Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0E021005.700ON1140114048290.0
Kwal_55.197075.700ON114391615530.0
KAFR0D022405.700ON118772312851e-156
KLLA0A00638g5.700ON115572112441e-151
Kpol_2001.745.700ON111373112411e-151
SAKL0E14872g5.700ON114066812031e-145
KNAG0L021105.700ON12004508503e-95
ZYRO0G06644g5.700ON11664388484e-95
TDEL0B022105.700ON10954368261e-92
TBLA0I016805.700ON12143818268e-92
Smik_9.225.700ON12304288232e-91
CAGL0H06567g5.700ON11693758212e-91
NDAI0F003105.700ON12593778057e-89
Suva_9.415.700ON12193887958e-88
YIL147C (SLN1)5.700ON12203767809e-86
NCAS0G002505.700ON11833837772e-85
Kpol_1043.685.700ON10423707562e-83
Skud_9.215.700ON12213707596e-83
KLTH0E01100g5.700ON11773767347e-80
TPHA0D045905.700ON11273767257e-79
Ecym_40205.700ON11253447115e-77
TPHA0E002505.700ON10683826883e-74
AFR284W5.700ON11033226813e-73
Ecym_50775.230ON7951511641e-10
ADR343C5.230ON7491391523e-09
CAGL0D02882g5.230ON6671501461e-08
Ecym_74744.385ON4961231442e-08
ADL388W4.385ON4821231442e-08
KAFR0B069904.385ON5451231415e-08
KLLA0A10219g4.385ON4751231397e-08
TDEL0E039805.230ON7301461391e-07
KNAG0M001804.385ON6151231391e-07
Skud_8.2734.385ON6231231391e-07
YHR206W (SKN7)4.385ON6221231371e-07
Kwal_33.152885.230ON5871341372e-07
KAFR0J007005.230ON6201241372e-07
SAKL0B12408g4.385ON4651231352e-07
KLLA0E09505g5.230ON635751362e-07
NCAS0A064504.385ON6091231362e-07
Smik_8.2964.385ON6251231353e-07
Suva_15.4124.385ON6171231353e-07
CAGL0F09097g4.385ON6301171353e-07
ZYRO0G00484g4.385ON6471231336e-07
Kpol_1004.45.230ON714811311e-06
NDAI0D034304.385ON5971571301e-06
NCAS0D029005.230ON7621381301e-06
TDEL0D003204.385ON5471231291e-06
KLTH0B02684g5.230ON5951331291e-06
KNAG0B051405.230ON6481261282e-06
TPHA0N008505.230ON6701431255e-06
TBLA0A107004.385ON5871231245e-06
KLTH0D17182g4.385ON4641171245e-06
Kwal_47.167704.385ON4611171237e-06
TPHA0C001504.385ON5102031229e-06
Suva_10.845.230ON6951461239e-06
YLR006C (SSK1)5.230ON7121461239e-06
NDAI0I020005.230ON8901421221e-05
Smik_12.685.230ON7121461221e-05
Skud_12.725.230ON7021461211e-05
Kpol_265.24.385ON5491411192e-05
ZYRO0A11154g5.230ON7761451202e-05
SAKL0G12100g5.230ON738811183e-05
TBLA0D031705.230ON765831141e-04
KLLA0E04533g7.222ON42181860.14
Kwal_47.181517.222ON41435800.77
Smik_3.301.29ON79149772.2
SAKL0F08184g7.222ON41230752.9
SAKL0D12914g1.519ON1051159754.1
SAKL0B01210g8.34ON1588201754.4
KLTH0G18612g8.34ON152472728.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0E02100
         (1140 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0E02100 Chr5 (513016..516438) [3423 bp, 1140 aa] {ON} Anc_5....  1864   0.0  
Kwal_55.19707 s55 complement(89757..93188) [3432 bp, 1143 aa] {O...   602   0.0  
KAFR0D02240 Chr4 complement(450837..454400) [3564 bp, 1187 aa] {...   499   e-156
KLLA0A00638g Chr1 complement(60378..63845) [3468 bp, 1155 aa] {O...   483   e-151
Kpol_2001.74 s2001 (202108..205449) [3342 bp, 1113 aa] {ON} (202...   482   e-151
SAKL0E14872g Chr5 (1231857..1235279) [3423 bp, 1140 aa] {ON} sim...   468   e-145
KNAG0L02110 Chr12 (376096..379698) [3603 bp, 1200 aa] {ON} Anc_5...   332   3e-95
ZYRO0G06644g Chr7 complement(528671..532171) [3501 bp, 1166 aa] ...   331   4e-95
TDEL0B02210 Chr2 complement(396111..399398) [3288 bp, 1095 aa] {...   322   1e-92
TBLA0I01680 Chr9 (372270..375914) [3645 bp, 1214 aa] {ON} Anc_5....   322   8e-92
Smik_9.22 Chr9 complement(47449..51141) [3693 bp, 1230 aa] {ON} ...   321   2e-91
CAGL0H06567g Chr8 (645707..649216) [3510 bp, 1169 aa] {ON} simil...   320   2e-91
NDAI0F00310 Chr6 complement(66930..70709) [3780 bp, 1259 aa] {ON...   314   7e-89
Suva_9.41 Chr9 complement(64510..68166) [3657 bp, 1219 aa] {ON} ...   310   8e-88
YIL147C Chr9 complement(69791..73453) [3663 bp, 1220 aa] {ON}  S...   305   9e-86
NCAS0G00250 Chr7 complement(40367..43918) [3552 bp, 1183 aa] {ON...   303   2e-85
Kpol_1043.68 s1043 (141962..145090) [3129 bp, 1042 aa] {ON} (141...   295   2e-83
Skud_9.21 Chr9 complement(46872..50537) [3666 bp, 1221 aa] {ON} ...   296   6e-83
KLTH0E01100g Chr5 complement(106377..109910) [3534 bp, 1177 aa] ...   287   7e-80
TPHA0D04590 Chr4 (1001887..1005270) [3384 bp, 1127 aa] {ON} Anc_...   283   7e-79
Ecym_4020 Chr4 complement(49684..53061) [3378 bp, 1125 aa] {ON} ...   278   5e-77
TPHA0E00250 Chr5 complement(34875..38081) [3207 bp, 1068 aa] {ON...   269   3e-74
AFR284W Chr6 (947118..950429) [3312 bp, 1103 aa] {ON} Syntenic h...   266   3e-73
Ecym_5077 Chr5 (166792..169179) [2388 bp, 795 aa] {ON} similar t...    68   1e-10
ADR343C Chr4 complement(1311984..1314233) [2250 bp, 749 aa] {ON}...    63   3e-09
CAGL0D02882g Chr4 complement(300025..302028) [2004 bp, 667 aa] {...    61   1e-08
Ecym_7474 Chr7 (967242..968732) [1491 bp, 496 aa] {ON} similar t...    60   2e-08
ADL388W Chr4 (30355..31803) [1449 bp, 482 aa] {ON} Syntenic homo...    60   2e-08
KAFR0B06990 Chr2 (1455520..1457157) [1638 bp, 545 aa] {ON} Anc_4...    59   5e-08
KLLA0A10219g Chr1 (896931..898358) [1428 bp, 475 aa] {ON} simila...    58   7e-08
TDEL0E03980 Chr5 (741644..743836) [2193 bp, 730 aa] {ON} Anc_5.2...    58   1e-07
KNAG0M00180 Chr13 complement(22500..24347) [1848 bp, 615 aa] {ON...    58   1e-07
Skud_8.273 Chr8 (481627..483498) [1872 bp, 623 aa] {ON} YHR206W ...    58   1e-07
YHR206W Chr8 (512732..514600) [1869 bp, 622 aa] {ON}  SKN7Nuclea...    57   1e-07
Kwal_33.15288 s33 complement(1045147..1046910) [1764 bp, 587 aa]...    57   2e-07
KAFR0J00700 Chr10 (127858..129720) [1863 bp, 620 aa] {ON} Anc_5....    57   2e-07
SAKL0B12408g Chr2 (1065161..1066558) [1398 bp, 465 aa] {ON} simi...    57   2e-07
KLLA0E09505g Chr5 (840647..842554) [1908 bp, 635 aa] {ON} weakly...    57   2e-07
NCAS0A06450 Chr1 (1273459..1275288) [1830 bp, 609 aa] {ON} Anc_4...    57   2e-07
Smik_8.296 Chr8 (487452..489329) [1878 bp, 625 aa] {ON} YHR206W ...    57   3e-07
Suva_15.412 Chr15 (719438..721291) [1854 bp, 617 aa] {ON} YHR206...    57   3e-07
CAGL0F09097g Chr6 (898706..900598) [1893 bp, 630 aa] {ON} simila...    57   3e-07
ZYRO0G00484g Chr7 complement(35793..37736) [1944 bp, 647 aa] {ON...    56   6e-07
Kpol_1004.4 s1004 complement(9754..11898) [2145 bp, 714 aa] {ON}...    55   1e-06
NDAI0D03430 Chr4 (809977..811770) [1794 bp, 597 aa] {ON} Anc_4.385     55   1e-06
NCAS0D02900 Chr4 complement(551013..553301) [2289 bp, 762 aa] {O...    55   1e-06
TDEL0D00320 Chr4 complement(53243..54886) [1644 bp, 547 aa] {ON}...    54   1e-06
KLTH0B02684g Chr2 (207260..209047) [1788 bp, 595 aa] {ON} some s...    54   1e-06
KNAG0B05140 Chr2 (985361..987307) [1947 bp, 648 aa] {ON} Anc_5.2...    54   2e-06
TPHA0N00850 Chr14 complement(189011..191023) [2013 bp, 670 aa] {...    53   5e-06
TBLA0A10700 Chr1 (2646036..2647799) [1764 bp, 587 aa] {ON} Anc_4...    52   5e-06
KLTH0D17182g Chr4 complement(1424948..1426342) [1395 bp, 464 aa]...    52   5e-06
Kwal_47.16770 s47 (103208..104593) [1386 bp, 461 aa] {ON} YHR206...    52   7e-06
TPHA0C00150 Chr3 complement(15029..16561) [1533 bp, 510 aa] {ON}...    52   9e-06
Suva_10.84 Chr10 complement(167272..169359) [2088 bp, 695 aa] {O...    52   9e-06
YLR006C Chr12 complement(161755..163893) [2139 bp, 712 aa] {ON} ...    52   9e-06
NDAI0I02000 Chr9 complement(464492..467164) [2673 bp, 890 aa] {O...    52   1e-05
Smik_12.68 Chr12 complement(148821..150959) [2139 bp, 712 aa] {O...    52   1e-05
Skud_12.72 Chr12 complement(153012..155120) [2109 bp, 702 aa] {O...    51   1e-05
Kpol_265.2 s265 (9842..11491) [1650 bp, 549 aa] {ON} (9842..1149...    50   2e-05
ZYRO0A11154g Chr1 (893793..896123) [2331 bp, 776 aa] {ON} simila...    51   2e-05
SAKL0G12100g Chr7 (1029250..1031466) [2217 bp, 738 aa] {ON} weak...    50   3e-05
TBLA0D03170 Chr4 complement(771345..773642) [2298 bp, 765 aa] {O...    49   1e-04
KLLA0E04533g Chr5 (408415..409680) [1266 bp, 421 aa] {ON} simila...    38   0.14 
Kwal_47.18151 s47 (709368..710612) [1245 bp, 414 aa] {ON} YIL042...    35   0.77 
Smik_3.30 Chr3 complement(46053..48428) [2376 bp, 791 aa] {ON} Y...    34   2.2  
SAKL0F08184g Chr6 (623521..624759) [1239 bp, 412 aa] {ON} simila...    33   2.9  
SAKL0D12914g Chr4 complement(1080337..1083492) [3156 bp, 1051 aa...    33   4.1  
SAKL0B01210g Chr2 complement(109892..114658) [4767 bp, 1588 aa] ...    33   4.4  
KLTH0G18612g Chr7 (1604066..1608640) [4575 bp, 1524 aa] {ON} sim...    32   8.8  

