Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0E030606.27ON31931916160.0
KNAG0M012406.27ON31431810021e-136
CAGL0E02519g6.27ON3153059881e-134
NCAS0H015106.27ON3133079441e-127
NDAI0F017406.27ON3133159401e-127
Kwal_56.224546.27ON3152989321e-125
ZYRO0C07612g6.27ON3192919261e-125
Kpol_1032.96.27ON3182819251e-124
SAKL0E01474g6.27ON3113179221e-124
KLLA0D01331g6.27ON3083099211e-124
TDEL0G044206.27ON3222909091e-122
KAFR0G026506.27ON3213049091e-122
Smik_15.1686.27ON3273178991e-120
KLTH0C11044g6.27ON3152968941e-120
YOL002C (IZH2)6.27ON3173178941e-120
Skud_15.1606.27ON3273178951e-120
Ecym_30316.27ON3283218731e-116
Suva_15.1736.27ON3273208651e-115
ACL002C6.27ON3292728631e-115
TPHA0M002906.27ON3272918601e-114
SAKL0C09218g3.90ON3143136941e-89
Skud_4.7663.90ON3163126897e-89
CAGL0G04631g3.90ON3163126853e-88
KLTH0C09504g3.90ON3192966845e-88
YDR492W (IZH1)3.90ON3163126811e-87
TDEL0D053403.90ON3163136802e-87
Smik_4.7693.90ON3162846802e-87
TPHA0A006403.90ON3273136794e-87
Suva_2.6683.90ON3153156714e-86
Kwal_56.227043.90ON3203116699e-86
AFR337W3.90ON3173006611e-84
NCAS0I025703.90ON3143126583e-84
NDAI0A071603.90ON3302956569e-84
ZYRO0B06556g3.90ON3183226532e-83
KLLA0C12441g3.90ON3152816523e-83
Kpol_1053.263.90ON3242796403e-81
TBLA0B022903.90ON3263156142e-77
KAFR0A081303.90ON3193146053e-76
KNAG0K021603.90ON3233226054e-76
Ecym_35883.90ON3052715811e-72
TBLA0B082553.90ON2962843685e-41
NCAS0C049203.90ON3263183356e-36
NDAI0G043003.90ON3182973068e-32
CAGL0I07491g3.90ON3012882551e-24
Smik_15.563.90ON3122431944e-16
Suva_15.643.90ON3122991901e-15
Skud_15.533.90ON3123161776e-14
YOL101C (IZH4)3.90ON3122431761e-13
KAFR0J006705.197ON5092371621e-11
Smik_12.865.197ON5422371612e-11
TPHA0E031205.197ON5692431568e-11
NDAI0I023305.197ON5782801532e-10
Kpol_2002.945.197ON5772361495e-10
Skud_12.915.197ON5422361496e-10
NCAS0D026005.197ON5432831496e-10
KLLA0F15510g5.197ON6222811462e-09
YLR023C (IZH3)5.197ON5432361442e-09
Ecym_71095.197ON5682431381e-08
TBLA0C060505.197ON4373381352e-08
KNAG0B051005.197ON5382721353e-08
ZYRO0B10538g5.197ON5312401335e-08
Suva_10.1045.197ON5412371301e-07
KLTH0B03498g5.197ON5462421202e-06
AAL153C5.197ON4192721192e-06
TDEL0E043205.197ON4502561192e-06
Kwal_33.151225.197ON5662851175e-06
CAGL0D03322g5.197ON5452431141e-05
SAKL0G12980g5.197ON5632511141e-05
KNAG0K006703.90ON321224920.005
SAKL0B07656g3.354ON30838675.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0E03060
         (319 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0E03060 Chr5 (769031..769990) [960 bp, 319 aa] {ON} Anc_6.27...   627   0.0  
KNAG0M01240 Chr13 (226766..227710) [945 bp, 314 aa] {ON} Anc_6.2...   390   e-136
CAGL0E02519g Chr5 complement(242867..243814) [948 bp, 315 aa] {O...   385   e-134
NCAS0H01510 Chr8 complement(287981..288922) [942 bp, 313 aa] {ON...   368   e-127
NDAI0F01740 Chr6 (429141..430082) [942 bp, 313 aa] {ON} Anc_6.27      366   e-127
Kwal_56.22454 s56 (136175..137122) [948 bp, 315 aa] {ON} YOL002C...   363   e-125
ZYRO0C07612g Chr3 complement(578864..579823) [960 bp, 319 aa] {O...   361   e-125
Kpol_1032.9 s1032 (22700..23656) [957 bp, 318 aa] {ON} (22700..2...   360   e-124
SAKL0E01474g Chr5 (112382..113317) [936 bp, 311 aa] {ON} similar...   359   e-124
KLLA0D01331g Chr4 (117469..118395) [927 bp, 308 aa] {ON} similar...   359   e-124
TDEL0G04420 Chr7 complement(802412..803380) [969 bp, 322 aa] {ON...   354   e-122
KAFR0G02650 Chr7 complement(547561..548526) [966 bp, 321 aa] {ON...   354   e-122
Smik_15.168 Chr15 complement(290724..291707) [984 bp, 327 aa] {O...   350   e-120
KLTH0C11044g Chr3 complement(908604..909551) [948 bp, 315 aa] {O...   348   e-120
YOL002C Chr15 complement(323411..324364) [954 bp, 317 aa] {ON}  ...   348   e-120
Skud_15.160 Chr15 complement(283003..283986) [984 bp, 327 aa] {O...   349   e-120
Ecym_3031 Chr3 (61592..62578) [987 bp, 328 aa] {ON} similar to A...   340   e-116
Suva_15.173 Chr15 complement(297915..298898) [984 bp, 327 aa] {O...   337   e-115
ACL002C Chr3 complement(353449..354438) [990 bp, 329 aa] {ON} Sy...   337   e-115
TPHA0M00290 Chr13 (57784..58767) [984 bp, 327 aa] {ON} Anc_6.27 ...   335   e-114
SAKL0C09218g Chr3 (839747..840691) [945 bp, 314 aa] {ON} similar...   271   1e-89
Skud_4.766 Chr4 (1354630..1355580) [951 bp, 316 aa] {ON} YDR492W...   270   7e-89
CAGL0G04631g Chr7 (441149..442099) [951 bp, 316 aa] {ON} similar...   268   3e-88
KLTH0C09504g Chr3 complement(788442..789401) [960 bp, 319 aa] {O...   268   5e-88
YDR492W Chr4 (1434924..1435874) [951 bp, 316 aa] {ON}  IZH1Membr...   266   1e-87
TDEL0D05340 Chr4 (969608..970558) [951 bp, 316 aa] {ON} Anc_3.90...   266   2e-87
Smik_4.769 Chr4 (1356263..1357213) [951 bp, 316 aa] {ON} YDR492W...   266   2e-87
TPHA0A00640 Chr1 complement(115042..116025) [984 bp, 327 aa] {ON...   266   4e-87
Suva_2.668 Chr2 (1186763..1187710) [948 bp, 315 aa] {ON} YDR492W...   263   4e-86
Kwal_56.22704 s56 (244431..245393) [963 bp, 320 aa] {ON} YDR492W...   262   9e-86
AFR337W Chr6 (1051645..1052598) [954 bp, 317 aa] {ON} Syntenic h...   259   1e-84
NCAS0I02570 Chr9 complement(480266..481210) [945 bp, 314 aa] {ON...   258   3e-84
NDAI0A07160 Chr1 complement(1630482..1631474) [993 bp, 330 aa] {...   257   9e-84
ZYRO0B06556g Chr2 (526478..527434) [957 bp, 318 aa] {ON} similar...   256   2e-83
KLLA0C12441g Chr3 complement(1057427..1058374) [948 bp, 315 aa] ...   255   3e-83
Kpol_1053.26 s1053 complement(40099..41073) [975 bp, 324 aa] {ON...   251   3e-81
TBLA0B02290 Chr2 complement(534472..535452) [981 bp, 326 aa] {ON...   241   2e-77
KAFR0A08130 Chr1 (1638153..1639112) [960 bp, 319 aa] {ON} Anc_3....   237   3e-76
KNAG0K02160 Chr11 (436744..437715) [972 bp, 323 aa] {ON} Anc_3.9...   237   4e-76
Ecym_3588 Chr3 (1117646..1118563) [918 bp, 305 aa] {ON} similar ...   228   1e-72
TBLA0B08255 Chr2 (1973757..1974647) [891 bp, 296 aa] {ON}             146   5e-41
NCAS0C04920 Chr3 complement(1003692..1004672) [981 bp, 326 aa] {...   133   6e-36
NDAI0G04300 Chr7 (1035664..1036620) [957 bp, 318 aa] {ON} Anc_3.90    122   8e-32
CAGL0I07491g Chr9 complement(719539..720444) [906 bp, 301 aa] {O...   102   1e-24
Smik_15.56 Chr15 complement(90083..91021) [939 bp, 312 aa] {ON} ...    79   4e-16
Suva_15.64 Chr15 complement(100035..100973) [939 bp, 312 aa] {ON...    78   1e-15
Skud_15.53 Chr15 complement(86339..87277) [939 bp, 312 aa] {ON} ...    73   6e-14
YOL101C Chr15 complement(126982..127920) [939 bp, 312 aa] {ON}  ...    72   1e-13
KAFR0J00670 Chr10 (120378..121907) [1530 bp, 509 aa] {ON} Anc_5....    67   1e-11
Smik_12.86 Chr12 complement(172288..173916) [1629 bp, 542 aa] {O...    67   2e-11
TPHA0E03120 Chr5 complement(654079..655788) [1710 bp, 569 aa] {O...    65   8e-11
NDAI0I02330 Chr9 (532412..534148) [1737 bp, 578 aa] {ON} Anc_5.197     64   2e-10
Kpol_2002.94 s2002 (229517..231250) [1734 bp, 577 aa] {ON} (2295...    62   5e-10
Skud_12.91 Chr12 complement(177334..178962) [1629 bp, 542 aa] {O...    62   6e-10
NCAS0D02600 Chr4 (499689..501320) [1632 bp, 543 aa] {ON} Anc_5.1...    62   6e-10
KLLA0F15510g Chr6 (1433494..1435362) [1869 bp, 622 aa] {ON} some...    61   2e-09
YLR023C Chr12 complement(185498..187129) [1632 bp, 543 aa] {ON} ...    60   2e-09
Ecym_7109 Chr7 complement(210829..212535) [1707 bp, 568 aa] {ON}...    58   1e-08
TBLA0C06050 Chr3 (1468152..1469465) [1314 bp, 437 aa] {ON} Anc_5...    57   2e-08
KNAG0B05100 Chr2 (976101..977717) [1617 bp, 538 aa] {ON} Anc_5.1...    57   3e-08
ZYRO0B10538g Chr2 complement(830311..831906) [1596 bp, 531 aa] {...    56   5e-08
Suva_10.104 Chr10 complement(191663..193288) [1626 bp, 541 aa] {...    55   1e-07
KLTH0B03498g Chr2 complement(281148..282788) [1641 bp, 546 aa] {...    51   2e-06
AAL153C Chr1 complement(75086..76345) [1260 bp, 419 aa] {ON} Syn...    50   2e-06
TDEL0E04320 Chr5 complement(804655..806007) [1353 bp, 450 aa] {O...    50   2e-06
Kwal_33.15122 s33 (968885..970585) [1701 bp, 566 aa] {ON} YLR023...    50   5e-06
CAGL0D03322g Chr4 complement(340949..342586) [1638 bp, 545 aa] {...    49   1e-05
SAKL0G12980g Chr7 complement(1108751..1110442) [1692 bp, 563 aa]...    49   1e-05
KNAG0K00670 Chr11 complement(119419..120384) [966 bp, 321 aa] {O...    40   0.005
SAKL0B07656g Chr2 (655693..656619) [927 bp, 308 aa] {ON} similar...    30   5.3  

>TBLA0E03060 Chr5 (769031..769990) [960 bp, 319 aa] {ON} Anc_6.27
           YOL002C
          Length = 319

 Score =  627 bits (1616), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/319 (95%), Positives = 304/319 (95%)

Query: 1   MVTEVQRRKLTSSTEEGVELLYGDNQQQLNTSGSSGKRLYTWDEIPVWQHDNEYIYTGYV 60
           MVTEVQRRKLTSSTEEGVELLYGDNQQQLNTSGSSGKRLYTWDEIPVWQHDNEYIYTGYV
Sbjct: 1   MVTEVQRRKLTSSTEEGVELLYGDNQQQLNTSGSSGKRLYTWDEIPVWQHDNEYIYTGYV 60

Query: 61  RETNSMKESFLSLFYIHNESVNIYTHLIPAFCFLSMLLFNTYGVKPHPTTTYGDYVAIDL 120
           RETNSMKESFLSLFYIHNESVNIYTHLIPAFCFLSMLLFNTYGVKPHPTTTYGDYVAIDL
Sbjct: 61  RETNSMKESFLSLFYIHNESVNIYTHLIPAFCFLSMLLFNTYGVKPHPTTTYGDYVAIDL 120

Query: 121 FFIGAFTCLGLSSTFHCFKSHSLKISVFGNKLDYXXXXXXXXXXXXXXXYFGYHDDPFIF 180
           FFIGAFTCLGLSSTFHCFKSHSLKISVFGNKLDY               YFGYHDDPFIF
Sbjct: 121 FFIGAFTCLGLSSTFHCFKSHSLKISVFGNKLDYLGIVILISTSLISVLYFGYHDDPFIF 180

Query: 181 YIFSGITLCFGIACGIASLKDKFRTREWRPYRAALFVLFGLSGVLPIIAGIMKYGIREVF 240
           YIFSGITLCFGIACGIASLKDKFRTREWRPYRAALFVLFGLSGVLPIIAGIMKYGIREVF
Sbjct: 181 YIFSGITLCFGIACGIASLKDKFRTREWRPYRAALFVLFGLSGVLPIIAGIMKYGIREVF 240

Query: 241 ERVQLKWIIWEGVLYIFGAFLYGARFPEKFMPGKVDIWGQSHQIFHVLVVIAALCHLRGL 300
           ERVQLKWIIWEGVLYIFGAFLYGARFPEKFMPGKVDIWGQSHQIFHVLVVIAALCHLRGL
Sbjct: 241 ERVQLKWIIWEGVLYIFGAFLYGARFPEKFMPGKVDIWGQSHQIFHVLVVIAALCHLRGL 300

Query: 301 IGSYELVHQKLDAQLQSIT 319
           IGSYELVHQKLDAQLQSIT
Sbjct: 301 IGSYELVHQKLDAQLQSIT 319

>KNAG0M01240 Chr13 (226766..227710) [945 bp, 314 aa] {ON} Anc_6.27
           YOL002C
          Length = 314

 Score =  390 bits (1002), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 186/318 (58%), Positives = 231/318 (72%), Gaps = 5/318 (1%)

Query: 1   MVTEVQRRKLTSSTEEGVELLYGDNQQQLNTSGSS-GKRLYTWDEIPVWQHDNEYIYTGY 59
           M + VQR+ +T +      ++Y D+  ++ T+     KR+YTW+EIP WQ DNE+I  GY
Sbjct: 1   MSSRVQRQTVTITEP----VVYEDDGGEMKTATKKITKRIYTWNEIPEWQKDNEHIIDGY 56

Query: 60  VRETNSMKESFLSLFYIHNESVNIYTHLIPAFCFLSMLLFNTYGVKPHPTTTYGDYVAID 119
           VRETNS  +   SLFY+HNESVN+Y+HLIPA CF S+L  N Y VK   TT+  DY+ ID
Sbjct: 57  VRETNSFLKCVHSLFYLHNESVNVYSHLIPALCFFSVLFLNKYCVKSFETTSLVDYLFID 116

Query: 120 LFFIGAFTCLGLSSTFHCFKSHSLKISVFGNKLDYXXXXXXXXXXXXXXXYFGYHDDPFI 179
           LFF+GAFTCL LSSTFHCFKSHSLK++ FGNKLDY               Y+G++D   +
Sbjct: 117 LFFLGAFTCLILSSTFHCFKSHSLKVATFGNKLDYLGIVVLIVTSMISILYYGFYDSSVM 176

Query: 180 FYIFSGITLCFGIACGIASLKDKFRTREWRPYRAALFVLFGLSGVLPIIAGIMKYGIREV 239
           FY FS +TL FG ACG+ SLKD FR+REWRPYRA LFV FGLS +LPI++G+  YGI E 
Sbjct: 177 FYFFSFVTLSFGTACGVVSLKDHFRSREWRPYRAGLFVAFGLSAILPILSGMFAYGIEEA 236

Query: 240 FERVQLKWIIWEGVLYIFGAFLYGARFPEKFMPGKVDIWGQSHQIFHVLVVIAALCHLRG 299
           F R+Q+KWII EGV YI GAFLYG RFPEK  PGK DIWG SHQ+FH+LVV+AALCHL+G
Sbjct: 237 FHRIQIKWIILEGVFYILGAFLYGIRFPEKGSPGKYDIWGHSHQVFHILVVVAALCHLKG 296

Query: 300 LIGSYELVHQKLDAQLQS 317
           L+ SYELVH+ L +  ++
Sbjct: 297 LMVSYELVHKGLSSATKA 314

>CAGL0E02519g Chr5 complement(242867..243814) [948 bp, 315 aa] {ON}
           similar to uniprot|Q12442 Saccharomyces cerevisiae
           YOL002c
          Length = 315

 Score =  385 bits (988), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 183/305 (60%), Positives = 225/305 (73%), Gaps = 1/305 (0%)

Query: 6   QRRKLTSSTEEGVELLYGDNQQQLNTSGSSGKRLYTWDEIPVWQHDNEYIYTGYVRETNS 65
           QR+  T  T E   L+  D Q +L    +  ++LYTW+EIP WQ DNE+I+TGYVRET+S
Sbjct: 6   QRKVATMVTTEEQPLIGTDGQIKLRKK-TVVRKLYTWEEIPEWQKDNEHIHTGYVRETSS 64

Query: 66  MKESFLSLFYIHNESVNIYTHLIPAFCFLSMLLFNTYGVKPHPTTTYGDYVAIDLFFIGA 125
           + E   SLFY+HNE+VNIY+HLIPA  F S + FN Y V  + TTT  DY+ ID+FF+GA
Sbjct: 65  VMECIRSLFYLHNETVNIYSHLIPAIAFFSTIFFNKYVVPTYSTTTLIDYLIIDIFFLGA 124

Query: 126 FTCLGLSSTFHCFKSHSLKISVFGNKLDYXXXXXXXXXXXXXXXYFGYHDDPFIFYIFSG 185
           F+CL LSSTFHC KSHSL+++VFGNKLDY               Y+G+H +P+ F IFS 
Sbjct: 125 FSCLILSSTFHCLKSHSLRVAVFGNKLDYLGIVFLIVASMVSILYYGFHGNPWFFGIFSL 184

Query: 186 ITLCFGIACGIASLKDKFRTREWRPYRAALFVLFGLSGVLPIIAGIMKYGIREVFERVQL 245
           IT+ FG AC + SLKD FR+REWRPYRAALFV+FGLS VLPI+AG+ KYG  E + R+QL
Sbjct: 185 ITMTFGAACAVVSLKDTFRSREWRPYRAALFVIFGLSAVLPILAGLFKYGPTETWTRIQL 244

Query: 246 KWIIWEGVLYIFGAFLYGARFPEKFMPGKVDIWGQSHQIFHVLVVIAALCHLRGLIGSYE 305
           KW+I EGV YIFGAFLYG RFPEK  PG  D+WG SHQIFH+LVV+AALCHL+ L+GSY 
Sbjct: 245 KWVILEGVFYIFGAFLYGIRFPEKMSPGSFDLWGHSHQIFHILVVVAALCHLKALLGSYS 304

Query: 306 LVHQK 310
           LVH +
Sbjct: 305 LVHYR 309

>NCAS0H01510 Chr8 complement(287981..288922) [942 bp, 313 aa] {ON}
           Anc_6.27
          Length = 313

 Score =  368 bits (944), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 179/307 (58%), Positives = 220/307 (71%), Gaps = 1/307 (0%)

Query: 6   QRRKLTSSTEEGVELLYGDNQQQLNTSGSSG-KRLYTWDEIPVWQHDNEYIYTGYVRETN 64
           QR  LTS++      +  DN    +T  ++  ++LYTWDEIP WQ DNE+I  GYVRETN
Sbjct: 7   QRVALTSTSTSTKTTIDDDNVSIKHTKKTTTIRKLYTWDEIPEWQKDNEHIIAGYVRETN 66

Query: 65  SMKESFLSLFYIHNESVNIYTHLIPAFCFLSMLLFNTYGVKPHPTTTYGDYVAIDLFFIG 124
           S +  F SLFYIHNE+ N+Y+HL+P   F   +LF+ Y +    TTT+ DY+ I+LFF+G
Sbjct: 67  SFRRCFDSLFYIHNETGNVYSHLVPGVVFFLTMLFDKYAIVSFETTTFTDYLIINLFFLG 126

Query: 125 AFTCLGLSSTFHCFKSHSLKISVFGNKLDYXXXXXXXXXXXXXXXYFGYHDDPFIFYIFS 184
           AFTCL LSSTFHCFKSHSLKI+ FGNKLDY               ++G++D+   FY FS
Sbjct: 127 AFTCLILSSTFHCFKSHSLKIATFGNKLDYLGIVVLIVTSMISILFYGFYDNGPFFYGFS 186

Query: 185 GITLCFGIACGIASLKDKFRTREWRPYRAALFVLFGLSGVLPIIAGIMKYGIREVFERVQ 244
            +TL FG AC I SLKDKFR+REWRPYRA LFV FGLS VLPI+ G+M YG  E + R+Q
Sbjct: 187 LLTLSFGSACAIVSLKDKFRSREWRPYRAGLFVAFGLSAVLPILTGVMYYGPHETWTRIQ 246

Query: 245 LKWIIWEGVLYIFGAFLYGARFPEKFMPGKVDIWGQSHQIFHVLVVIAALCHLRGLIGSY 304
           LKW++ EGV YIFGAFLYG RFPEK++ G  DIWG SHQIFH+LVV+AA CHL+ L+GSY
Sbjct: 247 LKWVVLEGVFYIFGAFLYGIRFPEKYVNGTFDIWGHSHQIFHLLVVVAAFCHLKALLGSY 306

