNA-directed RNA polymerase I III
          Length = 137

 Score = 53.1 bits (126), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 48/91 (52%), Gaps = 2/91 (2%)

Query: 17  SKLQIEPDTKAPNTVVITFE--KEDHTLGNLIKSELLHDPKVLFAAYKVEHPLFARFKMR 74
           +K+++ P   + +    +F+  +EDHTLGN ++  ++ +P+V F  Y + HP      +R
Sbjct: 41  TKIKLLPQATSEDGTCASFQIAQEDHTLGNALRYIIMKNPEVEFCGYSIPHPSEELLNLR 100

Query: 75  IQTVEGYDPKDALRKACNSIIKKLGILKTNF 105
           IQT       DAL+K  + +I     +K  F
Sbjct: 101 IQTYGNITAVDALQKGLDDLIDLCDAVKDKF 131

>Kpol_165.2 s165 complement(2511..2897) [387 bp, 128 aa] {ON}
           complement(2511..2897) [387 nt, 129 aa]
          Length = 128

 Score = 51.6 bits (122), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 47/92 (51%), Gaps = 2/92 (2%)

Query: 16  ESKLQIEPDTKAPNTVVITFE--KEDHTLGNLIKSELLHDPKVLFAAYKVEHPLFARFKM 73
           E K++I P   + +    +F+   EDHTLGN ++  ++ +P+V F  Y + HP      +
Sbjct: 30  EDKIKILPQATSEDGTCASFQIMDEDHTLGNALRYIIMKNPEVEFCGYSIPHPSENLLNL 89

Query: 74  RIQTVEGYDPKDALRKACNSIIKKLGILKTNF 105
           RIQT       +AL+K    ++    +++  F
Sbjct: 90  RIQTYGSTTAVEALQKGLGDLMDMCDVVEEKF 121

>KAFR0B04570 Chr2 complement(949880..950275) [396 bp, 131 aa] {ON}
           Anc_2.163 YNL113W
          Length = 131

 Score = 50.1 bits (118), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 48/91 (52%), Gaps = 2/91 (2%)

Query: 17  SKLQIEPDTKAPNTVVITFE--KEDHTLGNLIKSELLHDPKVLFAAYKVEHPLFARFKMR 74
           +K++I P   + +    +F+  +EDHTLGN ++  ++ +P+V F  Y + HP      +R
Sbjct: 34  NKIKILPQATSEDGTSASFQIVEEDHTLGNALRYIIMKNPQVEFCGYSIPHPSENLLNIR 93

Query: 75  IQTVEGYDPKDALRKACNSIIKKLGILKTNF 105
           IQT       DAL+K    ++    +++  F
Sbjct: 94  IQTYGEITAVDALKKGLADLMDLCDVVEETF 124

>TBLA0B01290 Chr2 (274238..274546) [309 bp, 102 aa] {ON} Anc_2.163
           YNL113W
          Length = 102

 Score = 49.3 bits (116), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 24/86 (27%), Positives = 39/86 (45%)

Query: 20  QIEPDTKAPNTVVITFEKEDHTLGNLIKSELLHDPKVLFAAYKVEHPLFARFKMRIQTVE 79
           Q+ P T   +        EDHTLGN ++  L+ +P V F  Y + HP      +R+QT  
Sbjct: 10  QLPPVTPDGSAASFQIRDEDHTLGNALRYLLMRNPAVEFCGYSIPHPSEPFLNLRVQTYG 69

Query: 80  GYDPKDALRKACNSIIKKLGILKTNF 105
                DAL +    ++    +++  F
Sbjct: 70  DITASDALAQGLQDLMDLCDVVEDTF 95

>KNAG0I02060 Chr9 complement(401412..401816) [405 bp, 134 aa] {ON}
           Anc_2.163 YNL113W
          Length = 134

 Score = 49.3 bits (116), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 45/90 (50%), Gaps = 2/90 (2%)