>TBLA0E02100 Chr5 (513016..516438) [3423 bp, 1140 aa] {ON} Anc_5.700
            YIL147C
          Length = 1140

 Score = 1864 bits (4829), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 938/1140 (82%), Positives = 938/1140 (82%)

Query: 1    MRLPSWKIKLKMNKQTVKPPYRFSLRAQLTILVCXXXXXXXXXXXXXXGVYFTTHYKDLN 60
            MRLPSWKIKLKMNKQTVKPPYRFSLRAQLTILVC              GVYFTTHYKDLN
Sbjct: 1    MRLPSWKIKLKMNKQTVKPPYRFSLRAQLTILVCIVAIISLTTLAIITGVYFTTHYKDLN 60

Query: 61   VNRLYIASQLKSSQIDQTLNYLYYQCYWVASRNTIQTMVFSNHTGMHNASGIIESQSVLD 120
            VNRLYIASQLKSSQIDQTLNYLYYQCYWVASRNTIQTMVFSNHTGMHNASGIIESQSVLD
Sbjct: 61   VNRLYIASQLKSSQIDQTLNYLYYQCYWVASRNTIQTMVFSNHTGMHNASGIIESQSVLD 120

Query: 121  KFVGTSDLFYYTMIYDKNLKSIMNSTNNESGSNVEXXXXXXXXXXXXXXXXXXXXXXXXG 180
            KFVGTSDLFYYTMIYDKNLKSIMNSTNNESGSNVE                        G
Sbjct: 121  KFVGTSDLFYYTMIYDKNLKSIMNSTNNESGSNVEPSILSRLLPLSSTNTTIPPLINNTG 180

Query: 181  ILTDPILNSTKYLMSMSLPISGPYSTATKIGNQSNIYGYLTVVMSAESLKSVFNDTAGLS 240
            ILTDPILNSTKYLMSMSLPISGPYSTATKIGNQSNIYGYLTVVMSAESLKSVFNDTAGLS
Sbjct: 181  ILTDPILNSTKYLMSMSLPISGPYSTATKIGNQSNIYGYLTVVMSAESLKSVFNDTAGLS 240