Query: 305 ELVHQKL 311
           ELVH  L
Sbjct: 307 ELVHMNL 313

>NDAI0F01740 Chr6 (429141..430082) [942 bp, 313 aa] {ON} Anc_6.27
          Length = 313

 Score =  366 bits (940), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 180/315 (57%), Positives = 216/315 (68%), Gaps = 6/315 (1%)

Query: 1   MVTEVQRRKLTSSTE--EGV--ELLYGDNQQQLNTSGSSGKRLYTWDEIPVWQHDNEYIY 56
           M   +Q+R  TS+T   EG+      GD+ +Q+        +LY WDEIP WQ DNE+I 
Sbjct: 1   MPKTIQKRGNTSTTTVVEGIINNTDNGDSIEQVKRKVV--YKLYRWDEIPEWQKDNEHII 58

Query: 57  TGYVRETNSMKESFLSLFYIHNESVNIYTHLIPAFCFLSMLLFNTYGVKPHPTTTYGDYV 116
           +GYVRETNS K    SLFY+HNES N+Y+HL+P   F   ++ N YG+  + TT+  DY+
Sbjct: 59  SGYVRETNSFKGCLHSLFYVHNESGNVYSHLLPGVFFFFTMVLNKYGITIYSTTSIVDYL 118

Query: 117 AIDLFFIGAFTCLGLSSTFHCFKSHSLKISVFGNKLDYXXXXXXXXXXXXXXXYFGYHDD 176
            IDLFF GAF CL LSS FHCFKSHSLK++  GNKLDY               YFG+ D+
Sbjct: 119 MIDLFFFGAFCCLILSSLFHCFKSHSLKVATLGNKLDYLGIVILIVTSMISIMYFGFFDN 178

Query: 177 PFIFYIFSGITLCFGIACGIASLKDKFRTREWRPYRAALFVLFGLSGVLPIIAGIMKYGI 236
           P  FY FS +T  FG AC   SLKD FR+REWRPYRA LFV FGLS +LPI+AG   YGI
Sbjct: 179 PLFFYFFSSLTFLFGGACATVSLKDHFRSREWRPYRAGLFVAFGLSAILPILAGTFYYGI 238

Query: 237 REVFERVQLKWIIWEGVLYIFGAFLYGARFPEKFMPGKVDIWGQSHQIFHVLVVIAALCH 296
            E F R+QLKWII EG  YIFGAFLYG RFPEK++PG  DIWG SHQIFH+LVV+AA CH
Sbjct: 239 EETFIRIQLKWIILEGFFYIFGAFLYGVRFPEKYVPGSFDIWGHSHQIFHILVVVAAFCH 298

Query: 297 LRGLIGSYELVHQKL 311
           LRGL+ SYE+VH +L
Sbjct: 299 LRGLLSSYEIVHSRL 313

>Kwal_56.22454 s56 (136175..137122) [948 bp, 315 aa] {ON} YOL002C -
           Hypothetical ORF [contig 185] FULL
          Length = 315

 Score =  363 bits (932), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 169/298 (56%), Positives = 209/298 (70%), Gaps = 5/298 (1%)

Query: 14  TEEGVELLYGDNQQQLNTSGSSGKRLYTWDEIPVWQHDNEYIYTGYVRETNSMKESFLSL 73
           TEE   LL G   ++      + +RLY WDEIP WQ DNE+I  GY+ ET S+     SL
Sbjct: 21  TEETTTLLNGSRIEE-----RTRRRLYKWDEIPEWQKDNEHILNGYILETKSVGACLKSL 75

Query: 74  FYIHNESVNIYTHLIPAFCFLSMLLFNTYGVKPHPTTTYGDYVAIDLFFIGAFTCLGLSS 133
            Y+HNESVNIYTHLIP +CFL M LFN   ++ + TT   DY+ IDLFF+G FTCL +SS
Sbjct: 76  LYLHNESVNIYTHLIPGWCFLLMTLFNQLAIERYETTRMIDYIMIDLFFLGGFTCLMMSS 135

Query: 134 TFHCFKSHSLKISVFGNKLDYXXXXXXXXXXXXXXXYFGYHDDPFIFYIFSGITLCFGIA 193
           TFHCFK HSL ++V GNKLDY               ++G+HD+   FY+FSG+T+ FG+A
Sbjct: 136 TFHCFKCHSLPVAVLGNKLDYLGIVALVVTSMVSILFYGFHDNNLYFYVFSGLTIMFGLA 195

Query: 194 CGIASLKDKFRTREWRPYRAALFVLFGLSGVLPIIAGIMKYGIREVFERVQLKWIIWEGV 253
           C I SL DKFR+R+WRPYRAALFV FGLS + P+IAGI  YG +  + R+QLKW+  EGV
Sbjct: 196 CTIVSLSDKFRSRDWRPYRAALFVAFGLSALFPVIAGICHYGFKVTWTRIQLKWVFLEGV 255

Query: 254 LYIFGAFLYGARFPEKFMPGKVDIWGQSHQIFHVLVVIAALCHLRGLIGSYELVHQKL 311
            YI GA LYG RFPE+  PG  DIWGQSHQ+FHVLVVIAA CHLR L+G+Y+ VH ++
Sbjct: 256 FYILGALLYGVRFPERVAPGTFDIWGQSHQLFHVLVVIAASCHLRALLGAYKWVHSQM 313

>ZYRO0C07612g Chr3 complement(578864..579823) [960 bp, 319 aa] {ON}
           similar to uniprot|Q12442 Saccharomyces cerevisiae
           YOL002C IZH2 Membrane protein involved in zinc
           metabolism member of the four-protein IZH family direct
           target of the Zap1p transcription factor expression
           induced by zinc deficiency and fatty acids deletion
           increases sensitivity to elevated zinc
          Length = 319

 Score =  361 bits (926), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 169/291 (58%), Positives = 206/291 (70%), Gaps = 4/291 (1%)

Query: 25  NQQQ----LNTSGSSGKRLYTWDEIPVWQHDNEYIYTGYVRETNSMKESFLSLFYIHNES 80
           NQ+Q    +    +  K LYTW+EIP WQ DNE+I  GYVRETNS++E   SL Y+HNES
Sbjct: 24  NQEQTTIKIEPVNTQKKLLYTWNEIPDWQKDNEHIVGGYVRETNSIRECLQSLLYLHNES 83

Query: 81  VNIYTHLIPAFCFLSMLLFNTYGVKPHPTTTYGDYVAIDLFFIGAFTCLGLSSTFHCFKS 140
           +NIYTH +P  CFL+  +F+ + +K   TTT+ DY+AID FF GAF+CL LSSTFHCFKS
Sbjct: 84  INIYTHFLPGLCFLATCIFDKFAIKNFDTTTWIDYMAIDFFFFGAFSCLILSSTFHCFKS 143

Query: 141 HSLKISVFGNKLDYXXXXXXXXXXXXXXXYFGYHDDPFIFYIFSGITLCFGIACGIASLK 200
           HS ++SVFGNKLDY               Y+ +HD   +FY F+ I  CFG++C IAS  
Sbjct: 144 HSSRVSVFGNKLDYLGIVILIVCSMISILYYAFHDSNKLFYSFTLIIFCFGVSCTIASFD 203

Query: 201 DKFRTREWRPYRAALFVLFGLSGVLPIIAGIMKYGIREVFERVQLKWIIWEGVLYIFGAF 260
           D FR+REWRPYRA LFV FGLS +LPI+ GI+KYG  E + R+Q+KW+I EG+ YIFGAF
Sbjct: 204 DTFRSREWRPYRAGLFVAFGLSALLPIMGGIIKYGFHETWTRIQMKWVILEGIFYIFGAF 263

Query: 261 LYGARFPEKFMPGKVDIWGQSHQIFHVLVVIAALCHLRGLIGSYELVHQKL 311
           LY  RFPE+  PG  D  G SHQIFHVLVVIAALCHL  L+ SYELVH  L
Sbjct: 264 LYSIRFPERLAPGAFDFVGHSHQIFHVLVVIAALCHLVALMNSYELVHTNL 314

>Kpol_1032.9 s1032 (22700..23656) [957 bp, 318 aa] {ON}
           (22700..23656) [957 nt, 319 aa]
          Length = 318

 Score =  360 bits (925), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 159/281 (56%), Positives = 209/281 (74%)

Query: 36  GKRLYTWDEIPVWQHDNEYIYTGYVRETNSMKESFLSLFYIHNESVNIYTHLIPAFCFLS 95
           G +L TW+ +P WQ DNE+I +GYV+ETNS+K    SL +IHNESVNI++HL+PAFCF++
Sbjct: 38  GVQLVTWEHLPDWQKDNEHILSGYVKETNSIKACLHSLLFIHNESVNIFSHLVPAFCFMT 97

Query: 96  MLLFNTYGVKPHPTTTYGDYVAIDLFFIGAFTCLGLSSTFHCFKSHSLKISVFGNKLDYX 155
            ++F+ Y V+ +PTTT  DY+ +DLF  GAFTCL +SS FHC K+HS  +S FGNKLDY 
Sbjct: 98  TIIFDKYVVERYPTTTLKDYLMLDLFLFGAFTCLMMSSAFHCLKAHSPYVSSFGNKLDYL 157

Query: 156 XXXXXXXXXXXXXXYFGYHDDPFIFYIFSGITLCFGIACGIASLKDKFRTREWRPYRAAL 215
                         Y+G++D+ F+++ FS IT  FG++C + SL ++FR REWRPYRAA+
Sbjct: 158 GIVVLIVSSMSSILYYGFYDNSFLYFTFSAITFTFGLSCAVVSLGERFRAREWRPYRAAM 217

Query: 216 FVLFGLSGVLPIIAGIMKYGIREVFERVQLKWIIWEGVLYIFGAFLYGARFPEKFMPGKV 275
           FV FGLS +LPI AG + YG++E   RVQLKW++ EGV YIFGA LYG RFPE+  PG  
Sbjct: 218 FVAFGLSALLPIFAGFLYYGVQETTIRVQLKWVVLEGVFYIFGALLYGVRFPERLKPGMF 277

Query: 276 DIWGQSHQIFHVLVVIAALCHLRGLIGSYELVHQKLDAQLQ 316
           DIWG SHQ+FH+LVV+AALCHLRGL+GSY +VH +L +  Q
Sbjct: 278 DIWGHSHQLFHILVVVAALCHLRGLLGSYTIVHTRLSSLTQ 318

>SAKL0E01474g Chr5 (112382..113317) [936 bp, 311 aa] {ON} similar to
           uniprot|Q12442 Saccharomyces cerevisiae YOL002C IZH2
           Membrane protein involved in zinc metabolism member of
           the four-protein IZH family direct target of the Zap1p
           transcription factor expression induced by zinc
           deficiency and fatty acids deletion increases
           sensitivity to elevated zinc
          Length = 311

 Score =  359 bits (922), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 175/317 (55%), Positives = 218/317 (68%), Gaps = 11/317 (3%)

Query: 1   MVTEVQRRKLTSSTEEGVELLYGDNQQQLNTSGSSGK----RLYTWDEIPVWQHDNEYIY 56
           M  E  RR+L       V       +++  ++G+  K    RLY+W+EIP WQ DNE+I 
Sbjct: 1   MEPEPNRRRLQIKRANIV-------KEETMSTGTINKKRVRRLYSWEEIPDWQKDNEHIR 53

Query: 57  TGYVRETNSMKESFLSLFYIHNESVNIYTHLIPAFCFLSMLLFNTYGVKPHPTTTYGDYV 116
            GYVRETNS    F SLFY+HNESVNIYTHL+P  CF  ++LF+   +K   TTT+ DY+
Sbjct: 54  HGYVRETNSFLGCFDSLFYMHNESVNIYTHLLPGLCFFFVVLFDKVAIKVFDTTTFLDYI 113

Query: 117 AIDLFFIGAFTCLGLSSTFHCFKSHSLKISVFGNKLDYXXXXXXXXXXXXXXXYFGYHDD 176
            +DLFF+GAFTCL LSSTFHC K+HSL+I++ GNKLDY               Y+G+ D 
Sbjct: 114 MVDLFFLGAFTCLILSSTFHCLKTHSLRIAILGNKLDYLGIVALIVSSMISIMYYGFFDS 173

Query: 177 PFIFYIFSGITLCFGIACGIASLKDKFRTREWRPYRAALFVLFGLSGVLPIIAGIMKYGI 236
              FY FS +TL FGIAC IASL D FR+REWRPYRAALFV FGLS VLPI +G+  YG 
Sbjct: 174 GKFFYGFSTLTLVFGIACAIASLSDTFRSREWRPYRAALFVAFGLSAVLPIFSGVAVYGF 233

Query: 237 REVFERVQLKWIIWEGVLYIFGAFLYGARFPEKFMPGKVDIWGQSHQIFHVLVVIAALCH 296
           +E + +VQ+KW++  GV YI GA LY  R PE+  PGK DIWG SHQIFH+LVVIAALCH
Sbjct: 234 KETWVKVQVKWVLLGGVFYIIGALLYALRLPERISPGKFDIWGHSHQIFHILVVIAALCH 293

Query: 297 LRGLIGSYELVHQKLDA 313
           L+ ++ SYELVH+KL +
Sbjct: 294 LKAVLNSYELVHKKLAS 310

>KLLA0D01331g Chr4 (117469..118395) [927 bp, 308 aa] {ON} similar to
           uniprot|Q12442 Saccharomyces cerevisiae YOL002C IZH2
           Membrane protein involved in zinc metabolism member of
           the four-protein IZH family direct target of the Zap1p
           transcription factor expression induced by zinc
           deficiency and fatty acids deletion increases
           sensitivity to elevated zinc
          Length = 308

 Score =  359 bits (921), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 177/309 (57%), Positives = 212/309 (68%), Gaps = 3/309 (0%)

Query: 5   VQRRKLTSSTEEGVELLYGDNQQQLNTSGSSGKRLYTWDEIPVWQHDNEYIYTGYVRETN 64
           +  RK +  TEE    L  +      T     +R+Y+WDEIP WQ DNE+I  GYVRET 
Sbjct: 1   MSTRKRSVVTEETA--LIEETPGTKKTVRVYERRVYSWDEIPDWQKDNEHILHGYVRETQ 58

Query: 65  SMKESFLSLFYIHNESVNIYTHLIPAFCFLSMLLFNTYGV-KPHPTTTYGDYVAIDLFFI 123
           S KE F SLFY+HNESVNIYTHLIPA     ++LF T+ V   +PTT+  DY  I+LFF 
Sbjct: 59  SWKELFHSLFYLHNESVNIYTHLIPAVALFFIMLFATHHVINEYPTTSAIDYFMINLFFF 118

Query: 124 GAFTCLGLSSTFHCFKSHSLKISVFGNKLDYXXXXXXXXXXXXXXXYFGYHDDPFIFYIF 183
           G  TCL +SS FH  K HSL I+ FGNKLDY               ++G+HD   +FY F
Sbjct: 119 GCATCLTMSSMFHTIKCHSLPIATFGNKLDYLGIVVLISTSMISILFYGFHDSSLLFYPF 178

Query: 184 SGITLCFGIACGIASLKDKFRTREWRPYRAALFVLFGLSGVLPIIAGIMKYGIREVFERV 243
           +G+T  FG+ CG  SLKDKFR+REWRPYRA +FVLFGLS V PI+AG + YG  E ++RV
Sbjct: 179 AGLTSLFGLICGYMSLKDKFRSREWRPYRATMFVLFGLSAVFPIVAGFIVYGKDETWKRV 238

Query: 244 QLKWIIWEGVLYIFGAFLYGARFPEKFMPGKVDIWGQSHQIFHVLVVIAALCHLRGLIGS 303
           QL W+IWEGVLYIFGAFLYG RFPE+  PGK DIWG SHQ+FHVLVV+AALCHL+ L+ S
Sbjct: 239 QLTWVIWEGVLYIFGAFLYGVRFPERLAPGKFDIWGHSHQLFHVLVVVAALCHLKALVVS 298

Query: 304 YELVHQKLD 312
           Y LVHQ L 
Sbjct: 299 YGLVHQALS 307

>TDEL0G04420 Chr7 complement(802412..803380) [969 bp, 322 aa] {ON}
           Anc_6.27 YOL002C
          Length = 322

 Score =  354 bits (909), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 169/290 (58%), Positives = 206/290 (71%), Gaps = 1/290 (0%)

Query: 27  QQLNTSGSSGKRLYTWDEIPVWQHDNEYIYTGYVRETNSMKESFLSLFYIHNESVNIYTH 86
           Q+ +      ++LYTWDEIP WQ DNE+I +GYV ET SM + FLSLFY+HNESVNIYTH
Sbjct: 33  QKTDKMSKKKRKLYTWDEIPHWQRDNEHILSGYVGETRSMFQCFLSLFYLHNESVNIYTH 92

Query: 87  LIPAFCFLSMLLFNTYGVKPHPTTTYGDYVAIDLFFIGAFTCLGLSSTFHCFKSHSLKIS 146
           L+P   FL +L F+ + V    TTT  DYV IDLF + +FTCL LSS FHC K+HS  ++
Sbjct: 93  LLPGIAFLFVLCFDKFAVTQFETTTLIDYVMIDLFSLVSFTCLTLSSIFHCLKNHSRSVA 152

Query: 147 VFGNKLDYXXXXXXXXXXXXXXXYFGYHDDPFIFYIFSGITLCFGIACGIASLKDKFRTR 206
            FGNKLDY               Y+G+ + P +FY+FS IT  FG AC + SLK+ FRTR
Sbjct: 153 TFGNKLDYLGIVVLVVTSMVSIMYYGFFETPALFYLFSFITCTFGAACAVVSLKEGFRTR 212

Query: 207 EWRPYRAALFVLFGLSGVLPIIAGIMKYGIREVFERVQLKWIIWEGVLYIFGAFLYGARF 266
           EWRPYRAA+FV FGLS VLPI+ GI  YG  E++ R+Q+KW++  G+ YI GA LYG RF
Sbjct: 213 EWRPYRAAMFVAFGLSAVLPIVTGIFYYGFSEIYLRIQVKWVLLGGIFYITGAVLYGVRF 272

Query: 267 PEKFMPGKVDIWGQSHQIFHVLVVIAALCHLRGLIGSYELVHQKLD-AQL 315
           PEK+ PGK DIWG SHQ+FHVLVV+AALCHL GLI SY LVH K+  AQL
Sbjct: 273 PEKYAPGKYDIWGHSHQLFHVLVVVAALCHLYGLIKSYNLVHLKMAIAQL 322

>KAFR0G02650 Chr7 complement(547561..548526) [966 bp, 321 aa] {ON}
           Anc_6.27 YOL002C
          Length = 321

 Score =  354 bits (909), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 176/304 (57%), Positives = 212/304 (69%), Gaps = 6/304 (1%)

Query: 8   RKLTSST--EEGVELLYGDNQQQLNTSGSSGKRLYTWDEIPVWQHDNEYIYTGYVRETNS 65
           RK+T  T  ++ VE     N+ +   S     +LY W+EIP WQ DNE+I +GYV+ETNS
Sbjct: 11  RKVTIDTAFQDVVE----QNKGETIRSLEKIIQLYNWNEIPDWQKDNEHIISGYVKETNS 66

Query: 66  MKESFLSLFYIHNESVNIYTHLIPAFCFLSMLLFNTYGVKPHPTTTYGDYVAIDLFFIGA 125
                 SLFY+HNESVN+Y+HLIPA CFL   L N   V    TTT  DY+ IDLFF+GA
Sbjct: 67  FFSCIESLFYLHNESVNVYSHLIPAVCFLMTSLLNKTIVPKFRTTTVLDYLYIDLFFLGA 126

Query: 126 FTCLGLSSTFHCFKSHSLKISVFGNKLDYXXXXXXXXXXXXXXXYFGYHDDPFIFYIFSG 185
           FTCL LSSTFHCFKSHSL+I+ FGNKLDY               Y+G++D P +FY+F+ 
Sbjct: 127 FTCLILSSTFHCFKSHSLRIATFGNKLDYLGIVVLISTSMISLLYYGFYDTPSLFYVFAF 186

Query: 186 ITLCFGIACGIASLKDKFRTREWRPYRAALFVLFGLSGVLPIIAGIMKYGIREVFERVQL 245
           ITL FG+AC   SLKDKFR+RE R YRA LFV FGLS VLP+I G+  YG    + R+QL
Sbjct: 187 ITLSFGLACATVSLKDKFRSRECRAYRATLFVCFGLSAVLPVICGLYHYGFYNTWHRIQL 246

Query: 246 KWIIWEGVLYIFGAFLYGARFPEKFMPGKVDIWGQSHQIFHVLVVIAALCHLRGLIGSYE 305
           KW++ EGV YIFGAFLYG RFPEK+ PGK DIWG SHQ+FH+LVVIAALCH + L+ SYE
Sbjct: 247 KWVLLEGVFYIFGAFLYGIRFPEKYTPGKYDIWGHSHQLFHILVVIAALCHFKALMCSYE 306

Query: 306 LVHQ 309
            VH 
Sbjct: 307 HVHM 310

>Smik_15.168 Chr15 complement(290724..291707) [984 bp, 327 aa] {ON}
           YOL002C (REAL)
          Length = 327

 Score =  350 bits (899), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 168/317 (52%), Positives = 219/317 (69%)

Query: 1   MVTEVQRRKLTSSTEEGVELLYGDNQQQLNTSGSSGKRLYTWDEIPVWQHDNEYIYTGYV 60
           M T ++R K     ++        N  ++  +    KRLY+WDEIP WQ DN++I  GYV
Sbjct: 11  MSTLLERTKSVQELKKRAAGKTSANPAEVAEAKKVLKRLYSWDEIPEWQRDNDFILHGYV 70

Query: 61  RETNSMKESFLSLFYIHNESVNIYTHLIPAFCFLSMLLFNTYGVKPHPTTTYGDYVAIDL 120
           RET+S  E+F SLFY+HNESVNIY+HL+PA  F ++LL +   +K   TTT+ D+V IDL
Sbjct: 71  RETSSFIETFKSLFYLHNESVNIYSHLVPALGFFTVLLLDKSTIKVFETTTWKDHVVIDL 130

Query: 121 FFIGAFTCLGLSSTFHCFKSHSLKISVFGNKLDYXXXXXXXXXXXXXXXYFGYHDDPFIF 180
           F+ GAF CL LSS+FHC KSHSL+I+  GNKLDY               ++GY++   +F
Sbjct: 131 FYSGAFACLILSSSFHCLKSHSLRIATLGNKLDYLGICILIVTSMVSILFYGYYEKFSLF 190