Query: 18  KLQIEPDTKAPNTVVITFE--KEDHTLGNLIKSELLHDPKVLFAAYKVEHPLFARFKMRI 75
           K++I P+    +    +F+   EDHTLGN ++  ++ +P+V F  Y + HP      +RI
Sbjct: 38  KVKILPEATTEDGTCASFQILNEDHTLGNALRYVIMKNPEVEFCGYSIPHPSENWLNVRI 97

Query: 76  QTVEGYDPKDALRKACNSIIKKLGILKTNF 105
           QT       DA +K    ++    +++  F
Sbjct: 98  QTYGKITAVDAFKKGLGDLMDMCDVVEDVF 127

>YNL113W Chr14 (412771..413199) [429 bp, 142 aa] {ON}  RPC19RNA
           polymerase subunit AC19, common to RNA polymerases I and
           III
          Length = 142

 Score = 49.3 bits (116), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 50/102 (49%), Gaps = 8/102 (7%)

Query: 4   PDRFESFLLGEGESKLQIEPDTKAPNTVVITFEKEDHTLGNLIKSELLHDPKVLFAAYKV 63
           PDR +  LL +  S    E  T A   +V    +EDHTLGN ++  ++ +P V F  Y +
Sbjct: 42  PDREKIKLLTQATS----EDGTSASFQIV----EEDHTLGNALRYVIMKNPDVEFCGYSI 93

Query: 64  EHPLFARFKMRIQTVEGYDPKDALRKACNSIIKKLGILKTNF 105
            HP      +RIQT       DAL+K    ++    ++++ F
Sbjct: 94  PHPSENLLNIRIQTYGETTAVDALQKGLKDLMDLCDVVESKF 135

>Smik_14.214 Chr14 (392413..392841) [429 bp, 142 aa] {ON} YNL113W
           (REAL)
          Length = 142

 Score = 48.9 bits (115), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 50/102 (49%), Gaps = 8/102 (7%)

Query: 4   PDRFESFLLGEGESKLQIEPDTKAPNTVVITFEKEDHTLGNLIKSELLHDPKVLFAAYKV 63
           PDR +  LL +  S    E  T A   +V    +EDHTLGN ++  ++ +P V F  Y +
Sbjct: 42  PDREKIKLLTQATS----EDGTSASFQIV----EEDHTLGNALRYIIMKNPDVEFCGYSI 93

Query: 64  EHPLFARFKMRIQTVEGYDPKDALRKACNSIIKKLGILKTNF 105
            HP      +RIQT       DAL+K    ++    ++++ F
Sbjct: 94  PHPSENLLNIRIQTYGESTAVDALQKGLKDLMDLCDVVESKF 135

>Ecym_5423 Chr5 complement(871715..872098) [384 bp, 127 aa] {ON}
           similar to Ashbya gossypii AFL220C
          Length = 127

 Score = 48.5 bits (114), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 46/90 (51%), Gaps = 2/90 (2%)

Query: 18  KLQIEPDTKAPNTVVITFE--KEDHTLGNLIKSELLHDPKVLFAAYKVEHPLFARFKMRI 75
           K+++ P+  + +    +F+   EDHTLGN ++  ++ +P+V F  Y + HP      +RI
Sbjct: 31  KIRLLPEAASEDGTCASFQISDEDHTLGNALRYIIMKNPEVEFCGYSIPHPSETVLNLRI 90

Query: 76  QTVEGYDPKDALRKACNSIIKKLGILKTNF 105
           QT       +AL K    ++    +++  F
Sbjct: 91  QTYGKMTAVEALHKGLKDLMDLCDVVEDKF 120

>Suva_14.225 Chr14 (409562..409990) [429 bp, 142 aa] {ON} YNL113W
           (REAL)
          Length = 142

 Score = 48.5 bits (114), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 31/104 (29%), Positives = 52/104 (50%), Gaps = 8/104 (7%)