Query: 241  DSTTALLSAIYTNDTLPRYFHFVFPPFDLDDSIIDERQTIKNGTFQYRAFDXXXXXXXXX 300
            DSTTALLSAIYTNDTLPRYFHFVFPPFDLDDSIIDERQTIKNGTFQYRAFD         
Sbjct: 241  DSTTALLSAIYTNDTLPRYFHFVFPPFDLDDSIIDERQTIKNGTFQYRAFDKNKSGSKKK 300

Query: 301  XXXXXXXXYAIGYAPTNFPLCKWVAVVALPDHQFYSESRKLTKIICGTVVGIAVFVFLIS 360
                    YAIGYAPTNFPLCKWVAVVALPDHQFYSESRKLTKIICGTVVGIAVFVFLIS
Sbjct: 301  VKLVNKKNYAIGYAPTNFPLCKWVAVVALPDHQFYSESRKLTKIICGTVVGIAVFVFLIS 360

Query: 361  LPLSYWAVQPIVRLQRASELITKRRGLRNLXXXXXXXXXXXXXXXXXXXXXXESKLISST 420
            LPLSYWAVQPIVRLQRASELITKRRGLRNL                      ESKLISST
Sbjct: 361  LPLSYWAVQPIVRLQRASELITKRRGLRNLNDDSFDDSNDDHTYDSNDDHTYESKLISST 420

Query: 421  PTLKNSDSNIHDEKSGRTRGDAXXXXXXXXXXXXXXXXXKDFNRLRRNVSVSTHVSLSEF 480
            PTLKNSDSNIHDEKSGRTRGDA                 KDFNRLRRNVSVSTHVSLSEF
Sbjct: 421  PTLKNSDSNIHDEKSGRTRGDANSGTLNSNNTITNNTNNKDFNRLRRNVSVSTHVSLSEF 480

Query: 481  DEIQVPVYRKLFDDELTELTDTFNVMSNALDEHYALLEKRVHQRTXXXXXXXXXXXXXXX 540
            DEIQVPVYRKLFDDELTELTDTFNVMSNALDEHYALLEKRVHQRT               
Sbjct: 481  DEIQVPVYRKLFDDELTELTDTFNVMSNALDEHYALLEKRVHQRTKQLEAAKVQAEAANE 540

Query: 541  XXTVFIANISHELRTPLNGILGMTSTSLEENXXXXXXXXXXXXFRSGXXXXXXXXXXXXF 600
              TVFIANISHELRTPLNGILGMTSTSLEEN            FRSG            F
Sbjct: 541  AKTVFIANISHELRTPLNGILGMTSTSLEENDIKKIKDGLKLIFRSGELLLNILTELLTF 600

Query: 601  SKNVLNKTKLEYREFNIIEITSQIKTIFNKLIQLQEVKLFIRXXXXXXXXXXXXYGDSNR 660
            SKNVLNKTKLEYREFNIIEITSQIKTIFNKLIQLQEVKLFIR            YGDSNR
Sbjct: 601  SKNVLNKTKLEYREFNIIEITSQIKTIFNKLIQLQEVKLFIRLLPKKFLKSLLFYGDSNR 660

Query: 661  ILQVLMNLISNAIKFTPTVNGKVEVNMYLLGEYDEEESKTENYSKVCIKPSTQIVTESGE 720
            ILQVLMNLISNAIKFTPTVNGKVEVNMYLLGEYDEEESKTENYSKVCIKPSTQIVTESGE
Sbjct: 661  ILQVLMNLISNAIKFTPTVNGKVEVNMYLLGEYDEEESKTENYSKVCIKPSTQIVTESGE 720

Query: 721  LIKSKIRCKIXXXXXXXXXXXXXXXXRIESNTNQYLSPYSHTNTRTHTHPGADXXXXXXX 780
            LIKSKIRCKI                RIESNTNQYLSPYSHTNTRTHTHPGAD       
Sbjct: 721  LIKSKIRCKITKSTTNMNTATTNNSARIESNTNQYLSPYSHTNTRTHTHPGADSRRNSNV 780

Query: 781  XXXXXXXXXXXXXXXKMYDNLMFNRLIKREGDGDINDIKALEQIEGNKKWVIRFEVIDNG 840
                           KMYDNLMFNRLIKREGDGDINDIKALEQIEGNKKWVIRFEVIDNG
Sbjct: 781  STVNNSSISLDSESSKMYDNLMFNRLIKREGDGDINDIKALEQIEGNKKWVIRFEVIDNG 840

Query: 841  PGIDQNLHDSVFKPFVQGDQTLSRQYGGTGLGLSICKQLCEMMKGTLELESELGKGSKFI 900
            PGIDQNLHDSVFKPFVQGDQTLSRQYGGTGLGLSICKQLCEMMKGTLELESELGKGSKFI
Sbjct: 841  PGIDQNLHDSVFKPFVQGDQTLSRQYGGTGLGLSICKQLCEMMKGTLELESELGKGSKFI 900

Query: 901  YTIPLLQVGGXXXXXXXXXXXXXXXXXSSVDIDIIEDTPVSITSSSQTHSDLNSLQSNST 960
            YTIPLLQVGG                 SSVDIDIIEDTPVSITSSSQTHSDLNSLQSNST
Sbjct: 901  YTIPLLQVGGTKKDNDDNEEDHNDNTNSSVDIDIIEDTPVSITSSSQTHSDLNSLQSNST 960

Query: 961  NEVGLDDSFSEAENDSTVASLDKSVLQKTRMDAQKVEANEIDDIDHCNKGIPSKLKVLVA 1020
            NEVGLDDSFSEAENDSTVASLDKSVLQKTRMDAQKVEANEIDDIDHCNKGIPSKLKVLVA
Sbjct: 961  NEVGLDDSFSEAENDSTVASLDKSVLQKTRMDAQKVEANEIDDIDHCNKGIPSKLKVLVA 1020

Query: 1021 EDNLVNQEVIKRMLKLENISDIELAFDGIEAFEKVKKNLLSYKKYDIIFMDIQMPKMDGL 1080
            EDNLVNQEVIKRMLKLENISDIELAFDGIEAFEKVKKNLLSYKKYDIIFMDIQMPKMDGL
Sbjct: 1021 EDNLVNQEVIKRMLKLENISDIELAFDGIEAFEKVKKNLLSYKKYDIIFMDIQMPKMDGL 1080

Query: 1081 ESTTKIRQELKYEGKIVALTAFADESNIKECRDAGMDGFIEKPIKRVALHTLLEEFQQDL 1140
            ESTTKIRQELKYEGKIVALTAFADESNIKECRDAGMDGFIEKPIKRVALHTLLEEFQQDL
Sbjct: 1081 ESTTKIRQELKYEGKIVALTAFADESNIKECRDAGMDGFIEKPIKRVALHTLLEEFQQDL 1140

>Kwal_55.19707 s55 complement(89757..93188) [3432 bp, 1143 aa] {ON}
           YIL147C (SLN1) - histidine kinase osmosensor that
           regulates an osmosensing MAP kinase cascade and is
           similar to bacterial two-component regulators [contig
           159] FULL
          Length = 1143