Query: 181 YIFSGITLCFGIACGIASLKDKFRTREWRPYRAALFVLFGLSGVLPIIAGIMKYGIREVF 240
            +F+ IT+ FG+AC I SLKDKFR REWRPYRA LFV FGLS ++PI +G+  Y   E++
Sbjct: 191 CLFALITVSFGVACSIVSLKDKFRKREWRPYRAGLFVCFGLSSIVPIFSGLYCYSFSEIW 250

Query: 241 ERVQLKWIIWEGVLYIFGAFLYGARFPEKFMPGKVDIWGQSHQIFHVLVVIAALCHLRGL 300
            ++QL W++  GVLYI GA LYG RFPEK  PGK DIWG SHQ+FH LVVIA+LCHLRGL
Sbjct: 251 TQIQLFWVLLGGVLYIIGAVLYGMRFPEKVCPGKFDIWGHSHQLFHFLVVIASLCHLRGL 310

Query: 301 IGSYELVHQKLDAQLQS 317
           + SYELVH K+++ + S
Sbjct: 311 LNSYELVHIKMESGIIS 327

>KLTH0C11044g Chr3 complement(908604..909551) [948 bp, 315 aa] {ON}
           similar to uniprot|Q12442 Saccharomyces cerevisiae
           YOL002C IZH2 Membrane protein involved in zinc
           metabolism member of the four-protein IZH family direct
           target of the Zap1p transcription factor expression
           induced by zinc deficiency and fatty acids deletion
           increases sensitivity to elevated zinc
          Length = 315

 Score =  348 bits (894), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 161/296 (54%), Positives = 206/296 (69%), Gaps = 5/296 (1%)

Query: 14  TEEGVELLYGDNQQQLNTSGSSGKRLYTWDEIPVWQHDNEYIYTGYVRETNSMKESFLSL 73
            EE   LL   N +Q      + +RLYTWDEIP WQ DNE+I  GY+ ET S  E   SL
Sbjct: 21  VEENSSLLKDSNLKQ-----RTKRRLYTWDEIPEWQRDNEHIVGGYILETKSTWECLKSL 75

Query: 74  FYIHNESVNIYTHLIPAFCFLSMLLFNTYGVKPHPTTTYGDYVAIDLFFIGAFTCLGLSS 133
            Y+HNESVNIYTHL+P +CFL + +FN   ++   TT   DYV IDLFF+G FTCL +SS
Sbjct: 76  LYLHNESVNIYTHLLPGWCFLLVAVFNQVVIEKFETTRLIDYVMIDLFFLGGFTCLMMSS 135

Query: 134 TFHCFKSHSLKISVFGNKLDYXXXXXXXXXXXXXXXYFGYHDDPFIFYIFSGITLCFGIA 193
            FHCFK HSL +++ GNKLDY               ++G+HD    F++FSG+T+ FG+A
Sbjct: 136 VFHCFKCHSLPVAILGNKLDYLGIVALVVTSIVSILFYGFHDYDLYFWLFSGLTMAFGLA 195

Query: 194 CGIASLKDKFRTREWRPYRAALFVLFGLSGVLPIIAGIMKYGIREVFERVQLKWIIWEGV 253
           C   SL +KFR+REWRPYRA+LFV FGLS +LP+IAG + YG++E + R+QL+W++  GV
Sbjct: 196 CATVSLSNKFRSREWRPYRASLFVAFGLSALLPVIAGALHYGLKETWTRIQLEWVLLGGV 255

Query: 254 LYIFGAFLYGARFPEKFMPGKVDIWGQSHQIFHVLVVIAALCHLRGLIGSYELVHQ 309
            YI GA LYG RFPE+  PG  DIWG SHQ+FH+LVV+AALCHLR L+G+Y+L H 
Sbjct: 256 FYILGAVLYGIRFPERMAPGCFDIWGHSHQLFHILVVVAALCHLRALLGAYKLFHH 311

>YOL002C Chr15 complement(323411..324364) [954 bp, 317 aa] {ON}
           IZH2Plasma membrane protein involved in zinc homeostasis
           and osmotin-induced apoptosis; transcription regulated
           by Zap1p, zinc and fatty acid levels; similar to
           mammalian adiponectins; deletion increases sensitivity
           to elevated zinc
          Length = 317

 Score =  348 bits (894), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 169/317 (53%), Positives = 217/317 (68%)

Query: 1   MVTEVQRRKLTSSTEEGVELLYGDNQQQLNTSGSSGKRLYTWDEIPVWQHDNEYIYTGYV 60
           M T ++R K     ++        N  ++  +    +RLY+WDEIP WQ DN++I  GYV
Sbjct: 1   MSTLLERTKSVQELKKRAAGKTSANPAEVAKAKKVLRRLYSWDEIPEWQRDNDFILHGYV 60

Query: 61  RETNSMKESFLSLFYIHNESVNIYTHLIPAFCFLSMLLFNTYGVKPHPTTTYGDYVAIDL 120
           +ET+S  E+F SLFY+HNESVNIY+HLIPA  F ++LL +   +K   TTT+ D++ IDL
Sbjct: 61  KETSSFIETFKSLFYLHNESVNIYSHLIPALGFFTVLLLDKSTIKVFATTTWLDHMVIDL 120

Query: 121 FFIGAFTCLGLSSTFHCFKSHSLKISVFGNKLDYXXXXXXXXXXXXXXXYFGYHDDPFIF 180
           F+ GAF CL LSS+FHC KSHSL+I+  GNKLDY               Y+GY +   +F
Sbjct: 121 FYSGAFACLILSSSFHCLKSHSLRIATLGNKLDYLGICILIVTSMVSILYYGYFEKFSLF 180

Query: 181 YIFSGITLCFGIACGIASLKDKFRTREWRPYRAALFVLFGLSGVLPIIAGIMKYGIREVF 240
            +F+ IT+ FGIAC I SLKDKFR REWRPYRA LFV FGLS ++PI +G+  Y   E++
Sbjct: 181 CLFALITVSFGIACSIVSLKDKFRKREWRPYRAGLFVCFGLSSIIPIFSGLYCYSFSEIW 240

Query: 241 ERVQLKWIIWEGVLYIFGAFLYGARFPEKFMPGKVDIWGQSHQIFHVLVVIAALCHLRGL 300
            ++QL W++  GVLYI GA LYG RFPEK  PGK DIWG SHQ+FH LVVIAALCHLRGL
Sbjct: 241 TQIQLFWVLLGGVLYIIGAVLYGMRFPEKICPGKFDIWGHSHQLFHFLVVIAALCHLRGL 300

Query: 301 IGSYELVHQKLDAQLQS 317
           + SYELVH K++  + S
Sbjct: 301 LNSYELVHIKMENGIVS 317

>Skud_15.160 Chr15 complement(283003..283986) [984 bp, 327 aa] {ON}
           YOL002C (REAL)
          Length = 327

 Score =  349 bits (895), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 169/317 (53%), Positives = 217/317 (68%)

Query: 1   MVTEVQRRKLTSSTEEGVELLYGDNQQQLNTSGSSGKRLYTWDEIPVWQHDNEYIYTGYV 60
           M T ++R K     ++        N  ++  +    KRLY+WDEIP WQ DN+YI  GYV
Sbjct: 11  MSTLLERTKSVQELKKRAAGKTPANPAEVAEAKKVLKRLYSWDEIPEWQRDNDYILHGYV 70

Query: 61  RETNSMKESFLSLFYIHNESVNIYTHLIPAFCFLSMLLFNTYGVKPHPTTTYGDYVAIDL 120
           RET S  E+F SLFY+HNESVNIY+HLIPA  F ++LL +   +K   TTT+ D++ IDL
Sbjct: 71  RETCSFVETFKSLFYMHNESVNIYSHLIPALGFFTVLLLDKSTIKVFETTTWKDHMIIDL 130

Query: 121 FFIGAFTCLGLSSTFHCFKSHSLKISVFGNKLDYXXXXXXXXXXXXXXXYFGYHDDPFIF 180
           F+ GAF CL LSS+FHC KSHSL+I+  GNKLDY               Y+GY++   +F
Sbjct: 131 FYSGAFACLILSSSFHCLKSHSLRIATLGNKLDYLGICILIVTSMTSILYYGYYEKFSLF 190

Query: 181 YIFSGITLCFGIACGIASLKDKFRTREWRPYRAALFVLFGLSGVLPIIAGIMKYGIREVF 240
            +F+ IT+ FGIAC I +LKDKFR REWRPYRA LFV FGLS ++PI +G+  Y   E++
Sbjct: 191 CLFALITVSFGIACSIVTLKDKFRKREWRPYRAGLFVCFGLSSIVPIFSGLYCYTFSEIW 250

Query: 241 ERVQLKWIIWEGVLYIFGAFLYGARFPEKFMPGKVDIWGQSHQIFHVLVVIAALCHLRGL 300
            ++QL W++  GVLYI GA LYG RFPEK  PGK DIWG SHQ+FH LVVIA+ CHLRGL
Sbjct: 251 TQIQLFWVLLGGVLYIIGAVLYGMRFPEKVCPGKFDIWGHSHQLFHFLVVIASFCHLRGL 310

Query: 301 IGSYELVHQKLDAQLQS 317
           + SYELVH K++ ++ S
Sbjct: 311 LNSYELVHLKMEGKIVS 327

>Ecym_3031 Chr3 (61592..62578) [987 bp, 328 aa] {ON} similar to
           Ashbya gossypii ACL002C
          Length = 328

 Score =  340 bits (873), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 161/321 (50%), Positives = 207/321 (64%), Gaps = 8/321 (2%)

Query: 4   EVQRRKLTSSTEE--------GVELLYGDNQQQLNTSGSSGKRLYTWDEIPVWQHDNEYI 55
           +V +RK+  +T             +++ D  Q          +L++W EIP WQ DNE+I
Sbjct: 5   QVFQRKIQKATSSLAGKNRTLETSVIFEDLNQATTIPLKPASKLFSWHEIPEWQRDNEHI 64

Query: 56  YTGYVRETNSMKESFLSLFYIHNESVNIYTHLIPAFCFLSMLLFNTYGVKPHPTTTYGDY 115
             GYV+ETNS KE+  SL Y+HNESVNIYTHLIP  CF  +L  N Y +    TTT+ DY
Sbjct: 65  LGGYVKETNSFKETLHSLLYLHNESVNIYTHLIPGVCFFCVLFLNKYVISRFKTTTWKDY 124

Query: 116 VAIDLFFIGAFTCLGLSSTFHCFKSHSLKISVFGNKLDYXXXXXXXXXXXXXXXYFGYHD 175
             ID FF+GAF CL +S T+HC KSHS  +S+ GN+LDY               Y+G+++
Sbjct: 125 AIIDTFFVGAFACLVMSGTYHCLKSHSYPVSIVGNQLDYIGIVILISTSMFSLLYYGFYN 184

Query: 176 DPFIFYIFSGITLCFGIACGIASLKDKFRTREWRPYRAALFVLFGLSGVLPIIAGIMKYG 235
              +FY FSG+TL  G  C + +L  +FR+R WRPYRA++FV FGLS +LPI+A I+ YG
Sbjct: 185 SSKMFYGFSGVTLLLGTICTVVTLDSRFRSRLWRPYRASIFVAFGLSSILPILASILYYG 244

Query: 236 IREVFERVQLKWIIWEGVLYIFGAFLYGARFPEKFMPGKVDIWGQSHQIFHVLVVIAALC 295
             E +  VQL WII EGVLYIFGAF+YG RFPE   PG  DIWG SHQ+FHVLVVIAALC
Sbjct: 245 SEETWNSVQLGWIILEGVLYIFGAFIYGIRFPESMAPGSFDIWGHSHQLFHVLVVIAALC 304

Query: 296 HLRGLIGSYELVHQKLDAQLQ 316
           H + +  SYELVH +L+  +Q
Sbjct: 305 HFKAVTQSYELVHFRLNEAVQ 325

>Suva_15.173 Chr15 complement(297915..298898) [984 bp, 327 aa] {ON}
           YOL002C (REAL)
          Length = 327

 Score =  337 bits (865), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 171/320 (53%), Positives = 221/320 (69%), Gaps = 6/320 (1%)

Query: 1   MVTEVQRRKLTSSTEEGVELLYGD---NQQQLNTSGSSGKRLYTWDEIPVWQHDNEYIYT 57
           M T ++R   T+S +E  +   G+   N  ++  +    KR+Y+WDEIP WQ DN+YI  
Sbjct: 11  MSTLLER---TNSVQELKKRAAGNTAANPAEVAKAKKVLKRVYSWDEIPEWQRDNDYILH 67

Query: 58  GYVRETNSMKESFLSLFYIHNESVNIYTHLIPAFCFLSMLLFNTYGVKPHPTTTYGDYVA 117
           GYV+ET+S  ++F SLFY+HNESVNIY+HLIPA  FL++LL +   +    TTT+ D++ 
Sbjct: 68  GYVKETSSFVDTFKSLFYMHNESVNIYSHLIPAVGFLTVLLLDKTTITVFETTTWLDHMM 127

Query: 118 IDLFFIGAFTCLGLSSTFHCFKSHSLKISVFGNKLDYXXXXXXXXXXXXXXXYFGYHDDP 177
           IDLFF GAF CL LSS+FHCFKSHSLKI+  GNKLDY               Y+GY+D  
Sbjct: 128 IDLFFTGAFACLILSSSFHCFKSHSLKIATLGNKLDYLGICILIVTSMVSILYYGYYDKF 187

Query: 178 FIFYIFSGITLCFGIACGIASLKDKFRTREWRPYRAALFVLFGLSGVLPIIAGIMKYGIR 237
             F +F+ IT+ FGIAC I SLKDKFR REWRPYRA LFV FGLS ++PI +G+  Y   
Sbjct: 188 PAFCLFALITVSFGIACSIVSLKDKFRKREWRPYRAGLFVCFGLSSIVPIFSGLYYYSFS 247

Query: 238 EVFERVQLKWIIWEGVLYIFGAFLYGARFPEKFMPGKVDIWGQSHQIFHVLVVIAALCHL 297
           E++ ++QL W++  G LYI GA LYG RFPEK  PG+ DIWG SHQ+FH LVVIA+LCH+
Sbjct: 248 EIWNQIQLFWVLLGGALYIIGAVLYGMRFPEKVYPGRFDIWGHSHQLFHFLVVIASLCHM 307

Query: 298 RGLIGSYELVHQKLDAQLQS 317
           RG++ SYELVH K+   + S
Sbjct: 308 RGVLNSYELVHIKMQNGIVS 327

>ACL002C Chr3 complement(353449..354438) [990 bp, 329 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL002C
          Length = 329

 Score =  337 bits (863), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 155/272 (56%), Positives = 192/272 (70%)

Query: 39  LYTWDEIPVWQHDNEYIYTGYVRETNSMKESFLSLFYIHNESVNIYTHLIPAFCFLSMLL 98
           L +WD++P WQ DNE+I +GYVRETNS +++F SLFY+HNESVNIY+HLIP  CFL + L
Sbjct: 52  LCSWDDLPDWQKDNEHILSGYVRETNSYRKTFRSLFYLHNESVNIYSHLIPGICFLFIAL 111

Query: 99  FNTYGVKPHPTTTYGDYVAIDLFFIGAFTCLGLSSTFHCFKSHSLKISVFGNKLDYXXXX 158
           FN Y V  + TTT+ DY+ ID+F +GA  CL LS  +HC KSHSL++SVFGNKLDY    
Sbjct: 112 FNKYVVADYSTTTWKDYLMIDIFLLGAVVCLTLSGVYHCMKSHSLEVSVFGNKLDYIGIV 171

Query: 159 XXXXXXXXXXXYFGYHDDPFIFYIFSGITLCFGIACGIASLKDKFRTREWRPYRAALFVL 218
                      Y+G++D   +F +FS +TL   +AC + SL   FR+REWR YRAA+F  
Sbjct: 172 ALISCSMISQMYYGFYDSTAMFSLFSTVTLSLALACAVVSLSPHFRSREWRKYRAAIFTA 231

Query: 219 FGLSGVLPIIAGIMKYGIREVFERVQLKWIIWEGVLYIFGAFLYGARFPEKFMPGKVDIW 278
           FGLSG+LP+I     YG  E + R+QLKW+  EGVLYI GA LYG RFPEK  PG  DIW
Sbjct: 232 FGLSGLLPVITSCFYYGPIEAYSRIQLKWLSLEGVLYISGAVLYGVRFPEKLEPGSFDIW 291

Query: 279 GQSHQIFHVLVVIAALCHLRGLIGSYELVHQK 310
           G SHQ+FHVLVVIAALCHLR L+  Y+ VH  
Sbjct: 292 GHSHQLFHVLVVIAALCHLRALLSCYKNVHTN 323

>TPHA0M00290 Chr13 (57784..58767) [984 bp, 327 aa] {ON} Anc_6.27
           YOL002C
          Length = 327

 Score =  335 bits (860), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 156/291 (53%), Positives = 201/291 (69%), Gaps = 3/291 (1%)

Query: 24  DNQQQLNTSGSSGKRLYT---WDEIPVWQHDNEYIYTGYVRETNSMKESFLSLFYIHNES 80
            N++ +   G   ++L T   WD++P WQ DNE+I+ GYV+ETNS    F SLF++HNES
Sbjct: 35  SNKKLVKIIGRFTRQLITITHWDDLPDWQKDNEHIHEGYVKETNSFINCFESLFFLHNES 94

Query: 81  VNIYTHLIPAFCFLSMLLFNTYGVKPHPTTTYGDYVAIDLFFIGAFTCLGLSSTFHCFKS 140
           VNIY+H++P  C L MLL +   +K  PTTT+ DY  IDLF  GAF+CL LSS FH  KS
Sbjct: 95  VNIYSHMVPGLCALFMLLIDINIIKKFPTTTFVDYFMIDLFLAGAFSCLILSSAFHTLKS 154

Query: 141 HSLKISVFGNKLDYXXXXXXXXXXXXXXXYFGYHDDPFIFYIFSGITLCFGIACGIASLK 200
           HSL ++++GNKLDY               Y+G++D P+ F++FS IT+ FGIACG  SL 
Sbjct: 155 HSLFVAIYGNKLDYLGIVILIVTSMISILYYGFYDTPYFFHLFSTITILFGIACGTVSLA 214

Query: 201 DKFRTREWRPYRAALFVLFGLSGVLPIIAGIMKYGIREVFERVQLKWIIWEGVLYIFGAF 260
           +KFR+REWRPYRA LFV FGLS V P++ GI  YG+ + F+R+QLKWI+ EG  YIFGAF
Sbjct: 215 NKFRSREWRPYRATLFVCFGLSAVFPVLTGIWYYGLEDTFKRIQLKWIVTEGFFYIFGAF 274

Query: 261 LYGARFPEKFMPGKVDIWGQSHQIFHVLVVIAALCHLRGLIGSYELVHQKL 311
           LY  R+PE+  PG  D+WG SHQIFHV VVIAA  H  GL+ +YE  H+ L
Sbjct: 275 LYAMRYPERICPGAFDLWGHSHQIFHVFVVIAAYSHFHGLLSAYEYAHEML 325

>SAKL0C09218g Chr3 (839747..840691) [945 bp, 314 aa] {ON} similar to
           uniprot|Q6Q557 Saccharomyces cerevisiae YDR492W IZH1
           Membrane protein involved in zinc metabolism member of
           the four-protein IZH family transcription is regulated
           directly by Zap1p expression induced by zinc deficiency
           and fatty acids deletion increases sensitivity to
           elevated zinc
          Length = 314

 Score =  271 bits (694), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 142/313 (45%), Positives = 189/313 (60%), Gaps = 15/313 (4%)

Query: 3   TEVQRRKLT-SSTEEGVELLYGDNQQQLNTSGSSGKRLYTWDEIPVWQHDNEYIYTGYVR 61
           T  QRRK T  ++ E +    G             KRL T++E+P WQ DNE I  GYVR
Sbjct: 6   TVRQRRKTTQKASAESIATAKGR------------KRLCTFEELPDWQKDNELILDGYVR 53

Query: 62  ETNSMKESFLSLFYIHNESVNIYTHLIPAFCFLSMLLFNT--YGVKPHPTTTYGDYVAID 119
           ET S+ E F SL Y HNE+VNIYTHL+P   +L ML+F T    +   P++T  DY+ I+
Sbjct: 54  ETRSVSECFKSLLYFHNETVNIYTHLVPGVTYLLMLMFLTDFILIPKFPSSTMTDYIIIN 113

Query: 120 LFFIGAFTCLGLSSTFHCFKSHSLKISVFGNKLDYXXXXXXXXXXXXXXXYFGYHDDPFI 179
            F +GAF CL  SS FHC K HS + S   +K+DY               Y+G+HD  F 
Sbjct: 114 FFLLGAFVCLMCSSCFHCLKQHSEEHSDIWSKVDYMGIIVLISCSMVSILYYGFHDHLFH 173

Query: 180 FYIFSGITLCFGIACGIASLKDKFRTREWRPYRAALFVLFGLSGVLPIIAGIMKYGIREV 239
           F IF+ +T+  G  C    L D+F ++ +R +RA+ FV FG SG++PII G++K+GI E 
Sbjct: 174 FKIFTVVTVILGSCCAAFVLNDRFNSKNFRVFRASFFVSFGFSGLVPIIFGLVKFGISES 233

Query: 240 FERVQLKWIIWEGVLYIFGAFLYGARFPEKFMPGKVDIWGQSHQIFHVLVVIAALCHLRG 299
             RVQLK++  E V YI GA  YG R PE F PGK D+ G SHQIFHV+VV+ +LCHLR 
Sbjct: 234 VHRVQLKYVGLEAVFYIGGAVFYGFRIPENFGPGKFDLVGHSHQIFHVMVVLGSLCHLRA 293

Query: 300 LIGSYELVHQKLD 312
           ++GSY  +H  ++
Sbjct: 294 VVGSYIFMHTGVN 306

>Skud_4.766 Chr4 (1354630..1355580) [951 bp, 316 aa] {ON} YDR492W
           (REAL)
          Length = 316

 Score =  270 bits (689), Expect = 7e-89,   Method: Compositional matrix adjust.
 Identities = 132/312 (42%), Positives = 186/312 (59%), Gaps = 2/312 (0%)