Query: 2   NAPDRFESFLLGEGESKLQIEPDTKAPNTVVITFEKEDHTLGNLIKSELLHDPKVLFAAY 61
           + PDR +  LL +  S    E  T A   +V    +EDHTLGN ++  ++ +P+V F  Y
Sbjct: 40  DEPDREKIKLLTQATS----EDGTSASFQIV----EEDHTLGNALRYIIMKNPEVEFCGY 91

Query: 62  KVEHPLFARFKMRIQTVEGYDPKDALRKACNSIIKKLGILKTNF 105
            + HP      +RIQT       +AL+K    ++    ++++ F
Sbjct: 92  SIPHPSENLLNVRIQTYGAITAVEALQKGLKDLMDLCDVVESKF 135

>Skud_14.218 Chr14 (402879..403349) [471 bp, 156 aa] {ON} YNL113W
           (REAL)
          Length = 156

 Score = 48.1 bits (113), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 32/104 (30%), Positives = 50/104 (48%), Gaps = 8/104 (7%)

Query: 2   NAPDRFESFLLGEGESKLQIEPDTKAPNTVVITFEKEDHTLGNLIKSELLHDPKVLFAAY 61
           + PDR +  LL +  S    E  T A   +V    +EDHTLGN ++  ++ +P V F  Y
Sbjct: 54  DEPDREKIKLLTQATS----EDGTNASFQIV----EEDHTLGNALRYIIMKNPDVEFCGY 105

Query: 62  KVEHPLFARFKMRIQTVEGYDPKDALRKACNSIIKKLGILKTNF 105
            + HP      +RIQT       DAL+K    ++    +++  F
Sbjct: 106 SIPHPSENLLNIRIQTYGEITAVDALQKGLKDLMDLCDVVEAKF 149

>AFL220C Chr6 complement(25281..25688) [408 bp, 135 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL113W
           (RPC19)
          Length = 135

 Score = 47.4 bits (111), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 44/90 (48%), Gaps = 2/90 (2%)

Query: 18  KLQIEPDTKAPNTVVITFE--KEDHTLGNLIKSELLHDPKVLFAAYKVEHPLFARFKMRI 75
           K+++ P   + +     F+   EDHTLGN ++  ++ +P+V F  Y + HP      +RI
Sbjct: 39  KIRLLPQATSEDGTCAFFQITDEDHTLGNALRYIIMKNPEVEFCGYSIPHPSENFLNIRI 98

Query: 76  QTVEGYDPKDALRKACNSIIKKLGILKTNF 105
           QT       DAL K    ++    +++  F
Sbjct: 99  QTYGKVTAVDALHKGLQDLMDMCDVVEDKF 128

>ZYRO0B09878g Chr2 complement(771644..772036) [393 bp, 130 aa] {ON}
           highly similar to uniprot|Q755Q7 Ashbya gossypii AFL220C
           AFL220Cp and similar to YNL113W uniprot|P28000
           Saccharomyces cerevisiae YNL113W RPC19 RNA polymerase
           subunit common to RNA polymerases I and III
          Length = 130

 Score = 47.0 bits (110), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 43/90 (47%), Gaps = 2/90 (2%)

Query: 18  KLQIEPDTKAPNTVVITFE--KEDHTLGNLIKSELLHDPKVLFAAYKVEHPLFARFKMRI 75
           K++I P   + +    +F+  +EDHTLGN ++  ++ +P V F  Y + HP      +R+
Sbjct: 34  KIKILPQATSEDGTCASFQIAEEDHTLGNALRYMIMKNPDVEFCGYSIPHPSENLLNIRV 93

Query: 76  QTVEGYDPKDALRKACNSIIKKLGILKTNF 105
           QT       D L K    ++     ++  F
Sbjct: 94  QTYGNVTAVDVLHKGLQDLMDLCDAVEDKF 123

>NCAS0G02550 Chr7 (456827..457279) [453 bp, 150 aa] {ON} Anc_2.163
           YNL113W
          Length = 150