 Score =  602 bits (1553), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/916 (38%), Positives = 489/916 (53%), Gaps = 51/916 (5%)

Query: 14  KQTVKPPYRFSLRAQLTILVCXXXXXXXXXXXXXXGVYFTTHYKDLNVNRLYIASQLKSS 73
           ++ ++ P   S+R QLT LVC              GVYFT+ +K L   RL++A+QLKSS
Sbjct: 14  QRRLRRPLVVSIRTQLTALVCLVALLSLIILAVITGVYFTSSFKSLRAERLHVAAQLKSS 73

Query: 74  QIDQTLNYLYYQCYWVASRNTIQ---TMVFSNHTGMHNASGIIESQSVLDKFVGTSDLFY 130
           QIDQ LNYLYYQCYW+++R+ +Q   T   + +T   N S   ++ + LDKF+G+S+LF 
Sbjct: 74  QIDQNLNYLYYQCYWLSTRDILQNALTQYLAGNTSTENWS---DASTTLDKFLGSSNLFS 130

Query: 131 YTMIYDKNLKSIMNSTNNESGSNVEXXXXXXXXXXXXXXXXXXXXXXXXGILTDPILNST 190
              +YD + + ++N +NN SG N+                         G+LTDP+LN +
Sbjct: 131 LARVYDSSFQDVLNVSNNGSG-NLIPENLLTQLFPLSTDVALPSSLERTGMLTDPVLNGS 189

Query: 191 KYLMSMSLPISGPYSTATKIGNQSNIYGYLTVVMSAESLKSVFNDTAGLSDSTTALLSAI 250
            YLMSMSLPI   ++  + I + + +YGY+TVV+SAE LKSV+NDT  L DS+  ++S +
Sbjct: 190 VYLMSMSLPI---FANPSIILSTAKVYGYITVVISAEGLKSVYNDTTALDDSSVIIVSTV 246

Query: 251 YTNDTLPRYFHFVFPPFDLDDSIIDERQTIKNGTFQYRAFDXXXXXXXXXXXXXXXXXYA 310
           Y +  L  Y H VFPP+++   +I+E   I+NG+F   A                    A
Sbjct: 247 YDDHELAGY-HLVFPPYNMYPDVINEHYQIENGSFLEDAIKDGKGGSIKSTRFFNNKKIA 305

Query: 311 IGYAPTNFPLCKWVAVVALPDHQFYSESRKLTKIICGTVVGIAVFVFLISLPLSYWAVQP 370
           +GY+P N  L +WVA++  P+  F S S +L KII GT + IAV   +++ PLS+WAVQP
Sbjct: 306 VGYSPCNSTLAQWVAIITQPEAIFLSPSTRLAKIIVGTCIAIAVVTCVVTFPLSHWAVQP 365

Query: 371 IVRLQRASELITKRRGLRNLXXXXXXXXXXXXXXXXXXXXXXESKLISSTPTLK-NSDSN 429
           IVRLQ+A+E+IT  RGLR+                          +  S    +   D  
Sbjct: 366 IVRLQKATEIITAGRGLRSDNSSTLFSHKRTSTAESFSSIFGTGSVRRSGSVARAGRDKY 425

Query: 430 IHDEKSGRTRGDAXXXXXXXXXXXXXXXXXKDFNRL--------RRNVSVSTHVSLSEFD 481
           I D      RG++                 +  N           + V    +++ +   
Sbjct: 426 IPDSSKEVPRGNSSDAIHEVNQENIEDIEMQKVNSPTPYSMMNESQAVKSERYITSTNLI 485

Query: 482 EIQVPVYRKLFDDELTELTDTFNVMSNALDEHYALLEKRVHQRTXXXXXXXXXXXXXXXX 541
           E +VPVY++LF DEL+ELT+TFN M++ LD HYALLE RV  RT                
Sbjct: 486 EARVPVYKRLFSDELSELTETFNTMTDELDRHYALLEDRVRARTRQLEAAKIEAEGANEA 545

Query: 542 XTVFIANISHELRTPLNGILGMTSTSLEENXXXXXXXXXXXXFRSGXXXXXXXXXXXXFS 601
            TVFIANISHELRTPLNGILGMT+ ++ E             FRSG            FS
Sbjct: 546 KTVFIANISHELRTPLNGILGMTAIAMAEEDTAKVKSSLKLIFRSGELLLHIMTELLTFS 605

Query: 602 KNVLNKTKLEYREFNIIEITSQIKTIFNKLIQLQEVKLFIRXXXXXXXXXXXXYGDSNRI 661
           KNVL +TKLE R+F I++I  Q+++IF KL + Q V L I             +GDSNRI
Sbjct: 606 KNVLKRTKLEERDFQIVDIALQVESIFGKLAKDQHVNLTI-SILPNLLRSMVLWGDSNRI 664

Query: 662 LQVLMNLISNAIKFTPTVNGKVEVNMYLLGEYDEEESKTENYSKVCIKPSTQIVTESGEL 721
           +Q++MNL+SNA+KFTP V+GKV+V   LLGEYDEE+SK   Y +V + P T+  T S E 
Sbjct: 665 VQIVMNLVSNALKFTP-VDGKVDVKFRLLGEYDEEKSKASEYKEVFVLPPTESRTSSTEA 723

Query: 722 IKSKIRCKIXXXXXXXXXXXXXXXXRIESNTNQYLSPYSHTNT---------RTHTHP-G 771
              K                      ++S+TN    P +  +T         R+ +    
Sbjct: 724 KDEK-----------------NAESCVDSDTNVLSLPSTAESTDEKNVKIGQRSESEAID 766

Query: 772 ADXXXXXXXXXXXXXXXXXXXXXXKMYDNLMFNRLIKREGDGDINDIKALEQIEGNKKWV 831
           ++                        YD+ +F   ++++   + N+      +E  KKWV
Sbjct: 767 SEAIESSDEDDENEDTKSIGSGNTSSYDDAIFQTRLRKDSSNEENE--EGRALESPKKWV 824

Query: 832 IRFEVIDNGPGIDQNLHDSVFKPFVQGDQTLSRQYGGTGLGLSICKQLCEMMKGTLELES 891
           I  EV D GPGID  LH+SVF+PFVQGDQTLSRQYGGTGLGLSIC+QL  MM GT++L+S
Sbjct: 825 ISMEVHDTGPGIDPALHESVFEPFVQGDQTLSRQYGGTGLGLSICRQLATMMHGTMKLDS 884

Query: 892 ELGKGSKFIYTIPLLQ 907
           ++G GSKF +T+PL Q
Sbjct: 885 QVGVGSKFSFTVPLTQ 900

 Score =  163 bits (413), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 77/126 (61%), Positives = 98/126 (77%)

Query: 1011 IPSKLKVLVAEDNLVNQEVIKRMLKLENISDIELAFDGIEAFEKVKKNLLSYKKYDIIFM 1070
            +  + K+LVAEDN VNQEVIKRML LE + D+ELA DG +AF+KVK    + K YD+IFM
Sbjct: 1000 LADRRKILVAEDNNVNQEVIKRMLNLEGLEDVELACDGQDAFDKVKAQDATGKHYDLIFM 1059