Query: 2   VTEVQRRKLTSSTEEGVELLYGDNQQQLNTSGSSGKRLYTWDEIPVWQHDNEYIYTGYVR 61
           +T  +RR   S   +           Q  T+    K L+ +DE+P WQ DN+ I TGYVR
Sbjct: 3   ITTTRRRNQESVCCKATTASIKVEAVQSKTASEKEKLLHNFDELPEWQKDNDKILTGYVR 62

Query: 62  ETNSMKESFLSLFYIHNESVNIYTHLIPAFCFL--SMLLFNTYGVKPHPTTTYGDYVAID 119
           ET S K+   SLFY +NE+VNIYTHL+PA  +   ++ L N + +   P+T++ DY  I+
Sbjct: 63  ETLSWKKCLRSLFYWNNETVNIYTHLVPAIIYFLFAITLTNYFLIPVFPSTSWSDYTVIN 122

Query: 120 LFFIGAFTCLGLSSTFHCFKSHSLKISVFGNKLDYXXXXXXXXXXXXXXXYFGYHDDPFI 179
           +F +GAF+CL  SS FHC K HS + S F +KLDY               YFGY D    
Sbjct: 123 IFLMGAFSCLMCSSCFHCLKQHSEEQSNFWSKLDYLGIISLISCSMIPIIYFGYFDHVSY 182

Query: 180 FYIFSGITLCFGIACGIASLKDKFRTREWRPYRAALFVLFGLSGVLPIIAGIMKYGIREV 239
           F +F+ +TL     C +  L +KF T  +RP+RA  F+LFG SG+LP+  G  K+GI+ V
Sbjct: 183 FSLFTTVTLVLATFCTVCVLHEKFNTSTFRPFRAMFFILFGFSGLLPLTTGFFKFGIQGV 242

Query: 240 FERVQLKWIIWEGVLYIFGAFLYGARFPEKFMPGKVDIWGQSHQIFHVLVVIAALCHLRG 299
             R+++ ++ WE + YI GA +YG R PE   PGK D  G SHQIFH++VV+ +LCHL+ 
Sbjct: 243 LNRIKVSFVFWEALFYISGAVIYGFRIPETIAPGKFDFLGSSHQIFHIMVVLGSLCHLKA 302

Query: 300 LIGSYELVHQKL 311
           +I SY+L+H  +
Sbjct: 303 IIDSYKLMHSHI 314

>CAGL0G04631g Chr7 (441149..442099) [951 bp, 316 aa] {ON} similar to
           uniprot|Q03419 Saccharomyces cerevisiae YDR492w
          Length = 316

 Score =  268 bits (685), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 140/312 (44%), Positives = 189/312 (60%), Gaps = 9/312 (2%)

Query: 3   TEVQRRKLTSSTEEGVELLYGDNQQQLNTSGS--SGKRLYTWDEIPVWQHDNEYIYTGYV 60
           T +++R   S  E G     G N   ++  G   S K L+ ++E+P WQ DN+ I  GYV
Sbjct: 5   TTLRKRASKSVGESG-----GRNDGSIHAHGEEKSEKLLWHFNELPEWQKDNDKILRGYV 59

Query: 61  RETNSMKESFLSLFYIHNESVNIYTHLIPAFCFLSMLLF--NTYGVKPHPTTTYGDYVAI 118
           RETNS K    SL Y++NESVNIYTHLIPA  ++S+ L+  N + +  +P+T+  DYV I
Sbjct: 60  RETNSFKRCLQSLLYLNNESVNIYTHLIPAVFYISLSLYLANVFLIPVYPSTSSVDYVII 119

Query: 119 DLFFIGAFTCLGLSSTFHCFKSHSLKISVFGNKLDYXXXXXXXXXXXXXXXYFGYHDDPF 178
           ++FF+GAF CL  SS FHC K HS       +KLDY               Y+GY D   
Sbjct: 120 NVFFLGAFFCLLCSSCFHCMKQHSESQCNVWSKLDYLGIICLISCSTVPMIYYGYFDHIS 179

Query: 179 IFYIFSGITLCFGIACGIASLKDKFRTREWRPYRAALFVLFGLSGVLPIIAGIMKYGIRE 238
            F IF+GITL   I C +  L DKF T E+RP RA+ F LFG SG++P+ AG +K+G   
Sbjct: 180 EFTIFTGITLLLAIGCSVFVLTDKFNTTEYRPIRASFFTLFGFSGIIPLGAGFLKFGAEG 239

Query: 239 VFERVQLKWIIWEGVLYIFGAFLYGARFPEKFMPGKVDIWGQSHQIFHVLVVIAALCHLR 298
           V +R+ L +I  E + YI GA +YG RFPE   PGK D +G SHQIFH++VV+ ++CHL 
Sbjct: 240 VLQRISLPFIGLEALFYISGAIIYGFRFPETIAPGKFDFFGSSHQIFHIMVVLGSICHLF 299

Query: 299 GLIGSYELVHQK 310
            ++ SY L+H  
Sbjct: 300 AMVESYHLIHSN 311

>KLTH0C09504g Chr3 complement(788442..789401) [960 bp, 319 aa] {ON}
           similar to uniprot|Q6Q557 Saccharomyces cerevisiae
           YDR492W IZH1 Membrane protein involved in zinc
           metabolism member of the four-protein IZH family
           transcription is regulated directly by Zap1p expression
           induced by zinc deficiency and fatty acids deletion
           increases sensitivity to elevated zinc
          Length = 319

 Score =  268 bits (684), Expect = 5e-88,   Method: Compositional matrix adjust.
 Identities = 134/296 (45%), Positives = 184/296 (62%), Gaps = 5/296 (1%)

Query: 23  GDNQQQLNTSGSS--GKR-LYTWDEIPVWQHDNEYIYTGYVRETNSMKESFLSLFYIHNE 79
             N+ +  TSG++  GK  L  ++E+P WQ DN+ I  GYVRETNSMK+ F SL Y HNE
Sbjct: 15  APNKGKAGTSGATAPGKNGLCCFEELPDWQRDNDKILAGYVRETNSMKKCFESLTYFHNE 74

Query: 80  SVNIYTHLIPAFCFLSMLLFNT--YGVKPHPTTTYGDYVAIDLFFIGAFTCLGLSSTFHC 137
           +VNIYTHLIP+  +L ML+F T  + +   PTTT  DY+ I+ F +GAF CL  S+ FHC
Sbjct: 75  TVNIYTHLIPSGTYLVMLMFFTDLFLIPQFPTTTMSDYIMINFFLLGAFLCLMCSTCFHC 134

Query: 138 FKSHSLKISVFGNKLDYXXXXXXXXXXXXXXXYFGYHDDPFIFYIFSGITLCFGIACGIA 197
            K HS   S   +K+DY               Y+G++D  F F +F+   +  G  C   
Sbjct: 135 LKQHSEAQSNIWSKVDYMGIIVLISCSTVSLLYYGFYDYLFHFKMFTIAVVVLGSCCAAF 194

Query: 198 SLKDKFRTREWRPYRAALFVLFGLSGVLPIIAGIMKYGIREVFERVQLKWIIWEGVLYIF 257
            L D+F  + WR  RA  FV FG SG++PI+ G++K+GI E  +RVQL++++ E + YI 
Sbjct: 195 VLNDRFNAKNWRACRAGFFVTFGFSGIVPIVVGLVKFGIAESSKRVQLRFVLLEALFYIS 254

Query: 258 GAFLYGARFPEKFMPGKVDIWGQSHQIFHVLVVIAALCHLRGLIGSYELVHQKLDA 313
           GA +YG R PE  +PGK D  G SHQIFH+LVV+ +LCH R L+GSY  +H  + +
Sbjct: 255 GAVIYGFRIPETLLPGKFDFVGHSHQIFHILVVLGSLCHFRALLGSYFFMHTGISS 310

>YDR492W Chr4 (1434924..1435874) [951 bp, 316 aa] {ON}  IZH1Membrane
           protein involved in zinc ion homeostasis, member of the
           four-protein IZH family; transcription is regulated
           directly by Zap1p, expression induced by zinc deficiency
           and fatty acids; deletion increases sensitivity to
           elevated zinc
          Length = 316

 Score =  266 bits (681), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 132/312 (42%), Positives = 185/312 (59%), Gaps = 2/312 (0%)

Query: 2   VTEVQRRKLTSSTEEGVELLYGDNQQQLNTSGSSGKRLYTWDEIPVWQHDNEYIYTGYVR 61
           +T  +RR   S   +              T     K L+ +DE+P WQ DN+ I TGYVR
Sbjct: 3   ITTTRRRNQDSVCCKATRASIKVEAVSGQTVFEKQKLLHNFDELPEWQKDNDKILTGYVR 62

Query: 62  ETNSMKESFLSLFYIHNESVNIYTHLIPAFCFL--SMLLFNTYGVKPHPTTTYGDYVAID 119
           ET S K+   SLFY +NE+VNIYTHL+PA  +   ++ L N + +   P+T++ DY  I+
Sbjct: 63  ETLSWKKCLYSLFYWNNETVNIYTHLVPAIVYFVFAITLTNYFLIPVFPSTSWSDYTVIN 122

Query: 120 LFFIGAFTCLGLSSTFHCFKSHSLKISVFGNKLDYXXXXXXXXXXXXXXXYFGYHDDPFI 179
           +F +GAF+CL  SS FHC K HS K S F +KLDY               YFGY D    
Sbjct: 123 IFLMGAFSCLMCSSCFHCMKQHSEKQSNFWSKLDYLGIISLISCSMIPIIYFGYFDHISY 182

Query: 180 FYIFSGITLCFGIACGIASLKDKFRTREWRPYRAALFVLFGLSGVLPIIAGIMKYGIREV 239
           F +F+ +TL     C +  L DKF T  +RP+RA  F+LFG SG+LP+  G  K+GI+ V
Sbjct: 183 FSLFTIVTLVLATFCTVCVLHDKFNTSTFRPFRAMFFILFGFSGLLPLTTGFFKFGIQGV 242

Query: 240 FERVQLKWIIWEGVLYIFGAFLYGARFPEKFMPGKVDIWGQSHQIFHVLVVIAALCHLRG 299
             R+++ ++ WE + YI GA +YG R PE   PGK D +G SHQIFH++VV+ ++CHL+ 
Sbjct: 243 LNRIKVSFVFWEALFYISGAVIYGFRIPETLAPGKFDFFGSSHQIFHIMVVLGSVCHLKA 302

Query: 300 LIGSYELVHQKL 311
           +I SY+L+H  +
Sbjct: 303 IIDSYKLMHSHI 314

>TDEL0D05340 Chr4 (969608..970558) [951 bp, 316 aa] {ON} Anc_3.90
           YOL101C
          Length = 316

 Score =  266 bits (680), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 136/313 (43%), Positives = 185/313 (59%), Gaps = 11/313 (3%)

Query: 3   TEVQRRKLTSSTEEGVELLYGDNQQQLNTSGSSGKRLYTWDEIPVWQHDNEYIYTGYVRE 62
           T +++RK T    +         + + +  G  GK+LY ++E+P WQ DN+ I TGYVRE
Sbjct: 5   TTIRQRKTTVQETQ---------KARDSKDGIMGKKLYHFNELPEWQQDNDKILTGYVRE 55

Query: 63  TNSMKESFLSLFYIHNESVNIYTHLIPAFCFLSMLLFNT--YGVKPHPTTTYGDYVAIDL 120
           T S+     SL Y +NESVNIYTHL+ A  +  +LLF T    +   P+TT  DY+ I+ 
Sbjct: 56  TKSVLRCLDSLSYWNNESVNIYTHLLSAVAYFVLLLFFTDILLIPSFPSTTMTDYIIINF 115

Query: 121 FFIGAFTCLGLSSTFHCFKSHSLKISVFGNKLDYXXXXXXXXXXXXXXXYFGYHDDPFIF 180
           + +GAF CL  SS FHCFK HS   S   +K+DY               Y+GY D  F F
Sbjct: 116 YLLGAFVCLMCSSCFHCFKQHSNSQSDAWSKVDYMGIIGLISCSVISLLYYGYFDHVFYF 175

Query: 181 YIFSGITLCFGIACGIASLKDKFRTREWRPYRAALFVLFGLSGVLPIIAGIMKYGIREVF 240
            +FS IT+   +AC +  L D+F T + RP RA+ F+ F  S V+PI  G+ K+G  EVF
Sbjct: 176 KLFSVITVVLAMACSVCVLSDRFNTSDMRPLRASFFITFAFSSVIPIATGMFKFGWTEVF 235

Query: 241 ERVQLKWIIWEGVLYIFGAFLYGARFPEKFMPGKVDIWGQSHQIFHVLVVIAALCHLRGL 300
            RVQL+++ WE   Y+ GA LYG R PE   PGK D  G SHQ+FHVLVV+ + CHLR +
Sbjct: 236 HRVQLRFVGWEAFFYLSGALLYGYRIPETIAPGKFDFIGSSHQLFHVLVVLGSFCHLRAV 295

Query: 301 IGSYELVHQKLDA 313
           +GSY  +H  ++A
Sbjct: 296 MGSYMFMHAHINA 308

>Smik_4.769 Chr4 (1356263..1357213) [951 bp, 316 aa] {ON} YDR492W
           (REAL)
          Length = 316

 Score =  266 bits (680), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 128/284 (45%), Positives = 178/284 (62%), Gaps = 2/284 (0%)

Query: 30  NTSGSSGKRLYTWDEIPVWQHDNEYIYTGYVRETNSMKESFLSLFYIHNESVNIYTHLIP 89
            T     K L+ +DE+P WQ DN+ I TGYVRET S K+   SLFY +NE+VNIYTHL+P
Sbjct: 31  TTVSEKKKLLHNFDELPEWQKDNDKILTGYVRETLSWKKCLYSLFYWNNETVNIYTHLVP 90

Query: 90  AFCFL--SMLLFNTYGVKPHPTTTYGDYVAIDLFFIGAFTCLGLSSTFHCFKSHSLKISV 147
           A  +   ++ L N + +   P+T++ DY  I++F +GAF+CL  SS FHC K HS K S 
Sbjct: 91  AVIYFVFAITLTNYFLIPVFPSTSWSDYTVINIFLMGAFSCLMCSSCFHCMKQHSEKQSN 150

Query: 148 FGNKLDYXXXXXXXXXXXXXXXYFGYHDDPFIFYIFSGITLCFGIACGIASLKDKFRTRE 207
           F +KLDY               YFGY D    F +F+ +TL     C +  L +KF T  
Sbjct: 151 FWSKLDYLGIISLISCSMIPIIYFGYFDHISYFSLFTIVTLVLATFCTVCVLHEKFNTST 210

Query: 208 WRPYRAALFVLFGLSGVLPIIAGIMKYGIREVFERVQLKWIIWEGVLYIFGAFLYGARFP 267
           +RP+RA  F+LFG SG+LP+  G  K+GI+ V  R+++ ++ WE + YI GA +YG R P
Sbjct: 211 FRPFRAMFFILFGFSGLLPLTTGFFKFGIQGVLNRIKVSFVFWEALFYISGAVIYGFRIP 270

Query: 268 EKFMPGKVDIWGQSHQIFHVLVVIAALCHLRGLIGSYELVHQKL 311
           E   PGK D  G SHQIFH++VV+ ++CHL+ +IGSY+L+H  +
Sbjct: 271 ETLAPGKFDFLGSSHQIFHIMVVLGSICHLKAIIGSYKLMHSHI 314

>TPHA0A00640 Chr1 complement(115042..116025) [984 bp, 327 aa] {ON}
           Anc_3.90 YOL101C
          Length = 327

 Score =  266 bits (679), Expect = 4e-87,   Method: Compositional matrix adjust.
 Identities = 138/313 (44%), Positives = 186/313 (59%), Gaps = 8/313 (2%)

Query: 3   TEVQRRKLTSSTEEGVELLYGDNQQQLNTSGSSGKRLYTWDEIPVWQHDNEYIYTGYVRE 62
           +++ RR+ + S + G  LL     +      +  K+LY++ E+P WQ DNE I  GYVRE
Sbjct: 15  SKLSRRRFSVS-KNGTVLL-----ESTEIVETYSKKLYSFHELPEWQKDNELIIQGYVRE 68

Query: 63  TNSMKESFLSLFYIHNESVNIYTHLIPAFCFLSMLLFNT--YGVKPHPTTTYGDYVAIDL 120
           TNS  + F SL Y HNES+NIYTHLIP   +  MLLF T    V   P+TT  DY+ ID 
Sbjct: 69  TNSWFKCFHSLSYFHNESINIYTHLIPGLVYFIMLLFYTDLLVVPSFPSTTIMDYIVIDF 128

Query: 121 FFIGAFTCLGLSSTFHCFKSHSLKISVFGNKLDYXXXXXXXXXXXXXXXYFGYHDDPFIF 180
           + +GAF CL  SS FHC K HS   S F +K+DY               Y+GY D    F
Sbjct: 129 YLLGAFICLVGSSCFHCLKQHSEDQSNFWSKIDYVGIICLISCSLISLLYYGYFDHFIYF 188

Query: 181 YIFSGITLCFGIACGIASLKDKFRTREWRPYRAALFVLFGLSGVLPIIAGIMKYGIREVF 240
            +F+ ITL     C +  L ++F  + +RP RA  FV+F  S V+PI  G++K+   EV 
Sbjct: 189 KVFTLITLILATICTVCVLDERFNAKNFRPIRAGFFVVFATSAVIPICTGLIKFDYVEVI 248

Query: 241 ERVQLKWIIWEGVLYIFGAFLYGARFPEKFMPGKVDIWGQSHQIFHVLVVIAALCHLRGL 300
            R+QL+++ WE   Y+ GA LYG R PE F PG+ D+ G SHQIFHV+VVI +L HL+ +
Sbjct: 249 NRIQLRFVGWETFFYVVGALLYGYRIPEIFAPGRFDLVGSSHQIFHVMVVIGSLFHLKAV 308

Query: 301 IGSYELVHQKLDA 313
           IGSYE +H+ L+ 
Sbjct: 309 IGSYEFMHKSLNV 321

>Suva_2.668 Chr2 (1186763..1187710) [948 bp, 315 aa] {ON} YDR492W
           (REAL)
          Length = 315

 Score =  263 bits (671), Expect = 4e-86,   Method: Compositional matrix adjust.
 Identities = 135/315 (42%), Positives = 187/315 (59%), Gaps = 13/315 (4%)

Query: 2   VTEVQRRK-----LTSSTEEGVELLYGDNQQQLNTSGSSGKRLYTWDEIPVWQHDNEYIY 56
           +T  +RR        +ST   VE L      +   +    K L+ + E+P WQ DN+ I 
Sbjct: 3   ITATRRRNQENVCCKTSTSIKVEAL------KSKVTLRKEKLLHDFHELPDWQRDNDKIL 56

Query: 57  TGYVRETNSMKESFLSLFYIHNESVNIYTHLIPAFCFL--SMLLFNTYGVKPHPTTTYGD 114
           TGYVRET S K+   SLFY +NE+VNIYTHL+PA  +    + L N + +   P+TT+ D
Sbjct: 57  TGYVRETLSWKKCLYSLFYWNNETVNIYTHLVPAIVYFVFGVTLTNYFLIPVFPSTTWSD 116

Query: 115 YVAIDLFFIGAFTCLGLSSTFHCFKSHSLKISVFGNKLDYXXXXXXXXXXXXXXXYFGYH 174
           Y  I++F +GAF CL  SS FHC K HS K S F +KLDY               YFGY 
Sbjct: 117 YTVINIFLMGAFLCLMCSSCFHCMKQHSEKQSDFWSKLDYLGIISLISCSMIPIIYFGYF 176

Query: 175 DDPFIFYIFSGITLCFGIACGIASLKDKFRTREWRPYRAALFVLFGLSGVLPIIAGIMKY 234
           D    F +F+ +TL     C I  L DKF T  +RP+RA  F+LFG SG+LP+  G+ K+
Sbjct: 177 DHASYFSLFTIVTLVLATFCTICVLHDKFNTSTFRPFRAMFFILFGFSGLLPLTTGLFKF 236

Query: 235 GIREVFERVQLKWIIWEGVLYIFGAFLYGARFPEKFMPGKVDIWGQSHQIFHVLVVIAAL 294
           G++ V  R+++ ++ WE + YI GA +YG R PE   PGK D +G SHQIFH++VV+ ++
Sbjct: 237 GLQGVLNRIRVSFVFWEALFYISGALIYGFRIPETLAPGKFDFFGSSHQIFHIMVVLGSV 296

Query: 295 CHLRGLIGSYELVHQ 309
           CHL+ +I SY+L+H 
Sbjct: 297 CHLKAIIDSYKLMHS 311

>Kwal_56.22704 s56 (244431..245393) [963 bp, 320 aa] {ON} YDR492W -
           Hypothetical ORF [contig 184] FULL
          Length = 320

 Score =  262 bits (669), Expect = 9e-86,   Method: Compositional matrix adjust.
 Identities = 135/311 (43%), Positives = 183/311 (58%), Gaps = 9/311 (2%)

Query: 6   QRRKLTSSTEEGVELLYGDNQQQLNTSGSSGKRLYTWDEIPVWQHDNEYIYTGYVRETNS 65
           QRR    +     EL  G N +    +  S   L  ++E+P WQ DNE I  GYVRET S
Sbjct: 9   QRRSACKN-----ELKNGKNSKSAEQTKKSA--LCRFEELPEWQRDNEKILAGYVRETRS 61

Query: 66  MKESFLSLFYIHNESVNIYTHLIPAFCFLSMLLFNT-YGVKPH-PTTTYGDYVAIDLFFI 123
           M++   SL Y HNE++NIYTHLIP+  +L +L+F T   + PH P+TT  DY+ I+ + +
Sbjct: 62  MRKCLESLTYFHNETLNIYTHLIPSGTYLVLLMFFTDVFLIPHFPSTTMSDYIMINFYLL 121

Query: 124 GAFTCLGLSSTFHCFKSHSLKISVFGNKLDYXXXXXXXXXXXXXXXYFGYHDDPFIFYIF 183
           GAF CL  S+ FHC K HS   S   +K+DY               Y+G+HD  F F IF
Sbjct: 122 GAFLCLLCSTCFHCLKQHSEAQSNIWSKVDYMGIIVLISCSTVSLLYYGFHDYLFHFKIF 181