 Score = 46.6 bits (109), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 31/102 (30%), Positives = 48/102 (47%), Gaps = 8/102 (7%)

Query: 4   PDRFESFLLGEGESKLQIEPDTKAPNTVVITFEKEDHTLGNLIKSELLHDPKVLFAAYKV 63
           PDR +  +L EG S    E  T A   +V     EDHTLGN ++  ++ +P V F  Y +
Sbjct: 50  PDREKVKILPEGAS----EDGTCASFQIV----DEDHTLGNALRYIIMKNPNVEFCGYSI 101

Query: 64  EHPLFARFKMRIQTVEGYDPKDALRKACNSIIKKLGILKTNF 105
            HP      +RIQT       +A +K    ++    +++  F
Sbjct: 102 PHPSENFLNVRIQTYGDITAVEAFQKGLQDLMDLCDVVEDKF 143

>SAKL0E10692g Chr5 complement(891637..892032) [396 bp, 131 aa] {ON}
           highly similar to uniprot|P28000 Saccharomyces
           cerevisiae YNL113W RPC19 RNA polymerase subunit common
           to RNA polymerases I and III
          Length = 131

 Score = 45.4 bits (106), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 46/90 (51%), Gaps = 2/90 (2%)

Query: 18  KLQIEPDTKAPNTVVITFE--KEDHTLGNLIKSELLHDPKVLFAAYKVEHPLFARFKMRI 75
           K+++ P   + +    +F+  +EDHTLGN ++  ++ +P+V F  Y + HP      +RI
Sbjct: 35  KIKLLPQATSDDGTSASFQISEEDHTLGNALRYIIMKNPEVEFCGYSIPHPSENLLNVRI 94

Query: 76  QTVEGYDPKDALRKACNSIIKKLGILKTNF 105
           QT       +AL+K    ++     ++  F
Sbjct: 95  QTYGKITAVEALQKGLQDLMDMCDAVEDKF 124

>NDAI0F02750 Chr6 complement(673843..674292) [450 bp, 149 aa] {ON}
           Anc_2.163 YNL113W
          Length = 149

 Score = 45.1 bits (105), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 36/69 (52%)

Query: 37  KEDHTLGNLIKSELLHDPKVLFAAYKVEHPLFARFKMRIQTVEGYDPKDALRKACNSIIK 96
           +EDHTLGN ++  ++ +P+V F  Y + HP      +RIQT       +AL K    ++ 
Sbjct: 74  QEDHTLGNALRYIIMKNPQVEFCGYSIPHPSEEFLNIRIQTYGEITAVEALHKGLQDLMD 133

Query: 97  KLGILKTNF 105
              +++  F
Sbjct: 134 LCDVVEEKF 142

>KLLA0F23760g Chr6 complement(2218555..2218938) [384 bp, 127 aa]
           {ON} similar to uniprot|P28000 Saccharomyces cerevisiae
           YNL113W RPC19 RNA polymerase subunit common to RNA
           polymerases I and III
          Length = 127

 Score = 44.3 bits (103), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 40/88 (45%)

Query: 18  KLQIEPDTKAPNTVVITFEKEDHTLGNLIKSELLHDPKVLFAAYKVEHPLFARFKMRIQT 77
           KL  E  ++   +       EDHTLGN ++  ++ +P+V F  Y + HP      +RIQT
Sbjct: 33  KLLTEATSEDGTSASFRITDEDHTLGNTLRYMIMKNPEVEFCGYSIPHPSENFLHIRIQT 92

Query: 78  VEGYDPKDALRKACNSIIKKLGILKTNF 105
                  +AL K    ++     ++  F
Sbjct: 93  YGKITAVEALHKGLGDLMDMCDAVEDRF 120

>KLTH0D09350g Chr4 complement(776115..776555) [441 bp, 146 aa] {ON}
           some similarities with uniprot|P28000 Saccharomyces
           cerevisiae YNL113W RPC19 RNA polymerase subunit common
           to RNA polymerases I and III
          Length = 146