Query: 1071 DIQMPKMDGLESTTKIRQELKYEGKIVALTAFADESNIKECRDAGMDGFIEKPIKRVALH 1130
            D+QMP++DGL +T  IR+EL Y   IVALTAFAD+SNIKEC DAGM+GF+ KPIKR  + 
Sbjct: 1060 DVQMPRVDGLTATRMIRKELGYSHPIVALTAFADDSNIKECLDAGMNGFLSKPIKRPKIK 1119

Query: 1131 TLLEEF 1136
             +L+E+
Sbjct: 1120 AILKEY 1125

>KAFR0D02240 Chr4 complement(450837..454400) [3564 bp, 1187 aa] {ON}
           Anc_5.700 YIL147C
          Length = 1187

 Score =  499 bits (1285), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 286/723 (39%), Positives = 391/723 (54%), Gaps = 25/723 (3%)

Query: 18  KPPYRFSLRAQLTILVCXXXXXXXXXXXXXXGVYFTTHYKDLNVNRLYIASQLKSSQIDQ 77
           KPPYR S+R QL  +V               GVYFT+ YK+L  NRLYIA+QLKSSQIDQ
Sbjct: 24  KPPYRISIRTQLIAVVSLVAILSLLILAVTTGVYFTSSYKNLRANRLYIAAQLKSSQIDQ 83

Query: 78  TLNYLYYQCYWVASRNTIQTMVFSNHTGMHNASGIIESQSVLDKFVGTSDLFYYTMIYDK 137
           TL YLYYQ YW+++R+T+Q  + +   G  ++S    ++SVL+KF+ +SD F    +YD+
Sbjct: 84  TLTYLYYQSYWISTRDTLQDSLANFVAGNKSSSNWESTESVLEKFLSSSDYFSAVKVYDE 143

Query: 138 NLKSIMNSTNNESGSNVEXXXXXXXXXXXXXXXXXXXXXXXXGILTDPILNSTKYLMSMS 197
           N  ++++ TNN +G+ +                         GILTDP+LN T YLMSMS
Sbjct: 144 NFDTVLSVTNNGTGNQI-AADVLEKLFPLSTNIPLSSSLETTGILTDPVLNGTSYLMSMS 202

Query: 198 LPISGPYSTATKIGNQSNIYGYLTVVMSAESLKSVFNDTAGLSDSTTALLSAIYTNDTLP 257
           LP+   ++  + I + S +YGY+T++M+A+ L SVFNDT  +  S  A++SA+Y N +  
Sbjct: 203 LPV---FANPSIILSTSRVYGYITIIMTADGLLSVFNDTTAIEKSNVAIVSAVYNNQSEL 259

Query: 258 RYFHFVFPPFDLDDSIIDERQTIKNGTFQYRAFDXXXXXXXXXXXXXXXXXYAIGYAPTN 317
             +H   PP+    S+ D    +KN +F   A                    A+GY+P +
Sbjct: 260 DAYHLALPPYGFTASVTDINFQLKNSSFLNGALKQGKGGSIKKTHFLYNKAVAVGYSPCS 319

Query: 318 FPLCKWVAVVALPDHQFYSESRKLTKIICGTVVGIAVFVFLISLPLSYWAVQPIVRLQRA 377
           F L  WV+VV+  +  F   S KLTKII G VVGI+VFV L++LPL+Y+AV+PIVRL++A
Sbjct: 320 FELANWVSVVSQAESVFSGPSTKLTKIIAGVVVGISVFVMLVTLPLAYFAVKPIVRLKKA 379

Query: 378 SELITKRRGLRNLX------------------XXXXXXXXXXXXXXXXXXXXXESKLISS 419
           +E+IT+ RGLR                                           S  +SS
Sbjct: 380 TEIITEGRGLRPTTPGSGSVSRTSSMRREKSPRTSIVSSRKSTATGNSNSLNENSASLSS 439

Query: 420 TPTLKNSDSNIHDEKSGRTRGDAXXXXXXXXXXXXXXXXXKDFNRLRRNVSVSTH-VSLS 478
            P +  S++ +    SG +R                       +   R    S H ++ +
Sbjct: 440 HPMVLTSENVLVTNHSGLSRIPVNMNQELLDRASASTVNTLTIDSNDRLSERSKHLITFT 499

Query: 479 EFDEIQVPVYRKLFDDELTELTDTFNVMSNALDEHYALLEKRVHQRTXXXXXXXXXXXXX 538
              E +VP+ RKLF DEL++LT+TFN M++ALDEHY LLE RV  RT             
Sbjct: 500 NLTEARVPIARKLFFDELSDLTETFNTMTDALDEHYTLLEDRVRARTKQLEAAKIQAEAA 559

Query: 539 XXXXTVFIANISHELRTPLNGILGMTSTSLEENXXXXXXXXXXXXFRSGXXXXXXXXXXX 598
               TVFIANISHELRTPLNGILGMT+ S+EE             FRSG           
Sbjct: 560 NEAKTVFIANISHELRTPLNGILGMTAISMEEEDITKIRSSLKLIFRSGELLLHILTELL 619

Query: 599 XFSKNVLNKTKLEYREFNIIEITSQIKTIFNKLIQLQEVKLFIRXXXXXXXXXXXXYGDS 658
            FSKNVL +TKLE R F I ++  Q+K+IF K+ + Q V+L I             YGDS
Sbjct: 620 TFSKNVLQRTKLEKRNFCITDVALQMKSIFGKVAKDQHVRLSI-ILSPNIMRTMVLYGDS 678

Query: 659 NRILQVLMNLISNAIKFTPTVNGKVEVNMYLLGEYDEEESKTENYSKVCIKPSTQIVTES 718
           NRI+QV+MNL+SNA+KFTP V+GKV+V + LLGEYDEE SK   + KV +K  T+  +  
Sbjct: 679 NRIIQVVMNLVSNALKFTP-VDGKVQVKIKLLGEYDEESSKNSKFEKVYVKGGTEFTSIP 737

Query: 719 GEL 721
            EL
Sbjct: 738 AEL 740

 Score =  278 bits (712), Expect = 5e-77,   Method: Compositional matrix adjust.
 Identities = 165/367 (44%), Positives = 215/367 (58%), Gaps = 45/367 (12%)

Query: 798  YDNLMFNRLIKR------EGDGDINDIKALEQIEGNKKWVIRFEVIDNGPGIDQNLHDSV 851
            YD+ +FN   K+      + DG++      E++   K WV R EVID GPGID +L +SV
Sbjct: 815  YDDAIFNSQFKKTPDLYEDEDGNLG-----EELSQQKTWVFRIEVIDTGPGIDSSLQESV 869

Query: 852  FKPFVQGDQTLSRQYGGTGLGLSICKQLCEMMKGTLELESELGKGSKFIYTIPLLQVGGX 911
            F+PFVQGDQTLSRQYGGTGLGLSIC+QL  MM GT+ LES +G GSKFI+T+PL Q    
Sbjct: 870  FEPFVQGDQTLSRQYGGTGLGLSICRQLATMMNGTMTLESTVGSGSKFIFTVPLTQTRVI 929