Query: 184 SGITLCFGIACGIASLKDKFRTREWRPYRAALFVLFGLSGVLPIIAGIMKYGIREVFERV 243
           +   +  G  C    L D+F  + WR  RA  FV FG SG++PII G++K+G+ E  +RV
Sbjct: 182 TIAVVVLGSCCAAFVLNDRFNAKNWRACRAGFFVTFGFSGIVPIIMGLVKFGVAESSKRV 241

Query: 244 QLKWIIWEGVLYIFGAFLYGARFPEKFMPGKVDIWGQSHQIFHVLVVIAALCHLRGLIGS 303
           QL++++ E   YI GA +YG R PE  +PGK D  G SHQIFH+LVV+ +LCH R LIGS
Sbjct: 242 QLRFVLLEAFFYIGGAIIYGFRIPETLIPGKFDFVGHSHQIFHILVVLGSLCHFRALIGS 301

Query: 304 YELVHQKLDAQ 314
           Y  +H  + + 
Sbjct: 302 YFFMHTGISSS 312

>AFR337W Chr6 (1051645..1052598) [954 bp, 317 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR492W (IZH1) and
           YOL101C (IZH4)
          Length = 317

 Score =  259 bits (661), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 133/300 (44%), Positives = 179/300 (59%), Gaps = 8/300 (2%)

Query: 13  STEEGV-ELLYGDNQQQLNTSGSSG-----KRLYTWDEIPVWQHDNEYIYTGYVRETNSM 66
           S E G+ E    +  Q++  + S G     ++LYT+DE+P WQ DNE I +GYVRETNS+
Sbjct: 2   SEERGMKEQTISEMAQEMAHTTSEGLKKRIRKLYTFDELPAWQKDNELILSGYVRETNSV 61

Query: 67  KESFLSLFYIHNESVNIYTHLIPAFCFLSMLLFNTYGVKPH--PTTTYGDYVAIDLFFIG 124
           KE   ++ Y +NES+NIYTHLIP   +L + L     V     P    G++  +  + +G
Sbjct: 62  KECLRAMTYFNNESINIYTHLIPGVAYLVLFLIFADLVLAQLLPGLDAGEHRMLRFYLLG 121

Query: 125 AFTCLGLSSTFHCFKSHSLKISVFGNKLDYXXXXXXXXXXXXXXXYFGYHDDPFIFYIFS 184
           AFTCL  SS FHC K HS   S   +K+DY               Y+GYH  P  F  FS
Sbjct: 122 AFTCLACSSCFHCLKQHSEPHSRLWSKVDYLGILAQITCSTISLLYYGYHSYPSHFVFFS 181

Query: 185 GITLCFGIACGIASLKDKFRTREWRPYRAALFVLFGLSGVLPIIAGIMKYGIREVFERVQ 244
            +T+    AC +  L D F T  +RP RA LF+ FGLSGV+P++AG  ++G  E   R+Q
Sbjct: 182 TLTVALCSACAVLVLNDSFNTVAFRPLRAFLFMAFGLSGVIPVLAGSYQFGFAEWAARIQ 241

Query: 245 LKWIIWEGVLYIFGAFLYGARFPEKFMPGKVDIWGQSHQIFHVLVVIAALCHLRGLIGSY 304
           LK++++E V YI GA +YG R PE+F PGK D+ G SHQIFH+LVV+  LCH R + GSY
Sbjct: 242 LKYVLYEAVFYITGALVYGFRIPERFAPGKFDMVGHSHQIFHLLVVLGTLCHFRAVTGSY 301

>NCAS0I02570 Chr9 complement(480266..481210) [945 bp, 314 aa] {ON}
           Anc_3.90 YDR492W
          Length = 314

 Score =  258 bits (658), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 139/312 (44%), Positives = 182/312 (58%), Gaps = 11/312 (3%)

Query: 7   RRKLTSSTEEGVELLYGDNQQQLN---TSGSSGKRLYTWDEIPVWQHDNEYIYTGYVRET 63
           RRK T      V    G + +  +   T  +  +RL+ ++E+P WQ DN+ I TGYVRET
Sbjct: 8   RRKPTKVQAVAV----GSSNKHADGDKTKRNWKRRLFNFNELPEWQRDNDKILTGYVRET 63

Query: 64  NSMKESFLSLFYIHNESVNIYTHLIPAFCFL--SMLLFNTYGVKPH-PTTTYGDYVAIDL 120
            S K+   SL Y +NE++NIYTHLIPA  +L  S+ L N Y V PH PTT+  DY  I++
Sbjct: 64  KSFKQCLQSLLYWNNETINIYTHLIPALFYLTISVTLIN-YVVVPHFPTTSIMDYFVINV 122

Query: 121 FFIGAFTCLGLSSTFHCFKSHSLKISVFGNKLDYXXXXXXXXXXXXXXXYFGYHDDPFIF 180
           F +GAF CL LSS FHC K HS +     +KLDY               YFGY D  +  
Sbjct: 123 FLMGAFVCLILSSCFHCLKQHSSRQCTLWSKLDYMGIIILISCSLIPMIYFGYFDHLYYV 182

Query: 181 YIFSGITLCFGIACGIASLKDKFRTREWRPYRAALFVLFGLSGVLPIIAGIMKYGIREVF 240
             F  +T  F   C I  L +KF    +RP+RA +F+LF  SG +PI+ G   +G   VF
Sbjct: 183 NFFIILTFSFATLCSICVLNEKFNVPHYRPFRAIVFMLFSFSGFIPILTGFYLFGFHGVF 242

Query: 241 ERVQLKWIIWEGVLYIFGAFLYGARFPEKFMPGKVDIWGQSHQIFHVLVVIAALCHLRGL 300
           ERV LK++ WE + YI GA LYG R PE F PG  D  G SHQIFH+LVV+ ++CH R +
Sbjct: 243 ERVALKFVAWEALFYITGATLYGFRIPECFKPGDFDFLGSSHQIFHILVVLGSICHFRAV 302

Query: 301 IGSYELVHQKLD 312
           I SY L+H  ++
Sbjct: 303 IKSYILMHSSMN 314

>NDAI0A07160 Chr1 complement(1630482..1631474) [993 bp, 330 aa] {ON}
           Anc_3.90
          Length = 330

 Score =  257 bits (656), Expect = 9e-84,   Method: Compositional matrix adjust.
 Identities = 128/295 (43%), Positives = 174/295 (58%), Gaps = 5/295 (1%)

Query: 23  GDNQQQLNTSGSSGK-RLYTWDEIPVWQHDNEYIYTGYVRETNSMKESFLSLFYIHNESV 81
            D  Q+  T+    K  L  +DE+P WQ DN+ I TGYVRETNS    F SLFY++NE++
Sbjct: 36  NDTSQKPKTNRRKRKIHLSKFDELPEWQKDNDKILTGYVRETNSFIHCFQSLFYLNNETI 95

Query: 82  NIYTHLIPAFCFL----SMLLFNTYGVKPHPTTTYGDYVAIDLFFIGAFTCLGLSSTFHC 137
           NIYTHLIP+  +L    + +  N   +   PTT+  DY+ I++F +GAFTCL LSS FHC
Sbjct: 96  NIYTHLIPSIIYLIVSLTFIFINFIAIPKFPTTSVIDYIVINIFILGAFTCLLLSSCFHC 155

Query: 138 FKSHSLKISVFGNKLDYXXXXXXXXXXXXXXXYFGYHDDPFIFYIFSGITLCFGIACGIA 197
            K HS K     +KLDY               YFGY D    F  F+ +T  F I C I 
Sbjct: 156 LKQHSFKQCTLWSKLDYIGIIILISCSIIPILYFGYFDRLSYFKFFTILTFSFAIVCSII 215

Query: 198 SLKDKFRTREWRPYRAALFVLFGLSGVLPIIAGIMKYGIREVFERVQLKWIIWEGVLYIF 257
            L +KF    +RP RA LF+LF  +G++P+I G   +G + V ER+ L +++ E + YI 
Sbjct: 216 VLNEKFDLPSYRPLRAGLFMLFSFTGLIPMITGFYIFGYKGVMERISLNFVLLEAIFYII 275

Query: 258 GAFLYGARFPEKFMPGKVDIWGQSHQIFHVLVVIAALCHLRGLIGSYELVHQKLD 312
           G  LYG R PE F PG  D++G SHQIFH+ VV+ ++CH   +I SY L+H  ++
Sbjct: 276 GTLLYGFRIPETFKPGNFDMFGSSHQIFHIFVVLGSICHFGAVIKSYCLMHHLIN 330

>ZYRO0B06556g Chr2 (526478..527434) [957 bp, 318 aa] {ON} similar to
           uniprot|Q6Q557 Saccharomyces cerevisiae YDR492W IZH1
           Membrane protein involved in zinc metabolism member of
           the four-protein IZH family transcription is regulated
           directly by Zap1p expression induced by zinc deficiency
           and fatty acids deletion increases sensitivity to
           elevated zinc
          Length = 318

 Score =  256 bits (653), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 142/322 (44%), Positives = 191/322 (59%), Gaps = 15/322 (4%)

Query: 2   VTEVQRRKLTSSTEEGVELLYGDNQQQLNTSGSSGKRLYTWDEIPVWQHDNEYIYTGYVR 61
           +TEV+RR++      G E LY +  ++        K LY + E+P WQ DN+ I TGY+R
Sbjct: 4   ITEVKRRRVPIGNGNG-EGLYKEVLEE--------KTLYDFHELPEWQQDNDKILTGYIR 54

Query: 62  ETNSMKESFLSLFYIHNESVNIYTHLIPAFC-FLSMLLFNTYGVKPH-PTTTYGDYVAID 119
           ET S+ +   SLF  +NE+VNIYTHL+ A   FL ML      + PH PT+T+ DY  I+
Sbjct: 55  ETKSVLKCVRSLFIWNNETVNIYTHLVSAVSYFLLMLGITDLVMVPHFPTSTFTDYSVIN 114

Query: 120 LFFIGAFTCLGLSSTFHCFKSHSLKISVFGNKLDYXXXXXXXXXXXXXXXYFGYHDDPFI 179
            + +GAF CL  SS FH FK HS   S   +K+DY               Y+G+ D    
Sbjct: 115 FYLLGAFGCLMCSSCFHTFKQHSGPHSDAWSKVDYMGIIVLITCSMISLIYYGFFDHMEY 174

Query: 180 FYIFSGITLCFGIACGIASLKDKFRTREWRPYRAALFVLFGLSGVLPIIAGIMKYGIREV 239
           F +F+ +TL    AC +  L DKF  +++RP RA  F+ FGLSGV P+ AGI+K+GI+  
Sbjct: 175 FRLFTVLTLTLATACTVCVLSDKFNHKDFRPLRAGFFIAFGLSGVFPVAAGIIKFGIQGG 234

Query: 240 FERVQLKWIIWEGVLYIFGAFLYGARFPEKFMPGKVDIWGQSHQIFHVLVVIAALCHLRG 299
            +RVQLK++  E + YI GA +YG R PE   PG+ D WG SHQIFHVLVVIA+  HL+ 
Sbjct: 235 VQRVQLKYLGLEAIFYIAGALIYGFRIPETMFPGRFDFWGHSHQIFHVLVVIASFLHLKA 294

Query: 300 LIGSYELVHQKLD----AQLQS 317
           ++GSY   H  L+    A LQS
Sbjct: 295 VMGSYIFKHSHLNGVGLAALQS 316

>KLLA0C12441g Chr3 complement(1057427..1058374) [948 bp, 315 aa]
           {ON} similar to uniprot|Q6Q557 Saccharomyces cerevisiae
           YDR492W IZH1 Membrane protein involved in zinc
           metabolism member of the four-protein IZH family
           transcription is regulated directly by Zap1p expression
           induced by zinc deficiency and fatty acids deletion
           increases sensitivity to elevated zinc
          Length = 315

 Score =  255 bits (652), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 124/281 (44%), Positives = 171/281 (60%), Gaps = 2/281 (0%)

Query: 33  GSSGKRLYTWDEIPVWQHDNEYIYTGYVRETNSMKESFLSLFYIHNESVNIYTHLIPAFC 92
            S+ KRLY + E+P WQ DN+ I TGY+RET S+KE   SLF  HNES+NIY+HL+P   
Sbjct: 26  SSTIKRLYRYSELPEWQQDNDKIITGYIRETKSVKECVKSLFLFHNESINIYSHLVPTIT 85

Query: 93  FLSML--LFNTYGVKPHPTTTYGDYVAIDLFFIGAFTCLGLSSTFHCFKSHSLKISVFGN 150
           +L +L  L + + V   P +T    V I  F +G+  CLG SS FHC K HS       +
Sbjct: 86  YLVLLVGLADMFLVPQFPNSTMMQSVMIHFFLLGSVLCLGCSSFFHCLKQHSESHCHIWS 145

Query: 151 KLDYXXXXXXXXXXXXXXXYFGYHDDPFIFYIFSGITLCFGIACGIASLKDKFRTREWRP 210
           K+DY               Y+G+HD  F F  F+  T+  G  C + +L DKF ++ +RP
Sbjct: 146 KVDYMGIIIMITCSIISLLYYGFHDHIFHFKCFTVFTVILGTICTVFALHDKFNSKTFRP 205

Query: 211 YRAALFVLFGLSGVLPIIAGIMKYGIREVFERVQLKWIIWEGVLYIFGAFLYGARFPEKF 270
           +RA  +V FGLSG++PI+ G  K+G  E   RVQLK+++ E + YI GA +YG RFPE  
Sbjct: 206 FRAMFYVTFGLSGIVPIVTGFWKFGAYEAIRRVQLKYVLLEAMFYIAGAVIYGFRFPEVL 265

Query: 271 MPGKVDIWGQSHQIFHVLVVIAALCHLRGLIGSYELVHQKL 311
            PGK D  G SHQIFH++VV+ ++CH R ++GSY  +H  +
Sbjct: 266 APGKFDFVGHSHQIFHIMVVLGSICHFRAILGSYVFMHTGM 306

>Kpol_1053.26 s1053 complement(40099..41073) [975 bp, 324 aa] {ON}
           complement(40099..41073) [975 nt, 325 aa]
          Length = 324

 Score =  251 bits (640), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 122/279 (43%), Positives = 171/279 (61%), Gaps = 2/279 (0%)

Query: 38  RLYTWDEIPVWQHDNEYIYTGYVRETNSMKESFLSLFYIHNESVNIYTHLIPAFCFLSML 97
           +L  + E+P WQ DNE+I TGYVRETNS+K+   SL   +NES+NIY+HLI A  +  +L
Sbjct: 40  KLCHFHELPDWQKDNEFILTGYVRETNSIKKCLRSLGCFNNESINIYSHLIAAISYFVVL 99

Query: 98  LFNT--YGVKPHPTTTYGDYVAIDLFFIGAFTCLGLSSTFHCFKSHSLKISVFGNKLDYX 155
           LF T    +   P+TT+ DY+ IDL+ +GAFTCL  SS FHC K HS   S   +K+DY 
Sbjct: 100 LFYTDILCIPSFPSTTFVDYMVIDLYLLGAFTCLIGSSLFHCMKQHSESHSDMWSKVDYI 159

Query: 156 XXXXXXXXXXXXXXYFGYHDDPFIFYIFSGITLCFGIACGIASLKDKFRTREWRPYRAAL 215
                         Y+GY D    F +F+ ITL     C I  L  +F ++ +RP RA  
Sbjct: 160 GIICLITCSLISLLYYGYMDHFIYFKVFTVITLVLATICTICVLDQRFNSKNFRPIRAGF 219

Query: 216 FVLFGLSGVLPIIAGIMKYGIREVFERVQLKWIIWEGVLYIFGAFLYGARFPEKFMPGKV 275
           F+LF +S V+PI AG  K+G  EV +R+QL+++ WE   Y+ GA LYG R PE   PG  
Sbjct: 220 FILFSMSAVIPIGAGFSKFGFTEVLQRIQLRFVAWETFFYVVGALLYGFRIPETLYPGNF 279

Query: 276 DIWGQSHQIFHVLVVIAALCHLRGLIGSYELVHQKLDAQ 314
           D+ G SHQIFH++V++ ++ HL+ ++GSY  +H  + + 
Sbjct: 280 DLVGSSHQIFHIMVILGSVFHLKAVLGSYTFMHSNISSN 318

>TBLA0B02290 Chr2 complement(534472..535452) [981 bp, 326 aa] {ON}
           Anc_3.90 YOL101C
          Length = 326

 Score =  241 bits (614), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 131/315 (41%), Positives = 180/315 (57%), Gaps = 12/315 (3%)

Query: 2   VTEVQRRKLTSSTEEGVELLYGDNQQQLNTSGSSGKRLYTWDEIPVWQHDNEYIYTGYVR 61
           +T  + + ++S   +  E    D +Q++     +   LYT++E+P WQ DNE I TGY+R
Sbjct: 15  LTHHRSKSISSILSQAAE----DVKQKI-----TDTLLYTYEELPSWQQDNEMILTGYIR 65

Query: 62  ETNSMKESFLSLFYIHNESVNIYTHLIPAFCFLSMLLF---NTYGVKPHPTTTYGDYVAI 118
           ETNS K    SL + HNE++NIY+H I A  +L +L+F   N   +   PTTT  DY+ +
Sbjct: 66  ETNSWKLCLRSLTFFHNETINIYSHGISAAIYLLLLVFFFTNLIYLPSFPTTTLHDYLVL 125

Query: 119 DLFFIGAFTCLGLSSTFHCFKSHSLKISVFGNKLDYXXXXXXXXXXXXXXXYFGYHDDPF 178
           D++ +GA TCL LSS FHC K HS   S   +K+DY               YFGY D   
Sbjct: 126 DIYLLGAATCLTLSSCFHCLKQHSQSQSDIWSKMDYIGIICLITCSTISLLYFGYRDHFN 185

Query: 179 IFYIFSGITLCFGIACGIASLKDKFRTREWRPYRAALFVLFGLSGVLPIIAGIMKYGIRE 238
            F  F+  T    I C +    +KF TR+W+  RA  F+ F  SG++P+I GI  +G  E
Sbjct: 186 YFKFFAISTFILAITCTVFVTMEKFNTRDWKHVRALFFIAFAGSGLIPLITGINIFGFPE 245

Query: 239 VFERVQLKWIIWEGVLYIFGAFLYGARFPEKFMPGKVDIWGQSHQIFHVLVVIAALCHLR 298
           V++RVQL  +  E + Y+ GA LYG R PE F PGK D  G SHQ FH+ VV+ +L HLR
Sbjct: 246 VWQRVQLPSLTLELICYVIGALLYGYRIPEVFAPGKFDNIGNSHQWFHIFVVLGSLLHLR 305

Query: 299 GLIGSYELVHQKLDA 313
            L+GSY  +H  L A
Sbjct: 306 ALVGSYYFMHSFLLA 320

>KAFR0A08130 Chr1 (1638153..1639112) [960 bp, 319 aa] {ON} Anc_3.90
           YOL101C
          Length = 319

 Score =  237 bits (605), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 123/314 (39%), Positives = 179/314 (57%), Gaps = 11/314 (3%)

Query: 6   QRRKLTSSTEEGVELLYGDNQQQLNTSGSSGKRLYTWDEIPVWQHDNEYIYTGYVRETNS 65
           +R K   S +  +     D+  ++       + LY + E+P WQ DN+ I  GYVRETNS
Sbjct: 11  KRSKSFRSAKSTITRTRSDSSIKIEK-----RILYHFHELPTWQQDNDKILGGYVRETNS 65

Query: 66  MKESFLSLFYIHNESVNIYTHLIPAFCFLS---MLLFNT---YGVKPHPTTTYGDYVAID 119
             +   SLFY++NES+NIY+HLIP+  +L+   MLL        +  +PTTT  D++ I+
Sbjct: 66  FTKCIESLFYLNNESINIYSHLIPSLIYLTIAVMLLIEIDQFLNIPIYPTTTKYDFIFIN 125

Query: 120 LFFIGAFTCLGLSSTFHCFKSHSLKISVFGNKLDYXXXXXXXXXXXXXXXYFGYHDDPFI 179
           +F +GAF CL  S  FH  K HS     F +++DY               Y+G+ D   +
Sbjct: 126 IFLVGAFLCLLGSGCFHLLKQHSELQCNFWSRIDYMGIIVLISCSMMPVLYYGFFDHIVL 185

Query: 180 FYIFSGITLCFGIACGIASLKDKFRTREWRPYRAALFVLFGLSGVLPIIAGIMKYGIREV 239
           FY F  +TL F   C I  + + F   ++R  RA +F  FG SG++P+I G  K+G+  V
Sbjct: 186 FYCFITLTLAFASVCSIIVMSETFNLSKYRLLRACVFAAFGFSGLIPMIVGFSKFGLSGV 245

Query: 240 FERVQLKWIIWEGVLYIFGAFLYGARFPEKFMPGKVDIWGQSHQIFHVLVVIAALCHLRG 299
           F+R+ LK+I WE V Y+ GA LYG R PE  +PGK D++G SHQ+FH  VVI ++ H + 
Sbjct: 246 FQRISLKFIFWESVFYLVGATLYGFRIPESILPGKFDLFGSSHQLFHCFVVIGSVLHFKA 305

Query: 300 LIGSYELVHQKLDA 313
           +I SY L+H +  A
Sbjct: 306 VIESYILMHSRYTA 319

>KNAG0K02160 Chr11 (436744..437715) [972 bp, 323 aa] {ON} Anc_3.90
           YOL101C
          Length = 323

 Score =  237 bits (605), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 129/322 (40%), Positives = 192/322 (59%), Gaps = 11/322 (3%)

Query: 1   MVTEVQRR--KLTSSTEEGVELLYGDNQQQLNTSGSSGK------RLYTWDEIPVWQHDN 52
           M +E+++R   L  +  E   +  G   + L T  SSG       RL  ++E+P WQ DN
Sbjct: 1   MSSELRKRAVSLGETAIETATVSRGSRGKLLVTGTSSGAPSGQRGRLCRYEELPAWQQDN 60

Query: 53  EYIYTGYVRETNSMKESFLSLFYIHNESVNIYTHLIPAFCFLS--MLLFNTYGVKPHPTT 110
           + I TGYVRET S++    SL Y +NESVN+Y+HL+PA  +++   L  + +GV   PTT
Sbjct: 61  DCIRTGYVRETLSVRRCLGSLLYWNNESVNMYSHLVPAVLYIAGATLALSQWGVPRFPTT 120