 Score = 44.3 bits (103), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 20/71 (28%), Positives = 35/71 (49%)

Query: 35  FEKEDHTLGNLIKSELLHDPKVLFAAYKVEHPLFARFKMRIQTVEGYDPKDALRKACNSI 94
             +EDHTLGN ++  ++ +P V F  Y + HP      +RIQT   +   + L+K    +
Sbjct: 69  ISEEDHTLGNALRYIIMKNPDVEFCGYSIPHPSETLLNLRIQTYGKFTAVEVLQKGLQDL 128

Query: 95  IKKLGILKTNF 105
           +     ++  F
Sbjct: 129 MDLCDAVEDKF 139

>TDEL0F01180 Chr6 (211106..211495) [390 bp, 129 aa] {ON} Anc_2.163
           YNL113W
          Length = 129

 Score = 43.5 bits (101), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 23/90 (25%), Positives = 43/90 (47%), Gaps = 2/90 (2%)

Query: 18  KLQIEPDTKAPNTVVITFE--KEDHTLGNLIKSELLHDPKVLFAAYKVEHPLFARFKMRI 75
           K+++ P   + +    +F+  +EDHTLGN ++  ++ +  V F  Y + HP      +RI
Sbjct: 33  KIKLLPQASSEDGTCASFQIAEEDHTLGNALRYVIMKNKDVEFCGYSIPHPSENLLNLRI 92

Query: 76  QTVEGYDPKDALRKACNSIIKKLGILKTNF 105
           QT       D L+K    ++     ++  F
Sbjct: 93  QTYGATTAVDVLQKGLTDLMDLCDAVEDRF 122

>Kwal_26.8473 s26 complement(800017..800469) [453 bp, 150 aa] {ON}
           YNL113W (RPC19) - subunit common to RNA polymerases I
           (A) and III (C) [contig 61] FULL
          Length = 150

 Score = 42.7 bits (99), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 20/71 (28%), Positives = 35/71 (49%)

Query: 35  FEKEDHTLGNLIKSELLHDPKVLFAAYKVEHPLFARFKMRIQTVEGYDPKDALRKACNSI 94
             +EDHTLGN ++  ++ +P V F  Y + HP      +RIQT   +   + L+K    +
Sbjct: 73  ISEEDHTLGNSLRYIIMKNPDVEFCGYSIPHPSENLLNLRIQTYGKHTALEVLQKGLQDL 132

Query: 95  IKKLGILKTNF 105
           +     ++  F
Sbjct: 133 MDLCDAVEDKF 143

>NCAS0C05860 Chr3 complement(1204693..1210299) [5607 bp, 1868 aa]
           {ON} Anc_4.15 YHL030W
          Length = 1868

 Score = 32.7 bits (73), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 35/111 (31%), Positives = 52/111 (46%), Gaps = 6/111 (5%)

Query: 11  LLGEGESKLQIEPDTKAPNTVVITFEKEDHTLGNLIKSE--LLHDPKVLFAAYKVEHPLF 68
           L  EG  KLQ+   T A NT ++    +  TLG+++  E  L+ D   +   +       
Sbjct: 391 LHAEGWPKLQLGESTPAFNTTILQRRLQYETLGDILMKEFSLVEDLSFIEFLFDSLQGDL 450

Query: 69  ARFKMRIQ-TVEGYDPKDALRKACNSIIKKL-GILKTNFETEWNLQTLASD 117
           + F+  IQ  +    P   LRK  +S   KL GILK     ++NLQ  +SD
Sbjct: 451 SEFRASIQEALISLTPH--LRKLPSSSKDKLKGILKNLLSDDFNLQEASSD 499

>YHL030W Chr8 (40084..45690) [5607 bp, 1868 aa] {ON}  ECM29Scaffold
           protein that assists in association of the proteasome
           core particle with the regulatory particle; degraded by
           the mature proteasome after assembly; contains HEAT-like
           repeats
          Length = 1868