Query: 912  XXXXXXXXXXXXXXXXSSVDIDIIEDTPVS----------ITSSS------------QTH 949
                            S ++  +  +   S          ITS+S            +T 
Sbjct: 930  KLDESEHPYEDEFNPKSKMNRKVKFNVARSINSRRSRSSLITSNSSRIATVREESRLETR 989

Query: 950  SDLNSLQSNSTNEVGLDDSFSEAENDSTVASLDKSVLQKTRMDAQKVEANEIDDIDHCNK 1009
            S+ + + +++ NE     S S      +  +LD+  LQ T      + +  +  +    K
Sbjct: 990  SNHSDVSTSNKNE-----SASPQPESGSNLNLDRPFLQST---GTAISSANVPTVATLGK 1041

Query: 1010 GIPSKLKVLVAEDNLVNQEVIKRMLKLENISDIELAFDGIEAFEKVKKNLLSYKKYDIIF 1069
                 L VLVAEDN VNQEVIKRML LE + +I+LA DG +AF+ VK      + YD+IF
Sbjct: 1042 ----TLNVLVAEDNHVNQEVIKRMLSLEGVKNIDLACDGQDAFDNVKSLKERGEFYDMIF 1097

Query: 1070 MDIQMPKMDGLESTTKIRQELKYEGKIVALTAFADESNIKECRDAGMDGFIEKPIKRVAL 1129
            MD+QMPK+DGL +T  IR +LKYE  IVALTAFAD+SNIKEC DAGMDGF+ KPIKR  L
Sbjct: 1098 MDVQMPKVDGLSATKMIRNDLKYEHPIVALTAFADDSNIKECLDAGMDGFLSKPIKRPQL 1157

Query: 1130 HTLLEEF 1136
             T+L E+
Sbjct: 1158 KTILLEY 1164

>KLLA0A00638g Chr1 complement(60378..63845) [3468 bp, 1155 aa] {ON}
           similar to uniprot|P39928 Saccharomyces cerevisiae
           YIL147C SLN1 Histidine kinase osmosensor that regulates
           a MAP kinase cascade; transmembrane protein with an
           intracellular kinase domain that signals to Ypd1p and
           Ssk1p, thereby forming a phosphorelay system similar to
           bacterial two-component regulators
          Length = 1155

 Score =  483 bits (1244), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 277/721 (38%), Positives = 388/721 (53%), Gaps = 20/721 (2%)

Query: 7   KIKLKMNKQTVKPPYRFSLRAQLTILVCXXXXXXXXXXXXXXGVYFTTHYKDLNVNRLYI 66
           +  LK  ++   PP+   LR QL ILVC              GVYFTT+YK +   RL +
Sbjct: 8   RCSLKALRERFTPPFNVGLRTQLIILVCSICVLSLTIITVTTGVYFTTNYKSVRAERLQV 67

Query: 67  ASQLKSSQIDQTLNYLYYQCYWVASRNTIQTMVFSNHTGMHNASGIIESQSVLDKFVGTS 126
           A+QLKSSQ+DQ LNYLYYQ YW+++R+T+Q  + +   G  +      ++  L+KF+G+S
Sbjct: 68  AAQLKSSQVDQNLNYLYYQIYWLSTRDTLQDALVNFRAGNSSRDNWNSAEDSLEKFLGSS 127

Query: 127 DLFYYTMIYDKNLKSIMNSTNNESGSNVEXXXXXXXXXXXXXXXXXXXXXXXXGILTDPI 186
            LF    +YD +  +++NSTNN SG N+                         GI+TDP+
Sbjct: 128 GLFSAARVYDTSFNTVINSTNNGSGDNIP-ENVLAELFPLSGVEPLSSSLLTTGIVTDPV 186

Query: 187 LNSTKYLMSMSLPISGPYSTATKIGNQSNIYGYLTVVMSAESLKSVFNDTAGLSDSTTAL 246
            N T YL+SMSLP+S   +  + I N + I GY+TV+ SAESLK+V NDT  L  S+ ++
Sbjct: 187 YNWTNYLLSMSLPVS---TNPSIILNTNEIAGYITVIASAESLKAVVNDTIALDKSSVSI 243

Query: 247 LSAIYTNDTLPRYFHFVFPPFDLDDSIIDERQTIKNGTFQYRAFDXXXXXXXXXXXXXXX 306
           LSA++ +++    +HFVFPP             IKNGTF   AF+               
Sbjct: 244 LSAVFDSNSSLTGYHFVFPPHGTSSFSSKVTFPIKNGTFIADAFENGKVGSVMKTNMVQE 303

Query: 307 XXYAIGYAPTNFPLCKWVAVVALPDHQFYSESRKLTKIICGTVVGIAVFVFLISLPLSYW 366
              A+GY+P  F L  WVAVV  P+  F S + +L KII GTV  IAVF+ L++ P+++W
Sbjct: 304 RNIAVGYSPPTFKLVNWVAVVTQPEQVFLSPTIRLMKIIAGTVCAIAVFMCLLTFPIAHW 363

Query: 367 AVQPIVRLQRASELITKRRGLRNLXXXXXXXXXXXXXXXXXXXXXXESKLI--------S 418
           AVQPIVRLQ+A+E+IT  R L++                       +++++         
Sbjct: 364 AVQPIVRLQKATEIITSGRDLKHYSNTGNSDSNTAITHSRTRSTSNQNQVMKLFNKSVTK 423

Query: 419 STPT-LKNSDSNIH-----DEKSGRTRGDAXXXXXXXXXXXXXXXXXKDFNRLRRNVSVS 472
            TP+   N + N+      D  S   R                      F+    + +  
Sbjct: 424 GTPSNYLNHNYNVFPPSRTDSPSVSARNSQTIPRGPGDLTRSATTGSTPFSNDSSSYTSE 483

Query: 473 THVSLSEFDEIQVPVYRKLFDDELTELTDTFNVMSNALDEHYALLEKRVHQRTXXXXXXX 532
            ++  +   E  VPVYR+ F DEL+ELTDTFN M++ LD HYALLE+RV  RT       
Sbjct: 484 RYIKSTNLVEAYVPVYRRFFQDELSELTDTFNTMTDELDRHYALLEERVRARTKQLEAAK 543

Query: 533 XXXXXXXXXXTVFIANISHELRTPLNGILGMTSTSLEENXXXXXXXXXXXXFRSGXXXXX 592
                     TVFIANISHELRTPLNGILGMT+ ++ E             FRSG     
Sbjct: 544 IQAESANEAKTVFIANISHELRTPLNGILGMTAIAMAETDMQKVQNSLKLIFRSGELLLH 603

Query: 593 XXXXXXXFSKNVLNKTKLEYREFNIIEITSQIKTIFNKLIQLQEVKLFIRXXXXXXXXXX 652
                  FSKNVL +TKLE R+F++++I  QIK+IF KL + Q VKL I           
Sbjct: 604 ILTELLTFSKNVLKRTKLEERDFSVMDIALQIKSIFGKLAKDQHVKLSI-ALTPNFIRTL 662