Query: 111 TYGDYVAIDLFFIGAFTCLGLSSTFHCFKSHSLKISVFGNKLDYXXXXXXXXXXXXXXXY 170
           T+ DY+ I+ F +GA  CL  SS FHC K HS +     +++DY               Y
Sbjct: 121 TWSDYLIINTFLVGAGACLLCSSLFHCLKQHSERHCEAWSRMDYMGIILLIACSTIPMIY 180

Query: 171 FGYHDDPFIFYIFSGITLCFGIAC-GIASLKDKFRTREWRPYRAALFVLFGLSGVLPIIA 229
           FGY D      +F+ +T+  G+AC G+     +F +  ++  RAA F+ F  +G++P+  
Sbjct: 181 FGYFDYMGHCLLFTAVTVALGVACSGVVLFNKQFNSSSFKLVRAAFFIAFAFNGLIPMAT 240

Query: 230 GIMKYGIREVFERVQLKWIIWEGVLYIFGAFLYGARFPEKFMPGKVDIWGQSHQIFHVLV 289
           G +K+GI  V +R+ LK++ +E V YI GA LYG R PE ++PGKVD+WG SHQ+FHV+V
Sbjct: 241 GFVKFGIPGVLDRISLKYVWFEAVFYIAGAMLYGFRVPEIWIPGKVDLWGNSHQMFHVMV 300

Query: 290 VIAALCHLRGLIGSYELVHQKL 311
           V  +LCHL+ ++ SY L+H+ L
Sbjct: 301 VFGSLCHLKAVLESYSLMHRHL 322

>Ecym_3588 Chr3 (1117646..1118563) [918 bp, 305 aa] {ON} similar to
           Ashbya gossypii AFR337W
          Length = 305

 Score =  228 bits (581), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 120/271 (44%), Positives = 163/271 (60%), Gaps = 2/271 (0%)

Query: 36  GKRLYTWDEIPVWQHDNEYIYTGYVRETNSMKESFLSLFYIHNESVNIYTHLIPAFC-FL 94
            +RLY++DE+P WQ DNE I  GYVRETNS  E   S+ Y +NESVNIYTHL+P+   F+
Sbjct: 19  NRRLYSFDELPEWQKDNELIRMGYVRETNSFLECLKSMTYFNNESVNIYTHLVPSVTYFI 78

Query: 95  SMLLFNTYGVKPH-PTTTYGDYVAIDLFFIGAFTCLGLSSTFHCFKSHSLKISVFGNKLD 153
            +LLF    V P  P TT  +Y+ ID +  G F CL  S+ FHC K HS   +   +K+D
Sbjct: 79  LLLLFVDLVVTPMFPGTTMREYIMIDFYLFGVFVCLMCSTCFHCLKQHSESHNRIWSKVD 138

Query: 154 YXXXXXXXXXXXXXXXYFGYHDDPFIFYIFSGITLCFGIACGIASLKDKFRTREWRPYRA 213
           Y               Y+G++D        S +TL  G+ C    L D+F   ++R  RA
Sbjct: 139 YIGIIVQITSSIVSILYYGFYDHISHIKWLSVLTLTLGVCCVTFVLNDRFNAIDYRLLRA 198

Query: 214 ALFVLFGLSGVLPIIAGIMKYGIREVFERVQLKWIIWEGVLYIFGAFLYGARFPEKFMPG 273
             F +FG SGV+P++ GI ++G+ E   R+QLK+++   + YIFGA +YG R PE   PG
Sbjct: 199 IFFTVFGFSGVVPVLIGIYQFGLIEWLARIQLKFVLAGTIFYIFGALIYGFRIPEALAPG 258

Query: 274 KVDIWGQSHQIFHVLVVIAALCHLRGLIGSY 304
           K D  G SHQIFH+LVV+ ++CH R +IGSY
Sbjct: 259 KFDFIGHSHQIFHLLVVLGSICHFRAVIGSY 289

>TBLA0B08255 Chr2 (1973757..1974647) [891 bp, 296 aa] {ON}
          Length = 296

 Score =  146 bits (368), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 90/284 (31%), Positives = 135/284 (47%), Gaps = 28/284 (9%)

Query: 38  RLYTWDEIPVWQHDNEYIYTGYVRETNSMKESFLSLFYIHNESVNIYTHLIPAFCFLSML 97
           +L  ++++P WQ DN  I   YVRETNS+ +S  S+F  H+ES+NI+THLIPA      L
Sbjct: 7   QLCNFNDLPDWQKDNPLIVNYYVRETNSLFKSLCSIFLFHSESMNIFTHLIPA------L 60

Query: 98  LFNTYGVKPHPTTTYGDYVAIDLFFIGAFTCLGLSSTFHCFKSHSLKISVFGNKLDYXXX 157
           L+  +      T     Y  I  + I    C  LSS FH FK  S++ + F  KLDY   
Sbjct: 61  LYAKFTYNAITTLEQVSY-PIVFYLISVIICFLLSSLFHLFKCTSVQSNEFWGKLDYVGI 119

Query: 158 XXXXXXXXXXXXYFGYHDDPFIFY--IFSGITLCFGIACGIASLKDKFRTRE-------- 207
                         G+++  +      F   T C      I ++K   +  E        
Sbjct: 120 SLLINATIVSMALLGFNESRYTIMKNTFVTQTSCLTAYVIILAIKSHPKQGENEDDNDGT 179

Query: 208 -----------WRPYRAALFVLFGLSGVLPIIAGIMKYGIREVFERVQLKWIIWEGVLYI 256
                       +  RA LF   GLSG++P+I G+  YG + V+ ++ +  +I   + YI
Sbjct: 180 LSEDDDCCCDDHKGTRAKLFASLGLSGLIPVITGLYIYGPKVVYYKINIPMVIASVLCYI 239

Query: 257 FGAFLYGARFPEKFMPGKVDIWGQSHQIFHVLVVIAALCHLRGL 300
            G  +Y  + PEKF PG+ D+ G SHQ+FH+ +V   +CH   +
Sbjct: 240 VGTLIYVFKIPEKFYPGRFDLVGSSHQLFHIFIVFGTVCHYHAI 283

>NCAS0C04920 Chr3 complement(1003692..1004672) [981 bp, 326 aa] {ON}
           Anc_3.90
          Length = 326

 Score =  133 bits (335), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 94/318 (29%), Positives = 152/318 (47%), Gaps = 15/318 (4%)

Query: 10  LTSSTEE--GVELLYGDNQQQLNTSGSS------GKRLYTWDEIPVWQ--HDNEYIYTGY 59
           LTS+T++    E+   D     N    S       K L    E+P WQ  + N  I  GY
Sbjct: 4   LTSTTKKQTATEIQDADKLTPFNAPKYSVTFPRRPKVLPILKELPQWQKQYSNSKIINGY 63

Query: 60  VRETNSMKESFLSLFYIHNESVNIYTHLIPAFCFLSMLLFNT--YGVKPHPTTTYGDYVA 117
           VRETNS+ +   ++ Y +N++VNI  + + +  + ++LLF T  Y +   P TT  DY+ 
Sbjct: 64  VRETNSLIKCLHTVTYWNNQTVNIILNTVFSTVYFTLLLFFTDLYLIPSSPATTMSDYIM 123

Query: 118 IDLFFIGAFTCLGLSSTFHCFKSHSLKISVFGNKLDYXXXXXXXXXXXXXXXYFGYHDDP 177
           ++ +  GAF    L+S F+  +SHSL       KL +               Y+ + D+ 
Sbjct: 124 VNFYLFGAFQYFALNSIFYLLESHSLAKCHLWFKLSHLAFINYISTSIITQLYYTFFDNV 183

Query: 178 FIFYIFSGITLCFGIACGIASLKDKFRTREWRPYRAALFVLFGLS-GVLPIIAGIMKYGI 236
           F F   +  TL       I +L ++F  R+ R  R  + + F +S  +LP  + + K+  
Sbjct: 184 FYFKFLTISTLLISSIFAIFTLSEQF-LRKNRSQRNMVSITFIVSLLILPTASLMFKFNT 242

Query: 237 REVFERVQLKWIIWEGVLYIFGAFLYGARFPEKFMPGKVDIWGQSHQIFHVLVVIAALCH 296
             +  RV+ K I+ E  LY+F   L   + PE+F     D  G S  I+H+ +++ +L H
Sbjct: 243 FRILRRVEGKAILLELSLYLFSMTLKAVQVPERF-SENFDFIGNSENIYHICIILGSLLH 301

Query: 297 LRGLIGSYELVHQKLDAQ 314
            + L+ SY  +H  LDA 
Sbjct: 302 FKMLLNSYFFMHSGLDAS 319

>NDAI0G04300 Chr7 (1035664..1036620) [957 bp, 318 aa] {ON} Anc_3.90
          Length = 318

 Score =  122 bits (306), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 80/297 (26%), Positives = 145/297 (48%), Gaps = 9/297 (3%)

Query: 22  YGDNQQQLNTSGSSGKRLYTWDEIPVWQH--DNEYIYTGYVRETNSMKESFLSLFYIHNE 79
           Y  +++    S  S +  Y   E+P WQ   ++  + TG+++ETNS K+   S  Y HN 
Sbjct: 16  YPTSKRYTVISKLSTRNHYKLKELPEWQREFNSGKVITGFLKETNSFKKCLWSTMYWHNS 75

Query: 80  SVNIYTHLIPAFCFLSMLLFNT--YGVKPHPTTTYGDYVAIDLFFIGAFTCLGLSSTFHC 137
           S+NI  + I A  +  +L F T  Y +   P+TT  DY+ ++L+ + A     + + F+ 
Sbjct: 76  SINISLNGIAATVYFMLLFFFTDCYLIPSFPSTTMSDYIVLNLYLLTATQNFMVGTIFYI 135

Query: 138 FKSHSLKISVFGNKLDYXXXXXXXXXXXXXXXYFGYHDDPFIFYIFSGITLCFGIACGIA 197
            KSHS + +    KL+                Y+ Y D  F F  F+ +TL        +
Sbjct: 136 MKSHSKQQAFLWYKLNNIGLINHIASSVVTLLYYHYFDYVFYFKFFTIVTLLLITLFTCS 195

Query: 198 SLKDKFR--TREWRPYRAALFVLFGLSGVLPIIAGIMKYGIREVFERVQLKWIIWEGVLY 255
            + D F   TR  + +    +++  L  ++P +  I+++G+ +V ER+ L  II E  +Y
Sbjct: 196 IISDSFNKMTRIRKNFLLLAYII--LLTLMPSLFAILRFGLAKVLERISLNLIILEIFIY 253

Query: 256 IFGAFLYGARFPEKFMPGKVDIWGQSHQIFHVLVVIAALCHLRGLIGSYELVHQKLD 312
            FG  +  ++ PE+F     D  G S  ++ + +++ +  H + L+ SY L+H  ++
Sbjct: 254 AFGLTIRTSQLPERFF-NSFDFLGNSENVYQLSIIVCSFIHFKILMNSYCLMHSGVN 309

>CAGL0I07491g Chr9 complement(719539..720444) [906 bp, 301 aa] {ON}
           similar to uniprot|Q03419 Saccharomyces cerevisiae
           YDR492w
          Length = 301

 Score =  102 bits (255), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 80/288 (27%), Positives = 131/288 (45%), Gaps = 18/288 (6%)

Query: 38  RLYTWDEIPVW--QHDNEYIYTGYVRETNSMKESFL-SLFYIHNESVNIYTHLIPAFCFL 94
           ++ T +++PVW  ++ N  I TGY   TN+     L  L   +N+S++IY +L+      
Sbjct: 9   KIVTLEKLPVWYRRYGNSRIKTGYFYYTNATYLGCLQKLVKFNNDSISIYMNLVCGLISG 68

Query: 95  SMLLFNT--YGVKPHPTTTYGDYVAIDLFFIGAFTCLGLSSTFHCFKSHSLKISVFGNKL 152
            MLLF T    +  HP+TT  DY+ I+LF +   T     +     K HS       N+ 
Sbjct: 69  VMLLFYTDVRLIPSHPSTTMTDYIIINLFLMATTTYFATMTLGQLLKGHSEYQGKLWNQA 128

Query: 153 DYXXXXXXXXXXXXXXXYFGYHDDPFIFYIFSGITLCFGIACGIASLKDKFRTREWRPYR 212
                            Y+ + D  F+F +F   T        I  + D+++    R  +
Sbjct: 129 KQLALVLLLTCSIVTLLYYAFFDHVFLFKLFVIWTCLLMSITSIVIINDQYK----RVQK 184

Query: 213 AALFVLFG-LSGVLPIIAGIMKYGIREVF--ERVQLKWIIWEGVLYIFGAFLYGARFPEK 269
            +  V+FG LS  LPI   I+K+G+ + +  +R+  + + WE VLY   A L   R PE 
Sbjct: 185 LSCVVIFGVLSISLPIAVSIIKFGLFDSYKKQRIPFQVLTWEIVLYSLSAMLQLTRLPEL 244

Query: 270 FMPGK------VDIWGQSHQIFHVLVVIAALCHLRGLIGSYELVHQKL 311
            +         VD  G S Q+  ++ + A + H   +I +YE+VH  +
Sbjct: 245 TLSTLGDSFWIVDYLGNSDQVSQLVTIFAIIVHFNTIIFAYEVVHASI 292

>Smik_15.56 Chr15 complement(90083..91021) [939 bp, 312 aa] {ON}
           YOL101C (REAL)
          Length = 312

 Score = 79.3 bits (194), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 66/243 (27%), Positives = 112/243 (46%), Gaps = 9/243 (3%)

Query: 78  NESVNIYTHLIPAFCFLSMLLFNT--YGVKPHPTTT-YGDYVAIDLFFIGAFTCLGLSST 134
           NESV    +L+ +     +L+F T  Y +   PTTT   DY+  + + +  F    +   
Sbjct: 62  NESVVALIYLLGSMLSFCLLIFFTDFYLIPLFPTTTTMTDYIVFNFYLLNVFVFCMVHFI 121

Query: 135 FHCFKSHSLKISV-FGNKLDYXXXXXXXXXXXXXXXYFGYHDDPFIFYIFSGITLCFGIA 193
           +H  K+ SL+  +    K  Y               Y+ ++D  F F IF+ +    G+ 
Sbjct: 122 YHFIKNISLQQHLEHWQKFSYLSNINLLISSQITILYYLFYDYVFFFKIFTLLMNFIGLV 181

Query: 194 CGIASLKDKFRTREWRPYRAALFVLFG-LSGVLPIIAGIMKY-GIREVFERVQLKWIIWE 251
                L DK  + + R  +   F+    +   LP++  I+ + G+  + ER+++  I WE
Sbjct: 182 AYFFILTDKLISSK-RFNKTVFFISVSVICCSLPLLTAIITFDGLENLKERIKVNAITWE 240

Query: 252 GVLYIFGAFLYGARFPEKFMPGKV--DIWGQSHQIFHVLVVIAALCHLRGLIGSYELVHQ 309
            V  +  + +Y  RFPE F+ GK   + W  S  +FH+++  AA  H   LI SY L+H 
Sbjct: 241 LVALVAASIIYVTRFPELFLRGKKKEEGWNHSEYLFHLIISGAAFYHFFILIQSYILMHS 300

Query: 310 KLD 312
            L+
Sbjct: 301 SLN 303

>Suva_15.64 Chr15 complement(100035..100973) [939 bp, 312 aa] {ON}
           YOL101C (REAL)
          Length = 312

 Score = 77.8 bits (190), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 70/299 (23%), Positives = 125/299 (41%), Gaps = 30/299 (10%)

Query: 23  GDNQQQLNTSGSSGKRLYTWDEIPVWQHDNEYIYTGYVRETNSMKESFLSLFYIHNESVN 82
           G      +      K+ + + ++  WQ           +  +S  ES ++L Y+      
Sbjct: 26  GAVTSNADVETKETKKGFPFHDLAKWQKQ--------YKNKSSRSESLVALIYLLGS--- 74

Query: 83  IYTHLIPAFCFLSMLLFNTYGVKP--HPTTTYGDYVAIDLFFIGAFTCLGLSSTFHCFKS 140
                + +FC L  + F  + + P    TTT  DY+  + + +  F    +   +H  K+
Sbjct: 75  -----MSSFCLL--IFFTDFYLIPLFPTTTTMTDYIVFNFYLLNVFVFCMIHFIYHFIKN 127

Query: 141 HSLKISV-FGNKLDYXXXXXXXXXXXXXXXYFGYHDDPFIFYIFSGITLCFGIACGIASL 199
            SL+  +    K  Y               Y+ ++D  F F IF+ +    G+A     L
Sbjct: 128 ISLQQHIEIWQKFSYLANINLLISSQITILYYLFYDYVFFFKIFTLLMTFIGLAAYFVIL 187

Query: 200 KDKFRTREWRPYRAALFVLFGLSGV---LPIIAGIMKY-GIREVFERVQLKWIIWEGVLY 255
            DK  +  ++ +   +F +  +S V   LP++  I+ + G+  + +R++L  I WE V  
Sbjct: 188 TDKLNS--YKRFNKTVFFI-SVSVVCCSLPLLTAIITFDGLENLKDRIKLNAITWELVTL 244

Query: 256 IFGAFLYGARFPEKF--MPGKVDIWGQSHQIFHVLVVIAALCHLRGLIGSYELVHQKLD 312
           +  + +Y  RFPE       K + W  S   FH+L+   A  H   LI SY L+H  L+
Sbjct: 245 VVASMIYVTRFPESLCRRNEKEEGWNHSEYFFHLLISGTAFYHFFILIQSYILMHSSLN 303

>Skud_15.53 Chr15 complement(86339..87277) [939 bp, 312 aa] {ON}
           YOL101C (REAL)
          Length = 312

 Score = 72.8 bits (177), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 73/316 (23%), Positives = 131/316 (41%), Gaps = 27/316 (8%)

Query: 4   EVQRRKLTSSTEEGVELLYGDNQQQLNTSGSSGKRLYTWDEIPVWQHDNEYIYTGYVRET 63
           E    K  ++TE+G       N   ++      K+ + + ++  WQ           R  
Sbjct: 8   EQSPAKCKTTTEKGNGTGETTNSN-VDAETKEIKKGFPFHDLAKWQQQ--------YRNK 58

Query: 64  NSMKESFLSLFYIHNESVNIYTHLIPAFCFLSMLLFNTYGVKP--HPTTTYGDYVAIDLF 121
           +S  ES ++L Y+           + +FC L  + F  + + P    TTT  DY+  + +
Sbjct: 59  SSRNESLVALIYLLGS--------MSSFCLL--IFFTDFYLIPLFPTTTTMTDYIVFNFY 108

Query: 122 FIGAFTCLGLSSTFHCFKSHSLKISV-FGNKLDYXXXXXXXXXXXXXXXYFGYHDDPFIF 180
            +  F    +   +H  K+ SL+  +    K  Y               Y+ ++D  F F
Sbjct: 109 LLNVFVFCMVHFVYHFIKNISLQQHLEHWQKFSYLSNINLLISSQITILYYLFYDYVFFF 168

Query: 181 YIFSGITLCFGIACGIASLKDKFRTREWRPYRAALFVLFGLSGV-LPIIAGIMKY-GIRE 238
            IF+ +    G+      L DK  + + R  +   F+   +    LP++  I+ + G+  
Sbjct: 169 KIFTLLMNFIGLVAYFFILTDKLNSSK-RFNKTVFFISVSVVCCSLPLLTAIITFDGLEN 227

Query: 239 VFERVQLKWIIWEGVLYIFGAFLYGARFPEKFM--PGKVDIWGQSHQIFHVLVVIAALCH 296
           + ER+++K I  E V  +  + +Y  RFPE       K + W  S  +FH+++   A  H
Sbjct: 228 LKERIKVKAITCELVALVAASIIYVTRFPESLFRRNKKEESWNHSEYLFHLVISGTAFYH 287

Query: 297 LRGLIGSYELVHQKLD 312
              LI SY L+H  L+
Sbjct: 288 FFILIQSYILMHSSLN 303

>YOL101C Chr15 complement(126982..127920) [939 bp, 312 aa] {ON}
           IZH4Membrane protein involved in zinc ion homeostasis,
           member of the four-protein IZH family, expression
           induced by fatty acids and altered zinc levels; deletion
           reduces sensitivity to excess zinc; possible role in
           sterol metabolism
          Length = 312

 Score = 72.4 bits (176), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 63/243 (25%), Positives = 108/243 (44%), Gaps = 9/243 (3%)

Query: 78  NESVNIYTHLIPAFCFLSMLLFNT--YGVKPHPTTT-YGDYVAIDLFFIGAFTCLGLSST 134
           NES+    +L+ +     +L+F T  Y +   PTTT   DY+  + + +  F    +   
Sbjct: 62  NESLVALIYLLGSMLSFCLLIFFTDFYLIPLFPTTTTMTDYIVFNFYLLNVFVFCMVHFI 121

Query: 135 FHCFKSHSLKISV-FGNKLDYXXXXXXXXXXXXXXXYFGYHDDPFIFYIFSGITLCFGIA 193
           +H  K+ SL+  +    K  Y               Y+ ++D  F F IF+ +    G+ 
Sbjct: 122 YHFVKNISLQQHLEHWQKFSYLSNINLLISSQITILYYLFYDYVFFFKIFTLLMNFIGLV 181

Query: 194 CGIASLKDKFRTREWRPYRAALFVLFGLSGV-LPIIAGIMKY-GIREVFERVQLKWIIWE 251
                L DK  + + R  +   F+   +    LP++  I+ + G+  + ER+++  I WE
Sbjct: 182 AYFFILTDKLISSK-RFNKTVFFISVSVVCCSLPLLTAIITFDGLENLKERIKVNAITWE 240

Query: 252 GVLYIFGAFLYGARFPEKFM--PGKVDIWGQSHQIFHVLVVIAALCHLRGLIGSYELVHQ 309
            V  +  + +Y  RFPE       K + W  S  +FH+L+   A  H   LI SY L+H 
Sbjct: 241 LVALVAASIIYVTRFPESLFRRNKKEEGWNHSEYLFHLLISGTAFYHFFILIQSYILMHS 300

Query: 310 KLD 312
            L+
Sbjct: 301 SLN 303

>KAFR0J00670 Chr10 (120378..121907) [1530 bp, 509 aa] {ON} Anc_5.197
           YLR023C
          Length = 509