 Score = 32.3 bits (72), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 39/71 (54%), Gaps = 8/71 (11%)

Query: 11  LLGEGESKLQIEPDTKAPNTVVITFEKEDHTLGNLIKS--ELLHD---PKVLFAAYKVEH 65
           L  EG  KLQ+ P T A NT ++  + +  TLG+++K   EL+ D    + LF + K + 
Sbjct: 397 LHAEGWPKLQLGPQTPAFNTAILQRQLQYETLGDILKRDFELVSDLSYIEFLFESLKNDL 456

Query: 66  PLFARFKMRIQ 76
           P   +F+  IQ
Sbjct: 457 P---QFRSSIQ 464

>Suva_6.5 Chr6 complement(12340..13668) [1329 bp, 442 aa] {ON}
           YFL048C (REAL)
          Length = 442

 Score = 31.2 bits (69), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 24/86 (27%), Positives = 43/86 (50%), Gaps = 15/86 (17%)

Query: 2   NAPDR-FESFLLGEGESKLQIEPDTKAPNTVVITFEKEDHTLGNLIKSELLHDPKVLFAA 60
           N  DR F S L+G          D+  P+T+ +T++ ED+   NL+K ++  D ++ F  
Sbjct: 167 NIYDRSFASCLMGY--------QDSSVPSTIRMTYDMEDN---NLLKVQV--DNRICFQT 213

Query: 61  YKVEHPLFARFKMRIQTVEGYDPKDA 86
            K+  P    +++ +  V G   K+A
Sbjct: 214 RKISFPT-GSYRIGVSAVNGEVNKNA 238

>Smik_8.11 Chr8 (23753..29362) [5610 bp, 1869 aa] {ON} YHL030W
           (REAL)
          Length = 1869

 Score = 30.4 bits (67), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 23/37 (62%)

Query: 11  LLGEGESKLQIEPDTKAPNTVVITFEKEDHTLGNLIK 47
           L  EG  KLQ+ P T A NT ++  + +  TLG+++K
Sbjct: 398 LHAEGWPKLQLGPQTPAFNTAILQRQLQYETLGDILK 434

>Smik_6.28 Chr6 complement(54289..55623) [1335 bp, 444 aa] {ON}
           YFL048C (REAL)
          Length = 444

 Score = 28.9 bits (63), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 26/43 (60%), Gaps = 5/43 (11%)

Query: 24  DTKAPNTVVITFEKEDHTLGNLIKSELLHDPKVLFAAYKVEHP 66
           D+  P+T+ +T++ ED+   NL+K ++  D +V F   KV  P
Sbjct: 184 DSSVPSTIRVTYDMEDN---NLLKVQV--DNRVCFQTRKVRFP 221

>Suva_8.21 Chr8 (41705..47311) [5607 bp, 1868 aa] {ON} YHL030W
           (REAL)
          Length = 1868

 Score = 28.9 bits (63), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 32/63 (50%), Gaps = 5/63 (7%)

Query: 11  LLGEGESKLQIEPDTKAPNTVVITFEKEDHTLGNLIKSEL-----LHDPKVLFAAYKVEH 65
           L  EG  KLQ+ P T A NT +   + +  TLG+++K +      L   + LF + + + 
Sbjct: 397 LHAEGWPKLQLGPQTPAFNTAISQRQLQYETLGDILKRDFDLVSDLSYIEFLFESLQSDL 456

Query: 66  PLF 68
           P F
Sbjct: 457 PQF 459

>Suva_4.191 Chr4 (335199..340547) [5349 bp, 1782 aa] {ON} YDL058W
           (REAL)
          Length = 1782

 Score = 28.9 bits (63), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 31/66 (46%), Gaps = 14/66 (21%)