Query: 653 XXYGDSNRILQVLMNLISNAIKFTPTVNGKVEVNMYLLGEYDEEESKTENYSKVCIKPST 712
             +GDSNRI+Q++MNL+SNA+KFTP V+GKV+V + LLGEYD + S++ +Y +V + P +
Sbjct: 663 VLWGDSNRIIQIVMNLVSNALKFTP-VDGKVDVRIKLLGEYDSKRSESVDYQEVFVVPGS 721

Query: 713 Q 713
           +
Sbjct: 722 E 722

 Score =  264 bits (675), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 151/348 (43%), Positives = 209/348 (60%), Gaps = 24/348 (6%)

Query: 798  YDNLMFNRLIKR---EGDGDINDIKALEQIEGNKKWVIRFEVIDNGPGIDQNLHDSVFKP 854
            YD+ +F+   K+     D D  +      ++  K WVI  EV D G GID +L +SVF+P
Sbjct: 813  YDDAIFHSQFKKVLSSTDSDTEE-NTFRDLKVPKTWVISMEVEDTGSGIDPSLQESVFEP 871

Query: 855  FVQGDQTLSRQYGGTGLGLSICKQLCEMMKGTLELESELGKGSKFIYTIPLLQV------ 908
            FVQGDQTLSRQYGGTGLGLSIC+QL +MMKGT++L+S++G GSKFI+T+PL Q       
Sbjct: 872  FVQGDQTLSRQYGGTGLGLSICRQLAKMMKGTMKLDSKVGVGSKFIFTVPLQQTKEIVFD 931

Query: 909  GGXXXXXXXXXXXXXXXXXSSVDIDIIEDTPVSITSSSQTHSDLNSLQSNSTNEVGLDDS 968
            G                      I+       S   S QT    +S+  +S N V    +
Sbjct: 932  GAEKQFEDEFNIHSRKNRKVKFKIN-------SSRKSVQTKKSKSSIDGHSDNNVSERKA 984

Query: 969  FSEAENDSTVASLDKSVLQKTRMDAQKVEANEIDDIDHCNKGIPSKLKVLVAEDNLVNQE 1028
             +  EN      +D+  LQ T        A     I      + ++ +VLVAEDN VNQE
Sbjct: 985  SNSTENSVGNVRVDRPFLQSTGT------ATSTRSISSVASEV-TRHRVLVAEDNNVNQE 1037

Query: 1029 VIKRMLKLENISDIELAFDGIEAFEKVKKNLLSYKKYDIIFMDIQMPKMDGLESTTKIRQ 1088
            VIKRML+LE ++D+++A DG EA+EKV++ L + + Y +IFMD+QMP++DGL +T  IR 
Sbjct: 1038 VIKRMLQLEGLTDLDMACDGQEAYEKVEEILKNGESYSMIFMDVQMPRVDGLLATKMIRN 1097

Query: 1089 ELKYEGKIVALTAFADESNIKECRDAGMDGFIEKPIKRVALHTLLEEF 1136
            +L Y+G IVALTA+AD+SNIK C ++GMDGF+ KPIKR  L  ++ ++
Sbjct: 1098 DLLYKGPIVALTAYADDSNIKVCLESGMDGFLPKPIKRPLLKKIIAQY 1145

>Kpol_2001.74 s2001 (202108..205449) [3342 bp, 1113 aa] {ON}
           (202108..205449) [3342 nt, 1114 aa]
          Length = 1113

 Score =  482 bits (1241), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 297/731 (40%), Positives = 396/731 (54%), Gaps = 45/731 (6%)

Query: 14  KQTVKPPYRFSLRAQLTILVCXXXXXXXXXXXXXXGVYFTTHYKDLNVNRLYIASQLKSS 73
           ++  KPPYR ++RAQLT LV               GVYFT +YK+L   RL IA++LKSS
Sbjct: 6   RKAFKPPYRITIRAQLTALVSLVAIISLIILAVTTGVYFTENYKELRSGRLNIAAKLKSS 65

Query: 74  QIDQTLNYLYYQCYWVASRNTIQTMVFSNHTGMHNASGIIESQSVLDKFVGTSDLFYYTM 133
           QIDQTLNYL+YQC ++ SR+T+Q  + +   G       IES++V+ KF+ +SDLFY   
Sbjct: 66  QIDQTLNYLFYQCRYLTSRDTLQNALINYEAGNKTYENWIESENVVQKFLSSSDLFYVAR 125

Query: 134 IYDKNLKSIMNSTNNESGSNVEXXXXXXXXXXXXXXXXXXXXXXXXGILTDPILNSTKYL 193
           +YD N K ++N+TNN +G  +                         GILTDP+LN + YL
Sbjct: 126 LYDLNFKQVVNATNNGTGDLIPNEVLSELFPLSTNQSLPSSLNND-GILTDPVLNGSIYL 184

Query: 194 MSMSLPISGPYSTATKIGNQSNIYGYLTVVMSAESLKSVFNDTAGLSDSTTALLSAIYTN 253
           MSMSLPI    +  + I + S +YGY+T+VMSA+ LK+V+ +   L +S   ++SAIY +
Sbjct: 185 MSMSLPI---LTNPSIILSSSRVYGYITIVMSADGLKNVYLNNTALENSNVTVISAIYND 241

Query: 254 DTLPRYFHFVFPPFDLDDSIIDERQTIKNGTFQYRAFDXXXXXXXXXXXXXXXXXYAIGY 313
                 FHFVF   + D S + E   I+NGT+   A                    AIGY
Sbjct: 242 QGKVDGFHFVFEVENDDFSTLIE-YPIQNGTYLSSALVEGKSGSIKKTKYPFNRELAIGY 300

Query: 314 APTNFPLCKWVAVVALPDHQFYSESRKLTKIICGTVVGIAVFVFLISLPLSYWAVQPIVR 373
           +P +F L  WVA+V  P+  F S S KL KII GTVV IAVFV LI+ PLS+WAV+PIVR
Sbjct: 301 SPCSFSLSNWVALVTQPEAVFLSPSTKLEKIISGTVVAIAVFVCLITFPLSHWAVKPIVR 360

Query: 374 LQRASELITKRRGLRNLXXXXXXXXXXXXXXXXXXXXXXESKLISSTPTLK--------- 424
           LQ+A+ELI++    R L                      ES + +S    K         
Sbjct: 361 LQKATELISQG---RGLKPTSNFSNGDSSSTSDNWRESVESHVRASLGIFKSLRNNGSNE 417

Query: 425 ---NSDSNIHDEKSGR--TRGDAXXXXXXXXXXXXXXXXXKDFNRLRRNVSVSTHVSLSE 479
              N D N  +E+S +  + GD                    F R           + S 
Sbjct: 418 LQSNDDMNEINERSSKNNSTGD--------NIKSSDNDSSSSFQRY----------TTSN 459