 Score = 67.0 bits (162), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 63/237 (26%), Positives = 102/237 (43%), Gaps = 18/237 (7%)

Query: 44  EIPVWQHDNEYIYTGYVRETNSMKESFLSLFYIHNESVNIYTHLIPAFCFLSML---LFN 100
           ++P    +N YI   Y R  +S K+S LS+F +HNE+ NI++HL+ A  FL +L   L N
Sbjct: 197 QLPFPYRENRYIINNY-RFYDSHKKSLLSIFKLHNEATNIWSHLLGAIYFLYVLFHDLPN 255

Query: 101 TYGVKPH--PTTTYGDYVAIDLFFIGAFTCLGLSSTFHCFKSHS-LKISVFGNKLDYXXX 157
           +  V     PTT     + + LF   +  C+  S+ +H F   S LK+      +DY   
Sbjct: 256 SIIVSSSMVPTTA---KLFLYLFVFASLKCMLSSTFYHTFNGTSMLKLRRKFMCVDYSGI 312

Query: 158 XXXXXXXXXXXXYFGYHDDPFIFYIFSGITLCFGIACGIASLKDKFRTREWRPYRAALFV 217
                       +   +D P I   +   +   G+     +    F + E RP R   F+
Sbjct: 313 SILITSSILSIQFISLYDYPNILKFYMCASFMLGVLGIFMNWSPLFDSPEARPLRIKFFI 372

Query: 218 LFGLSGVLPIIAGIMK----YGIREVFERVQLKWIIWEGVLYIFGAFLYGARFPEKF 270
           L    G   ++  +      +   +V   +  K I+W    Y+ G   YG+  PE+F
Sbjct: 373 LLSSCGAFALLHLVFLEKSIFAAIDVLLPLTNKSIVW----YLVGVVFYGSFIPERF 425

>Smik_12.86 Chr12 complement(172288..173916) [1629 bp, 542 aa] {ON}
           YLR023C (REAL)
          Length = 542

 Score = 66.6 bits (161), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 64/237 (27%), Positives = 101/237 (42%), Gaps = 16/237 (6%)

Query: 44  EIPVWQHDNEYIYTGYVRETNSMKESFLSLFYI---HNESVNIYTHLIPA--FCFLSMLL 98
           ++P    +N YI  GY R  N+  +S LS+F     HNE+ NI++HL+ A    +L++  
Sbjct: 219 QLPFPWRENRYIIHGY-RFYNTHSKSLLSIFNWYGWHNETSNIWSHLLGAMYLIYLAIYD 277

Query: 99  FNTYGVKPHPTTTYGDYVAIDLFFIGAFTCLGLSSTFHCFKSHS-LKISVFGNKLDYXXX 157
           F    V  +P         + +F   A  C+  S  +H F   S LK+      +DY   
Sbjct: 278 FPQSEVWKNPKVPPQARWIVFMFLAAALKCMLSSVFWHTFNGTSFLKLRSKFACVDYSGI 337

Query: 158 XXXXXXXXXXXXYFGYHDDPFIFYIFSGITLCFGIACGIASLKDKFRTREWRPYRAALFV 217
                       +   +   +    + GI+L  GI     +   +F   E RP R   F+
Sbjct: 338 TILITASILTTEFVTMYSCYWAMCTYMGISLALGIFGVFMNWSPRFDRPEARPLRIRFFI 397

Query: 218 LFGLSGVLPIIAGI----MKYGIREVFERVQLKWIIWEGVLYIFGAFLYGARFPEKF 270
           L    GVL  +  I    ++Y  R +F  V  K ++W    Y+ G   YG+  PE+F
Sbjct: 398 LLATMGVLSFLHLIFLTDLRYAAR-LFSPVTYKSVVW----YLVGVAFYGSFIPERF 449

>TPHA0E03120 Chr5 complement(654079..655788) [1710 bp, 569 aa] {ON}
           Anc_5.197 YLR023C
          Length = 569

 Score = 64.7 bits (156), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 71/243 (29%), Positives = 106/243 (43%), Gaps = 27/243 (11%)

Query: 44  EIPVWQHDNEYIYTGYVRETNSMKESFLSLFY---IHNESVNIYTHLIPAFCFLSML--- 97
           E+P    +N+YI  GY R  +   +  LS+F    +HNE+ NI+TH++ AF  + +L   
Sbjct: 248 ELPFPWRENKYIIHGY-RFHDKFYQLILSVFNWYGVHNETTNIWTHMLAAFYLIYLLTVD 306

Query: 98  ---LFNTYGVKPHPTTTYGDYVAIDLFFIGAFTCLGLSSTFHCFK-SHSLKISVFGNKLD 153
               F     +  P TT   Y+ I +F      C+  S  +H F  + S+++      +D
Sbjct: 307 FQKTFIVLDTEHVPATT--KYI-IYMFLGAGIKCMFASVFWHTFNGTTSIRLRPKFCCVD 363

Query: 154 YXXXXXXXXXXXXXXXYFGYHDDP--FIFY-IFSGITLCFGIACGIASLKDKFRTREWRP 210
           Y               Y   +D P    FY I SGI   FG+    +    KF + E RP
Sbjct: 364 YTGITLLISASIMSAEYITLYDYPKAMSFYMILSGIFAVFGLYLNWSP---KFDSPEARP 420

Query: 211 YRAALFVLFGLSGVLPIIAGIMKYGIRE---VFERVQLKWIIWEGVLYIFGAFLYGARFP 267
            R   FVL    G L  +  +   G+     +F  V  K +I+    YI G F YG+  P
Sbjct: 421 LRIKFFVLLAAVGGLSFVNLVCLEGLSRAIWLFSPVTNKSVIY----YIIGVFFYGSFIP 476

Query: 268 EKF 270
           E+F
Sbjct: 477 ERF 479

>NDAI0I02330 Chr9 (532412..534148) [1737 bp, 578 aa] {ON} Anc_5.197
          Length = 578

 Score = 63.5 bits (153), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 75/280 (26%), Positives = 115/280 (41%), Gaps = 23/280 (8%)

Query: 10  LTSSTEEGVELLYGDNQQQLNTSGSSGKRLYTWDEIPVWQHDNEYIYTGYVRETNSMKES 69
           L+  +EE   ++Y  N       G +    Y   ++P    +N YI   Y R  +S K+S
Sbjct: 222 LSEPSEELKNVIYSFNHPTAFQLGKNDHLHYY--QLPFPWRENRYIIYNY-RFYDSHKKS 278

Query: 70  FLSLFYI---HNESVNIYTHLIPAFCFLSMLLFN-----TYGVKPHPTTTYGDYVAIDLF 121
            LS+F     HNES NI+THL+ A   + + +++      +  +  PTT     + + LF
Sbjct: 279 LLSIFNWYGWHNESSNIWTHLLGAIYLIYLSIYDFPNSEIFQSEKVPTTA---KLIVYLF 335

Query: 122 FIGAFTCLGLSSTFHCFKSHS-LKISVFGNKLDYXXXXXXXXXXXXXXXYFGYHDDPFIF 180
              A  CL  S  +H F   S LK+      +DY               +   +   F  
Sbjct: 336 LFAAIKCLLASVFWHTFNGTSFLKLRSKFACVDYSGITILITASILTTEFVTMYSSFFAM 395

Query: 181 YIFSGITLCFGIACGIASLKDKFRTREWRPYRAALFVLFGLSGVLPIIAGIMKYGIRE-- 238
            I+  I+L  G+     +   KF   E RP R   F+L    GVL  +       ++   
Sbjct: 396 CIYMTISLSLGMFGVFMNWSPKFDRPEARPLRIKFFILLASMGVLSFLHLTYLTNLQYAT 455

Query: 239 -VFERVQLKWIIWEGVLYIFGAFLYGARFPEKFMPG-KVD 276
            +   V  K I+W    Y+ G   YG+  PE+F    KVD
Sbjct: 456 WLLTPVTNKSIVW----YLVGVVFYGSFIPERFRTDVKVD 491

>Kpol_2002.94 s2002 (229517..231250) [1734 bp, 577 aa] {ON}
           (229517..231250) [1734 nt, 578 aa]
          Length = 577

 Score = 62.0 bits (149), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 58/236 (24%), Positives = 100/236 (42%), Gaps = 14/236 (5%)

Query: 44  EIPVWQHDNEYIYTGY--VRETNSMKESFLSLFYIHNESVNIYTHLIPAFCFLSMLLF-- 99
           ++P    +N YI  GY    + + +  S  + +  HNE+ NI++HL+ A  F  ++LF  
Sbjct: 255 QLPFPWRENRYIINGYRFYHKNSKLLLSVFNWYGFHNETANIWSHLLGAIYFAYIVLFEF 314

Query: 100 -NTYGVKPHPTTTYGDYVAIDLFFIGAFTCLGLSSTFHCFK-SHSLKISVFGNKLDYXXX 157
             ++ V+         Y+ + LF +    C+  S  +H F  + S+K+      +DY   
Sbjct: 315 PKSFIVQSPEVPPSAKYI-VYLFLLAGIKCMLASVFWHTFNGTCSIKLRPKYCCVDYSGI 373

Query: 158 XXXXXXXXXXXXYFGYHDDPFIFYIFSGITLCFGIACGIASLKDKFRTREWRPYRAALFV 217
                       +   +D   I  ++  ++L FG      +   KF + E RP R   F+
Sbjct: 374 TILITASILTAEFVSLYDHRSIMTVYMSLSLLFGCFGLYLNWSPKFDSPEARPLRIKFFI 433

Query: 218 LFGLSGVLPIIAGIMKYGIRE---VFERVQLKWIIWEGVLYIFGAFLYGARFPEKF 270
           L    G L         G+     ++  V  K I+W    Y+ G F YG+  PE+F
Sbjct: 434 LLAALGGLAFFHVAYLEGMAYAAWLYSPVTSKSIVW----YLIGVFFYGSFIPERF 485

>Skud_12.91 Chr12 complement(177334..178962) [1629 bp, 542 aa] {ON}
           YLR023C (REAL)
          Length = 542

 Score = 62.0 bits (149), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 60/236 (25%), Positives = 98/236 (41%), Gaps = 14/236 (5%)

Query: 44  EIPVWQHDNEYIYTGYVRETNSMKESFLSL---FYIHNESVNIYTHLIPAF--CFLSMLL 98
           ++P    +N YI  GY R  N+  +S LS+   +  HNE+ NI++HL+ A    +L++  
Sbjct: 219 QLPFPWRENRYIIHGY-RFYNTHSKSLLSIINWYGWHNETSNIWSHLLGAMYIIYLAIYD 277

Query: 99  FNTYGVKPHPTTTYGDYVAIDLFFIGAFTCLGLSSTFHCFKSHS-LKISVFGNKLDYXXX 157
           F    V  +P         + +F   A  C+  S  +H F   S L++      +DY   
Sbjct: 278 FPQSEVWRNPNVPQQARWIVFMFLAAALKCMLSSVFWHTFNGTSFLRLRSKFACVDYSGI 337

Query: 158 XXXXXXXXXXXXYFGYHDDPFIFYIFSGITLCFGIACGIASLKDKFRTREWRPYRAALFV 217
                       +   +   +    + GI+L  G+     +   +F   E RP R   F+
Sbjct: 338 TILITASILTTEFVTMYSCYWAMCTYMGISLALGVIGVFMNWSPRFDRPEARPLRIRFFI 397

Query: 218 LFGLSGVLPIIAGIMKYGI---REVFERVQLKWIIWEGVLYIFGAFLYGARFPEKF 270
           L    GVL  +  I    I     +F  V  K ++W    Y+ G   YG+  PE+F
Sbjct: 398 LLATMGVLSFLHLIFLTDIYYASRLFGPVTYKSVVW----YLVGVVFYGSFIPERF 449

>NCAS0D02600 Chr4 (499689..501320) [1632 bp, 543 aa] {ON} Anc_5.197
           YLR023C
          Length = 543

 Score = 62.0 bits (149), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 78/283 (27%), Positives = 114/283 (40%), Gaps = 26/283 (9%)

Query: 1   MVTEVQRRKLTSSTEEGVELLYGDNQQQLNTSGSSGKRLYTWDEIPVWQHDNEYIYTGYV 60
           +VTE Q   LT  +EE   L+   N +     G +    Y   ++P    +N YI   Y 
Sbjct: 181 VVTEYQ--PLTKPSEEVKNLICSYNHEVAYEIGKTEHLNYY--QLPFPWRENRYIIYNY- 235

Query: 61  RETNSMKESFLSLFYI---HNESVNIYTHLIPAFCFLSMLLFN-----TYGVKPHPTTTY 112
           R  +S K+S LS+F     HNE+ NI+THLI     + M +++      +     PTT  
Sbjct: 236 RFYDSHKKSLLSIFNWYGWHNETSNIWTHLIGGLYLIYMAVYDFPRSEIFLSDKIPTTAK 295

Query: 113 GDYVAIDLFFIGAFTCLGLSSTFHCFK-SHSLKISVFGNKLDYXXXXXXXXXXXXXXXYF 171
              + + LF   A  CL  S  +H F  + +LK+      +DY               + 
Sbjct: 296 ---LIVYLFLFAAIKCLFASVFWHSFNGTCTLKLRSKFACVDYSGISILITASILTTEFV 352

Query: 172 GYHDDPFIFYIFSGITLCFGIACGIASLKDKFRTREWRPYRAALFVLFGLSGVLPIIAGI 231
             +       ++  I+L  GI     +   KF   E RP R   FVL    GVL  +   
Sbjct: 353 TLYSSYRAMCVYMAISLSLGIFGVFMNWSPKFDRPEARPLRIKFFVLLASMGVLSFLHLT 412

Query: 232 M----KYGIREVFERVQLKWIIWEGVLYIFGAFLYGARFPEKF 270
                KY    +   V  K I+W    Y  G   YG+  PE+F
Sbjct: 413 FLTDWKYATW-LLAPVTNKSIVW----YCIGVVFYGSFIPERF 450

>KLLA0F15510g Chr6 (1433494..1435362) [1869 bp, 622 aa] {ON} some
           similarities with uniprot|Q07959 Saccharomyces
           cerevisiae YLR023C IZH3 Membrane protein involved in
           zinc metabolism member of the four-protein IZH family
           expression induced by zinc deficiency deletion reduces
           sensitivity to elevated zinc and shortens lag phase
           overexpression reduces Zap1p activity
          Length = 622

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 68/281 (24%), Positives = 117/281 (41%), Gaps = 31/281 (11%)

Query: 44  EIPVWQHDNEYIYTGYVRETNSMKESFLSL---FYIHNESVNIYTHLIPAFCFLSMLLF- 99
           E+P    +N YI  GY R  +S  +S LS+   +  HNE++NI++HL  A  +L+ LLF 
Sbjct: 303 ELPFPWRENRYIIHGY-RFYDSHVKSVLSVVNWYGWHNETLNIWSHLFGA-VYLAYLLFI 360

Query: 100 ---NTYGVKPHPTTTYGDYVAIDLFFIGAFTCLGLSSTFHCFK-SHSLKISVFGNKLDYX 155
               T          +G  + I +F I    CL  SS +H    +  L +      +DY 
Sbjct: 361 QLPTTKVFMSQDVPLFGKLI-IQVFLIAGVKCLLSSSVWHTLNGTCCLPLRCKFACIDYT 419

Query: 156 XXXXXXXXXXXXXXYFGYHDDPF-----IFYIFSGITLCFGIACGIASLKDKFRTREWRP 210
                         +   ++           ++  ++LC GI     +   +F   E RP
Sbjct: 420 GITVLITASILSTEFVSVYNLATQSLSTSMTVYMSLSLCLGIFGSFMNWSPRFDRPESRP 479

Query: 211 YRAALFVLFGLSGVLPIIAGIMKYGI---REVFERVQLKWIIWEGVLYIFGAFLYGARFP 267
           +R A +VL    G++  +   +  GI    + F+ V  + +IW    Y+ G   YG+  P
Sbjct: 480 FRIAFYVLLAGLGMISFLHLTISRGIDHSSQFFKPVWNRSLIW----YLIGVVFYGSFIP 535

Query: 268 EKFMPGKVDIWGQSHQIFHVLVVIAALCHLRGLIGSYELVH 308
           E+        W    ++ + +   A LC    ++  ++ VH
Sbjct: 536 ER--------WRTDVELDYTIPTDAELCSNLDILTKHKHVH 568

>YLR023C Chr12 complement(185498..187129) [1632 bp, 543 aa] {ON}
           IZH3Membrane protein involved in zinc ion homeostasis,
           member of the four-protein IZH family, expression
           induced by zinc deficiency; deletion reduces sensitivity
           to elevated zinc and shortens lag phase, overexpression
           reduces Zap1p activity
          Length = 543

 Score = 60.1 bits (144), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 60/236 (25%), Positives = 97/236 (41%), Gaps = 14/236 (5%)

Query: 44  EIPVWQHDNEYIYTGYVRETNSMKESFLSLFYI---HNESVNIYTHLIPAF--CFLSMLL 98
           ++P    +N YI  GY R  N+  +S LS+F     HNE+ NI++HL+ A    +L++  
Sbjct: 220 QLPFPWRENRYIIHGY-RFYNTHSKSLLSIFNWYGWHNETSNIWSHLLGAIYIIYLAIYD 278

Query: 99  FNTYGVKPHPTTTYGDYVAIDLFFIGAFTCLGLSSTFHCFKSHS-LKISVFGNKLDYXXX 157
           F    V  +          + +F   A  C+  S  +H F   S LK+      +DY   
Sbjct: 279 FPQSEVWRNSQVPPQARWIVFMFLAAALKCMLSSVFWHTFNGTSFLKLRSKFACVDYSGI 338

Query: 158 XXXXXXXXXXXXYFGYHDDPFIFYIFSGITLCFGIACGIASLKDKFRTREWRPYRAALFV 217
                       +   +   +  Y +  I+L  G+     +   +F   E RP R   F+
Sbjct: 339 TILITASILTTEFVTMYSCYWAMYTYMSISLALGVFGVFMNWSPRFDRPEARPLRIRFFI 398

Query: 218 LFGLSGVLPIIAGIMKYGIR---EVFERVQLKWIIWEGVLYIFGAFLYGARFPEKF 270
           L    GVL  +  I    +     +F  V  K ++W    Y+ G   YG+  PE+F
Sbjct: 399 LLATMGVLSFLHLIFLTDLHYAATLFSPVTYKSVVW----YLVGVVFYGSFIPERF 450

>Ecym_7109 Chr7 complement(210829..212535) [1707 bp, 568 aa] {ON}
           similar to Ashbya gossypii AAL153C
          Length = 568

 Score = 57.8 bits (138), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 60/243 (24%), Positives = 102/243 (41%), Gaps = 27/243 (11%)

Query: 44  EIPVWQHDNEYIYTGYVRETNSMKESFLSLFYI---HNESVNIYTHLIPAFCFLSMLL-- 98
           E+P    +N YI  G+ R  +S K+S LS+  +   HNE++NI++H+  A   L ++L  
Sbjct: 244 ELPQPWRENPYIIYGH-RFYHSHKKSLLSILNVYGWHNETINIWSHIAGAIILLYIMLRG 302

Query: 99  ------FNTYGVKPHPTTTYGDYVAIDLFFIGAFTCLGLSSTFHCFKSHS-LKISVFGNK 151
                 FN+  V   P    G   AI +F +    C+  S  +H F     L +    + 
Sbjct: 303 FPNSDVFNSTQV---PKVAKG---AIYVFLLCGIKCMVSSVMWHTFSGTCHLPLRSRFSC 356

Query: 152 LDYXXXXXXXXXXXXXXXYFG-YHDDPFIFYIFSGITLCFGIACGIASLKDKFRTREWRP 210
           +DY                F  Y   P   Y++ GI+LC G+     +   +F   + R 
Sbjct: 357 VDYTGITILITASVMTTEAFTLYRLAPKAMYLYMGISLCLGVFAAFTNWSRRFDGPDSRI 416

Query: 211 YRAALFVLFGLSGVLPIIAGIMK---YGIREVFERVQLKWIIWEGVLYIFGAFLYGARFP 267
           +R A +V+    G++  +   +       R +   +  K I+W    Y+ G   Y    P
Sbjct: 417 FRVAFYVILAGLGLISFVHLTVHSDWSSSRLMITPLINKSIVW----YLIGVVFYATLVP 472

Query: 268 EKF 270
           E++
Sbjct: 473 ERW 475

>TBLA0C06050 Chr3 (1468152..1469465) [1314 bp, 437 aa] {ON}
           Anc_5.197 YLR023C
          Length = 437

 Score = 56.6 bits (135), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 78/338 (23%), Positives = 124/338 (36%), Gaps = 71/338 (21%)

Query: 25  NQQQLNTSGSSGKRLYTWDEIPVWQHDNEYIYTGYVRETNSMK--ESFLSLFYIHNESVN 82
           N Q     G S   L+ + ++P    +N YI  GY    +++K   S ++ +  HNE++N
Sbjct: 100 NWQTAYNLGRSNNTLHYY-QLPFPWRENRYIIKGYRFYDSNVKCLLSVVNYYGWHNETLN 158

Query: 83  IYTHLIPAFCFLSMLLF---NT--YGVKPHPTTTYGDYVAIDLFFIGAFTCLGLSSTFHC 137
           I++HL      L + +F   NT  Y  +  PTT     + + +F I    C+  S  +H 
Sbjct: 159 IWSHLGGFLTLLYIAVFVYPNTEVYQSELIPTTAK---MLLFVFLIAGMKCMLASVFWHT 215

Query: 138 FK---SHSLKISVFGNKLDYXXXXXXXXXXXXXXXYFGYHDDPFIFYIFSGITLCFGIAC 194
           F    S++L+       +DY               Y      P   +I+  ++L  G   
Sbjct: 216 FDGTCSYTLRPKFCC--VDYTGITILITASILTAEYVSLSHAPIWMFIYMSLSLALGTFG 273

Query: 195 GIASLKDKFRTREWRPYRAALFVLFGLSGVLPIIAGIMKYGIRE---VFERVQLKWIIWE 251
              +   KF   E RP R   FV     G L  +  I    +R    +   +  K  IW 
Sbjct: 274 VYINWSPKFDGPEARPLRIKFFVTLSAMGCLSFVHLIFTTSLRHACWLLAPIISKSTIW- 332