Query: 54  PKVLFAAYKVEHPLFARFKMRIQTVEGYDPKDA------------LRKACNSIIKKLGIL 101
           PKV F+AY +   LF     RI+T   ++P +             L+K C  +  +LG L
Sbjct: 690 PKVYFSAYFI--HLFNENMYRIRTALSHNPDEEPISKISFEEVEELQKQCAKLKSELGSL 747

Query: 102 KTNFET 107
           +T  +T
Sbjct: 748 QTETKT 753

>YFL048C Chr6 complement(38843..40180) [1338 bp, 445 aa] {ON}
           EMP47Integral membrane component of endoplasmic
           reticulum-derived COPII-coated vesicles, which function
           in ER to Golgi transport
          Length = 445

 Score = 28.5 bits (62), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 25/43 (58%), Gaps = 5/43 (11%)

Query: 24  DTKAPNTVVITFEKEDHTLGNLIKSELLHDPKVLFAAYKVEHP 66
           D+  P+T+ +T++ ED    NL+K ++  D KV F   KV  P
Sbjct: 185 DSSVPSTIRVTYDLEDD---NLLKVQV--DNKVCFQTRKVRFP 222

>Ecym_4720 Chr4 complement(1412286..1413065,1413130..1413135) [786
           bp, 261 aa] {ON} similar to Ashbya gossypii ACL145W
           1-intron
          Length = 261

 Score = 28.1 bits (61), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 23/43 (53%)

Query: 15  GESKLQIEPDTKAPNTVVITFEKEDHTLGNLIKSELLHDPKVL 57
           G  ++ ++P TK        +E +DHTL  LIK + L  P +L
Sbjct: 94  GFYEVDVKPSTKEVRASYPIYELDDHTLVVLIKEDELQHPPIL 136

>TDEL0D03400 Chr4 (632541..633026) [486 bp, 161 aa] {ON} Anc_3.286
          Length = 161

 Score = 27.7 bits (60), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 26/99 (26%), Positives = 39/99 (39%), Gaps = 26/99 (26%)

Query: 16  ESKLQIEPDTKAPNTVVITFEKEDHTLGNLIKSELLHDPKVLFAAYKVEHPLFARFKMRI 75
            S L   P+T+ PN + ++   E+     LI S               + PL   F MR 
Sbjct: 29  SSGLGKGPETREPNQMFLSIRNENEMTDTLIASS--------------KTPLIMNFTMRN 74

Query: 76  QTVEGYDPKDALRKACNSII-----KKLGILKTNFETEW 109
                  P D L  A N I+     KK+ ++  + ET+W
Sbjct: 75  NA-----PCDKLTGALNRIVTLETDKKVNVV--DVETDW 106

>AGR316C Chr7 complement(1323148..1325289) [2142 bp, 713 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL012C
           (VTC4)
          Length = 713

 Score = 27.7 bits (60), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 20/80 (25%), Positives = 41/80 (51%), Gaps = 1/80 (1%)

Query: 15  GESKLQIEPDTKAPNTVVITFEKEDHTLGNLIKSELLHD-PKVLFAAYKVEHPLFARFKM 73
           G+++++I  DT+        F+  D T GN  + ++  D P      + VE+  +A  ++
Sbjct: 368 GDARVRISLDTELTMVREDDFDGYDRTNGNWRRMDIGVDWPFKQLPEHDVEYFPYAVLEV 427

Query: 74  RIQTVEGYDPKDALRKACNS 93
           ++QT  G +P + +R+   S
Sbjct: 428 KLQTQLGQEPPEWVRELVGS 447

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.135    0.390 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 12,753,518
Number of extensions: 475958
Number of successful extensions: 1231
Number of sequences better than 10.0: 55
Number of HSP's gapped: 1230
Number of HSP's successfully gapped: 55
Length of query: 118
Length of database: 53,481,399
Length adjustment: 87
Effective length of query: 31
Effective length of database: 43,505,457
Effective search space: 1348669167
Effective search space used: 1348669167
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 59 (27.3 bits)