Query: 252 GVLYIFGAFLYGARFPEKF-----------------------------------MPGK-- 274
              Y+ G F YG+  PEK+                                    P K  
Sbjct: 333 ---YVIGVFFYGSFIPEKYRSDYILDKTIPTSKQLSCDLSIITKDRHIHFRDQPTPNKNG 389

Query: 275 -----------VDIWGQSHQIFHVLVVIAALCHLRGLI 301
                      VD  GQSH I+H+ V++  + H +  +
Sbjct: 390 PRKTGLRSLWWVDYVGQSHTIWHIFVLLGVVGHYKACL 427

>KNAG0B05100 Chr2 (976101..977717) [1617 bp, 538 aa] {ON} Anc_5.197
           YLR023C
          Length = 538

 Score = 56.6 bits (135), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 63/272 (23%), Positives = 109/272 (40%), Gaps = 16/272 (5%)

Query: 8   RKLTSSTEEGVELLYGDNQQQLNTSGSSGKRLYTWDEIPVWQHDNEYIYTGYVRETNSMK 67
           + +   +EE   L+   N       G   ++L  + E+P    +N YI   Y    +++K
Sbjct: 187 KHMLKPSEEVEALITAYNHDVAFQEGR--EKLLHYYELPFPWRENRYIIHNYRFYDSNVK 244

Query: 68  E--SFLSLFYIHNESVNIYTHLIPAF--CFLSMLLFNTYGVKPHPTTTYGDYVAIDLFFI 123
              S ++ +  HNE+ NI++H +  F   +L++  F    V             + +F  
Sbjct: 245 SLLSAINWYGWHNETSNIWSHFLGFFYVVYLAVYEFPQSVVFQSDRIPSSAKFVVYIFLF 304

Query: 124 GAFTCLGLSSTFHCFKSHS-LKISVFGNKLDYXXXXXXXXXXXXXXXYFGYHDDPFIFYI 182
            A  CL  S+ +H F   + LK+      +DY               +   +D   +  +
Sbjct: 305 AAMKCLIASAFWHTFNGTAFLKMRRRFACVDYSGISILITASILTAEFVTLNDHRPMMIL 364

Query: 183 FSGITLCFGIACGIASLKDKFRTREWRPYRAALFVLFGLSGVLPIIAGIM----KYGIRE 238
           +  I+L  GI     +   +F T E RP R   F+L    GVL  I         Y + +
Sbjct: 365 YMTISLTLGIIGVFLNCSPQFDTPEARPLRIRFFMLLAAMGVLSFINASYLESWAYAV-D 423

Query: 239 VFERVQLKWIIWEGVLYIFGAFLYGARFPEKF 270
           +   +  K I+W    Y+ G   YG+  PE+F
Sbjct: 424 LLSPITNKSIVW----YLVGVVFYGSFIPERF 451

>ZYRO0B10538g Chr2 complement(830311..831906) [1596 bp, 531 aa] {ON}
           some similarities with uniprot|Q07959 Saccharomyces
           cerevisiae YLR023C IZH3 Membrane protein involved in
           zinc metabolism member of the four-protein IZH family
           expression induced by zinc deficiency deletion reduces
           sensitivity to elevated zinc and shortens lag phase
           overexpression reduces Zap1p activity
          Length = 531

 Score = 55.8 bits (133), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 60/240 (25%), Positives = 97/240 (40%), Gaps = 22/240 (9%)

Query: 44  EIPVWQHDNEYIYTGYVRETNSMKESFLSL---FYIHNESVNIYTHLIPAFCFLSMLLFN 100
           ++P    +N+YI  GY R   S K+SFLS+   +  HNE+ NI+THL+     + +  ++
Sbjct: 209 QLPFPYRENKYIIHGY-RFYASHKKSFLSIINWYGWHNETSNIWTHLLGGLYLIYLAFYH 267

Query: 101 TYGVKPHPTTTYGDYVA------IDLFFIGAFTCLGLSSTFHCFK-SHSLKISVFGNKLD 153
                PH      D V       + +F   A  C+  S  +H F  +H L++      +D
Sbjct: 268 F----PHSNIWLSDRVPKPAKCIVAVFLAAAIKCMFASVFWHTFNGTHLLRLRSKFACVD 323

Query: 154 YXXXXXXXXXXXXXXXYFGYHDDPFIFYIFSGITLCFGIACGIASLKDKFRTREWRPYRA 213
           Y               +   +D       +   +L  GI     +   KF   E RP R 
Sbjct: 324 YTGITILITASILTVEFVTMYDYKISLLFYMICSLALGIIGVSMNWSPKFDRPEARPLRI 383

Query: 214 ALFVLFGLSGVLPIIAGIMKYGIR---EVFERVQLKWIIWEGVLYIFGAFLYGARFPEKF 270
             F+L    G    I  +     R   ++   +  K ++W    Y+ G F YG+  PE+F
Sbjct: 384 KFFILLATVGCSSFIRLVFLTNWRYAADLLTPLTNKSVVW----YLIGVFFYGSFIPERF 439

>Suva_10.104 Chr10 complement(191663..193288) [1626 bp, 541 aa] {ON}
           YLR023C (REAL)
          Length = 541

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 61/237 (25%), Positives = 97/237 (40%), Gaps = 16/237 (6%)

Query: 44  EIPVWQHDNEYIYTGYVRETNSMKESFLSL---FYIHNESVNIYTHLIPAF--CFLSMLL 98
           ++P    +N YI  GY R  N+  +S LS+   +  HNE+ NI+THL+ A    +L++  
Sbjct: 219 QLPFPWRENRYIIHGY-RFYNTHYKSLLSVINWYGWHNETSNIWTHLLGAMYIVYLAVYD 277

Query: 99  FNTYGVKPHPTTTYGDYVAIDLFFIGAFTCLGLSSTFHCFKSHS-LKISVFGNKLDYXXX 157
           F    V  +P         +  F   A  C+  S  +H F   S L +      +DY   
Sbjct: 278 FPHSEVWQNPEVPQQARWIVFAFLAAALKCMLSSVFWHTFNGTSFLGLRSKFACVDYSGI 337

Query: 158 XXXXXXXXXXXXYFGYHDDPFIFYIFSGITLCFGIACGIASLKDKFRTREWRPYRAALFV 217
                       +   +   +    +  I+L  G+     +   +F   E RP R   F+
Sbjct: 338 TILITASILTTEFVTMYSCYWAMCTYMTISLALGVFGVFMNWSPRFDRPEARPLRIRFFI 397

Query: 218 LFGLSGVLPIIAGI----MKYGIREVFERVQLKWIIWEGVLYIFGAFLYGARFPEKF 270
           L    GVL  +  I    + Y I  +F  V  K ++W    Y+ G   YG+  PE+F
Sbjct: 398 LLATMGVLSFLHLIFLTDLHYAIW-LFSPVTNKSVVW----YLVGVVFYGSFIPERF 449

>KLTH0B03498g Chr2 complement(281148..282788) [1641 bp, 546 aa] {ON}
           some similarities with uniprot|Q07959 Saccharomyces
           cerevisiae YLR023C IZH3 Membrane protein involved in
           zinc metabolism member of the four-protein IZH family
           expression induced by zinc deficiency deletion reduces
           sensitivity to elevated zinc and shortens lag phase
           overexpression reduces Zap1p activity
          Length = 546

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 64/242 (26%), Positives = 95/242 (39%), Gaps = 21/242 (8%)

Query: 44  EIPVWQHDNEYIYTGYVRETNSMKESFLSLFYI---HNESVNIYTHLIPA--FCFLSMLL 98
           E+P    +N +I  GY R  NS  +S LS+F     HNE+VNI+THL  A  F FL    
Sbjct: 219 ELPFPWRENRFIIHGY-RFYNSYSKSLLSIFNWYGWHNETVNIWTHLCGALYFAFLIFKG 277

Query: 99  FNTYGV-KPHPTTTYGDYVAIDLFFIGAFTCLGLSSTFHCFKS-HSLKISVFGNKLDYXX 156
           F+   V +     T   ++A  +F      C   S  +H F     LK       +DY  
Sbjct: 278 FSQTTVYQSELVPTAAKFMAF-VFLTAGLECFLFSVVWHTFNGICHLKQRSNCACVDYTG 336

Query: 157 XXXXXXXXXXXXXYF---GYHDDPFIFYI--FSGITLCFGIACGIASLKDKFRTREWRPY 211
                        +    G  D  F + +  F+G +   G      +   KF   E RP 
Sbjct: 337 ITVLVTASILTTEFVTLSGSSDATFTWSLLFFTGASAALGAVGVFMNWSPKFDRPESRPL 396

Query: 212 RAALFVLFGLSGVLPIIAGIM---KYGIREVFERVQLKWIIWEGVLYIFGAFLYGARFPE 268
           R A ++L    G    +   +        ++ + V +K + W    YI G   YG   PE
Sbjct: 397 RIAFYLLLASFGFFSYLHSRLFNTAVDSSDLIKPVFMKSLAW----YIIGVVFYGTFIPE 452

Query: 269 KF 270
           ++
Sbjct: 453 RW 454

>AAL153C Chr1 complement(75086..76345) [1260 bp, 419 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR023C
          Length = 419

 Score = 50.4 bits (119), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 63/272 (23%), Positives = 107/272 (39%), Gaps = 29/272 (10%)

Query: 17  GVELLYGDNQQQLNTSGSSGK----RLYTWDEIPVWQHDNEYIYTGYVRETNSMKESFLS 72
           G     G  +Q L+ + S  +     L+ W E+P    +N YI  G+ R  +S ++S LS
Sbjct: 79  GAVTCSGAEEQPLHWAESRARGLARHLHYW-ELPYAWRENRYIIYGH-RFYHSHRKSLLS 136

Query: 73  LFYI---HNESVNIYTHLIPAFCFLSMLLF-----NTYGVKPHPTTTYGDYVAIDLFFIG 124
           +      HNE++NI++HL+ A     +L +     + Y     P        AI  F   
Sbjct: 137 VLNAYGWHNETINIWSHLVGAAVLAYLLCWGWPRSDVYRAAQVPRLAKW---AIGAFLAC 193

Query: 125 AFTCLGLSSTFHCFK-SHSLKISVFGNKLDY---XXXXXXXXXXXXXXXYFGYHDDPFIF 180
              C+  S  +H F  +  LK+      +DY                   +G        
Sbjct: 194 GVKCMASSVAWHTFNGTCHLKLRSRFVCVDYTGITLLVTASVVTTVAVTLYGLSRPLMYA 253

Query: 181 YIFSGITLCFGIACGIASLKDKFRTREWRPYRAALFVLFGLSGVLPIIAGIM--KYGIRE 238
           Y+ + I L  G A G+ +    F   E RP R A++V     G++  +   M  ++    
Sbjct: 254 YMVASIGL--GTAAGVMNWSPHFDRPEARPLRIAVYVGLAALGLVSFVHVWMQVRWASAH 311

Query: 239 VFERVQLKWIIWEGVLYIFGAFLYGARFPEKF 270
           +   +  K ++W G+    G   Y    PE++
Sbjct: 312 LMAPLVYKSLVWYGI----GVVFYATLVPERW 339

>TDEL0E04320 Chr5 complement(804655..806007) [1353 bp, 450 aa] {ON}
           Anc_5.197 YLR023C
          Length = 450

 Score = 50.4 bits (119), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 63/256 (24%), Positives = 101/256 (39%), Gaps = 18/256 (7%)

Query: 25  NQQQLNTSGSSGKRLYTWDEIPVWQHDNEYIYTGYVRETNSMKESFLSL---FYIHNESV 81
           +Q Q N  G   +R   + ++P    +N +I  GY R  +S  +S LS+   +  HNE+ 
Sbjct: 119 HQAQANELGR--ERHLHYYQLPFPWRENRFIIHGY-RFYDSHYKSLLSIVNWYGWHNETA 175

Query: 82  NIYTHLIPAF--CFLSMLLFNTYGVKPHPTTTYGDYVAIDLFFIGAFTCLGLSSTFHCFK 139
           NI+THL  A    +L++  F    V             + +F   A  C+  S   H F 
Sbjct: 176 NIWTHLGGALYVLWLAVYDFPRTSVWESEQVPMVAKCIVYVFLAAALKCMLASVFGHTFN 235

Query: 140 -SHSLKISVFGNKLDYXXXXXXXXXXXXXXXYFGYHDDPFIFYIFSGITLCFGIACGIAS 198
            +  L +      +DY               +   ++ P+    +  ++   GI   I +
Sbjct: 236 GTCCLALRSKFACVDYSGITMLITASILTTEFVTMYNYPWSLRFYLAVSTVLGIFGVIMN 295

Query: 199 LKDKFRTREWRPYRAALFVLFGLSGVLPIIA----GIMKYGIREVFERVQLKWIIWEGVL 254
              KF   E RP R   F+L    G L  +     G  KY    +   V  K ++W    
Sbjct: 296 WSPKFDRPEARPLRIKFFILLAAMGGLSFMQLGLLGGWKYA-SWLMAPVTHKSLVW---- 350

Query: 255 YIFGAFLYGARFPEKF 270
           Y+ G   YG+  PE+F
Sbjct: 351 YLLGVAFYGSFVPERF 366

>Kwal_33.15122 s33 (968885..970585) [1701 bp, 566 aa] {ON} YLR023C -
           Hypothetical ORF [contig 94] FULL
          Length = 566

 Score = 49.7 bits (117), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 75/285 (26%), Positives = 115/285 (40%), Gaps = 27/285 (9%)

Query: 44  EIPVWQHDNEYIYTGYVRETNSMKESFLSLFYI---HNESVNIYTHLIPAFCFLSMLLF- 99
           E+P    +N +I  GY R  NS K+S LS+F     HNE+VNI+THL  A  +L+ LLF 
Sbjct: 239 ELPFPWRENRFIIHGY-RFYNSYKKSLLSIFNWYGWHNETVNIWTHLGGAL-YLAYLLFR 296

Query: 100 ---NTYGVKPHPTTTYGDYVAIDLFFIGAFTCLGLSSTFHCFKS-HSLKISVFGNKLDYX 155
               T   +     T    +A  +F +    C   S  +H F     L+       +DY 
Sbjct: 297 GFSQTAVYQSELVPTAAKCMAF-VFLLSGLECFLFSVVWHTFNGICHLQQRSNCACVDYT 355

Query: 156 XXXXXXXXXXXXXXYF---GYHDDPFIFYI--FSGITLCFGIACGIASLKDKFRTREWRP 210
                         +    G  + PF + +  F+  +   G+     +   KF   E RP
Sbjct: 356 GITILVTASILTTEFVTLSGAAEAPFTWSLLFFTTTSSILGVIGVYMNWSPKFDRPESRP 415

Query: 211 YRAALFVLFGLSGVLPII-AGIMKYGI--REVFERVQLKWIIWEGVLYIFGAFLYGARFP 267
            R A ++L    G    + + I    I   E+ + V  K + W    Y+ G   YG   P
Sbjct: 416 LRIAFYLLLASFGFFSYLHSRIFHTSISSSELIKPVLSKSLAW----YLIGVVFYGTFIP 471

Query: 268 EKFMPG-KVD-IWGQSHQIFHVLVVIAALCHLRGLIGSYELVHQK 310
           E++    +VD      H++   L +I    H+     S  + HQK
Sbjct: 472 ERWRSDVQVDPTIPTEHELITNLDIITKQRHVH--FRSQPVTHQK 514

>CAGL0D03322g Chr4 complement(340949..342586) [1638 bp, 545 aa] {ON}
           similar to uniprot|Q07959 Saccharomyces cerevisiae
           YLR023c
          Length = 545

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 61/243 (25%), Positives = 96/243 (39%), Gaps = 28/243 (11%)

Query: 44  EIPVWQHDNEYIYTGYVRETNSMKESFLSL---FYIHNESVNIYTHLIPA--------FC 92
           E+P    +N  I  GY R  NS K+S LS+   +  HNE+ NI+THL+          + 
Sbjct: 218 ELPFPWRENRCIINGY-RFYNSHKKSLLSIVNWYGWHNETSNIWTHLLGGLYILYLMFYQ 276

Query: 93  FLSMLLFNTYGV-KPHPTTTYGDYVAIDLFFIGAFTCLGLSSTFHCFKSHS-LKISVFGN 150
           F S  +F +  V K     TY       +F I A  CL  S  +H F   S L++     
Sbjct: 277 FPSSEVFMSEQVPKAAKLITY-------VFLIAAAKCLFSSVFWHTFNGTSLLRLRCKFA 329

Query: 151 KLDYXXXXXXXXXXXXXXXYFGYHDDPFIFYIFSGITLCFGIACGIASLKDKFRTREWRP 210
            +DY               +   +  P+    +  ++   GI     +   KF   E RP
Sbjct: 330 CVDYSGISILITASILTTEFVTMYQCPWAMVSYMALSTALGIFGVFMNWSPKFDRPEARP 389

Query: 211 YRAALFVLFGLSGVLPIIAGIMKYGIRE---VFERVQLKWIIWEGVLYIFGAFLYGARFP 267
            R   F+L    G+L  +       +     +   +  K ++W    Y+ G   YG+  P
Sbjct: 390 LRIKFFILLASMGILSFLHLTFITSLSHSTWLLSPITKKSVVW----YLVGVVFYGSFIP 445

Query: 268 EKF 270
           E++
Sbjct: 446 ERW 448

>SAKL0G12980g Chr7 complement(1108751..1110442) [1692 bp, 563 aa]
           {ON} some similarities with uniprot|Q07959 Saccharomyces
           cerevisiae YLR023C IZH3 Membrane protein involved in
           zinc metabolism member of the four-protein IZH family
           expression induced by zinc deficiency deletion reduces
           sensitivity to elevated zinc and shortens lag phase
           overexpression reduces Zap1p activity
          Length = 563

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 64/251 (25%), Positives = 100/251 (39%), Gaps = 36/251 (14%)

Query: 44  EIPVWQHDNEYIYTGYVRETNSMKESFLSL---FYIHNESVNIYTHLIPAF--CFLSMLL 98
           E+P    +N +I  GY R  +S  +S LS+   +  HNE+ NI+THL  +    +L+   
Sbjct: 236 ELPFPWRENRFIIHGY-RFYHSHTKSLLSILNWYGWHNETTNIWTHLFGSLYIAYLAFYE 294

Query: 99  FNTYGVKPHPTTTYGDYVAIDLFFIGAFTCLGLSSTFHCFK-SHSLKISVFGNKLDYXXX 157
           F    V             + LF    F CL  S T+H F  +  L +      +DY   
Sbjct: 295 FPQSSVYLSGDVPQFAKYMVYLFLGAGFKCLVSSVTWHTFNGTCKLHLRSKFACMDYTGI 354

Query: 158 XXXXXXXXXXXXY---FGYHDDP-------FIFYI-FSGITLCFGIACGIASLKDKFRTR 206
                       +   +G  D+P        IFY+  S +  CFG+     +   +F   
Sbjct: 355 TVLITASIMTAEFVSLYGNGDNPNSPVTFSLIFYMAVSSVLCCFGV---FMNWSPRFDRP 411

Query: 207 EWRPYRAALFVLFGLSGVLPIIAGIM-------KYGIREVFERVQLKWIIWEGVLYIFGA 259
           E RP R A ++L    G L  +   +        + IR V +    K + W    Y+ G 
Sbjct: 412 ESRPLRIAFYLLLAGMGFLAFLHLTLITNFAHSSWLIRPVLD----KSVCW----YLIGV 463

Query: 260 FLYGARFPEKF 270
             YG+  PE++
Sbjct: 464 IFYGSFIPERW 474

>KNAG0K00670 Chr11 complement(119419..120384) [966 bp, 321 aa] {ON} 
          Length = 321

 Score = 40.0 bits (92), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 52/224 (23%), Positives = 96/224 (42%), Gaps = 21/224 (9%)

Query: 88  IPAFCFLSMLLF-NTYGVKPHPTTTYGDYVAIDLFFIGAFTCLGLSSTFHCFKSHSLKIS 146
           + A  F+ ++ F + Y V  H +TT  DYV +++F   AF C        CF + +    
Sbjct: 102 VTAVYFVLLVFFTDVYLVPRHVSTTMTDYVLLNVFLATAFQCAA-CHMVQCFTTTA---- 156

Query: 147 VFGNKLDYXXXXXXXXXXXXXXXYFGYHDDPFIFYIFSGITLCFGI---ACGIASLKDKF 203
             G+ L                 Y+ Y+D+ F F + +  T  + +   A  + S     
Sbjct: 157 --GSVLSTITMLNHWACSAVTLLYYSYYDNVFYFKLLALFTANWTLVVAAVTVTSTASNS 214

Query: 204 RTREWRPYRAALFVLFGLSGVLPIIAGIMKYGIREVFERVQLKWIIWEGVLYIFGAFLYG 263
             R+W   R  L V   +   +P++ G++++G  +V  R+  + ++ E  +Y+     YG
Sbjct: 215 PKRQWWSRRTLLLVYVVVLVSVPLVVGLLRFGTAKVLRRLDWRLLLAELAVYLISGVFYG 274

Query: 264 ARFPEKFMPGKVDIWGQSHQIFHVLVVIAALCHLRGLIGSYELV 307
               EK    K+         F+V    A+L HL+ L+ ++ L+
Sbjct: 275 GT--EKDTLPKLP--------FYVAFHTASLIHLQLLLNAFHLM 308

>SAKL0B07656g Chr2 (655693..656619) [927 bp, 308 aa] {ON} similar to
           uniprot|P25042 Saccharomyces cerevisiae YPR065W ROX1
           Heme-dependent repressor of hypoxic genes contains an
           HMG domain that is responsible for DNA bending activity
          Length = 308

 Score = 30.4 bits (67), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 22/38 (57%), Gaps = 1/38 (2%)

Query: 57  TGYVRETNSMKESFLSLFYIHNESVN-IYTHLIPAFCF 93
           T Y+ E +    S  S++ IHN S N IY  L+PAF F
Sbjct: 121 TEYIHEPHFPPTSAESIYSIHNHSRNNIYPPLLPAFQF 158

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.328    0.143    0.457 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 32,806,862
Number of extensions: 1404268
Number of successful extensions: 4001
Number of sequences better than 10.0: 71
Number of HSP's gapped: 3946
Number of HSP's successfully gapped: 73
Length of query: 319
Length of database: 53,481,399
Length adjustment: 110
Effective length of query: 209
Effective length of database: 40,868,139
Effective search space: 8541441051
Effective search space used: 8541441051
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 66 (30.0 bits)