Query: 480 FDEIQVPVYRKLFDDELTELTDTFNVMSNALDEHYALLEKRVHQRTXXXXXXXXXXXXXX 539
             + +VPVY +   DEL+ELTDTFN M+NALD+HY LLE RV  RT              
Sbjct: 460 LVQARVPVYGRFLQDELSELTDTFNAMTNALDQHYTLLEDRVRARTKQLEAAKIEAEAAN 519

Query: 540 XXXTVFIANISHELRTPLNGILGMTSTSLEENXXXXXXXXXXXXFRSGXXXXXXXXXXXX 599
              TVFIANISHELRTPLNGILGMT+ S+EE+            FRSG            
Sbjct: 520 EAKTVFIANISHELRTPLNGILGMTAISMEEDDSDKIKENLKLIFRSGELLLHILTELLT 579

Query: 600 FSKNVLNKTKLEYREFNIIEITSQIKTIFNKLIQLQEVKLFIRXXXXXXXXXXXXYGDSN 659
           FSKNVL +T LE R+F I EI  QIK+IF K+ + Q VKL I             +GDSN
Sbjct: 580 FSKNVLKRTNLEKRDFCITEIALQIKSIFGKVARDQHVKLLI-ILMPNRIRSMVLWGDSN 638

Query: 660 RILQVLMNLISNAIKFTPTVNGKVEVNMYLLGEYDEEESKTENYSKVCIKPSTQIVTESG 719
           RI+Q++MNL+SNA+KFTP ++GKV+V + LLGEYDEE S  ++Y +V IK  T++   +G
Sbjct: 639 RIIQIVMNLVSNALKFTP-IDGKVDVRIKLLGEYDEERSMNDDYKEVYIKSGTELPIGNG 697

Query: 720 ---ELIKSKIR 727
              ++++ KI+
Sbjct: 698 KKTDMVRKKIQ 708

 Score =  271 bits (693), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 159/345 (46%), Positives = 212/345 (61%), Gaps = 9/345 (2%)

Query: 796  KMYDNLMFNRLIKREGDGDINDIKALEQIEGNKKWVIRFEVIDNGPGIDQNLHDSVFKPF 855
            + YD+    R  K+  D D  +     ++   K WVI  EV D GPGI+  L ++VF+PF
Sbjct: 766  RSYDDAALQRQFKKTPDLDDKEETLGVELSEPKTWVISVEVEDTGPGIEPKLQEAVFEPF 825

Query: 856  VQGDQTLSRQYGGTGLGLSICKQLCEMMKGTLELESELGKGSKFIYTIPLLQVGGXXXXX 915
            VQGDQ LSRQYGGTGLGLSIC+QL  MM GT++LES +G GSKFI+T+PL Q        
Sbjct: 826  VQGDQALSRQYGGTGLGLSICRQLATMMHGTMKLESTVGVGSKFIFTVPLKQTREIHFDD 885

Query: 916  XXXXXXXXXXXXSSVDIDI-IEDTPVSITSSSQTHSDLNSLQS-NSTNEVGLDDSFSEAE 973
                         +  I   I D+  S  S+ +    + S +  +S+N    D++ +  +
Sbjct: 886  EKFEDEFNAESKKNRRIKFKIYDSSKSHDSNDEDEEGIKSSRDIDSSNNEHKDENGTSPD 945

Query: 974  NDSTVASLDKSVLQKT--RMDAQKVEANEIDDIDHCNKGIPSKLKVLVAEDNLVNQEVIK 1031
            N S V  LD+  LQ T     +QK+       I+  +  I   +++LVAEDN VNQEVIK
Sbjct: 946  NHSKV-RLDRPFLQSTGTATSSQKIPTL----INKEDTNIEKSIRILVAEDNHVNQEVIK 1000

Query: 1032 RMLKLENISDIELAFDGIEAFEKVKKNLLSYKKYDIIFMDIQMPKMDGLESTTKIRQELK 1091
            RML LE I +I+LA DG +AF+KVK    + + YDIIFMD+QMPK+DGL ST  IR++L 
Sbjct: 1001 RMLNLEKIDNIDLACDGQDAFDKVKSLADNEEYYDIIFMDVQMPKVDGLVSTKMIRKDLN 1060

Query: 1092 YEGKIVALTAFADESNIKECRDAGMDGFIEKPIKRVALHTLLEEF 1136
            Y+  IVALTAFA++ NIKEC DAGMDGF+ KPIKR  L  +L+E+
Sbjct: 1061 YKHPIVALTAFANDDNIKECLDAGMDGFLGKPIKRPKLKQILQEY 1105

>SAKL0E14872g Chr5 (1231857..1235279) [3423 bp, 1140 aa] {ON} similar
            to uniprot|P39928 Saccharomyces cerevisiae YIL147C SLN1
            Histidine kinase osmosensor that regulates a MAP kinase
            cascade; transmembrane protein with an intracellular
            kinase domain that signals to Ypd1p and Ssk1p, thereby
            forming a phosphorelay system similar to bacterial
            two-component regulators
          Length = 1140

 Score =  468 bits (1203), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 282/668 (42%), Positives = 370/668 (55%), Gaps = 25/668 (3%)

Query: 482  EIQVPVYRKLFDDELTELTDTFNVMSNALDEHYALLEKRVHQRTXXXXXXXXXXXXXXXX 541
            + +VPVY +LF DEL+ELTDTFN M++ LD HYALLE RV  RT                
Sbjct: 479  DARVPVYGRLFSDELSELTDTFNTMTDELDRHYALLEDRVRARTKQLEAAKIEAEAANEA 538

Query: 542  XTVFIANISHELRTPLNGILGMTSTSLEENXXXXXXXXXXXXFRSGXXXXXXXXXXXXFS 601
             TVFIANISHELRTPLNGILGMT+ S+ E             FRSG            FS
Sbjct: 539  KTVFIANISHELRTPLNGILGMTAISMAEKDMQKVQNSLKLIFRSGELLLHILTELLTFS 598

Query: 602  KNVLNKTKLEYREFNIIEITSQIKTIFNKLIQLQEVKLFIRXXXXXXXXXXXXYGDSNRI 661
            KNVL +TKLE R F I+++  Q+K+IF KL + Q V L I             +GDSNRI
Sbjct: 599  KNVLQRTKLEERNFAIMDVALQVKSIFGKLAKDQHVNLSI-ILSPNVIRTMILWGDSNRI 657

Query: 662  LQVLMNLISNAIKFTPTVNGKVEVNMYLLGEYDEEESKTENYSKVCIKPSTQIVTESGE- 720
            +Q++MNL+SNA+KF+P V+GKV V + LLGEYD ++SK  NY+ V IKP T+I   S   
Sbjct: 658  IQIVMNLVSNALKFSP-VDGKVGVRIKLLGEYDGKKSKDSNYNDVFIKPGTEIPDASASK 716

Query: 721  -----LIKSKIRCKIXXXXXXXXXXXXXXXXRIESNTNQYLSPYSHTNTRTHTHPGADXX 775
                 L  +K+                     I S      S  S ++ +  +    D  
Sbjct: 717  SSLSTLEYTKVDAIQRRLASKSSDSQKLKEEPIAS------SDVSSSDGKDESEADTDTD 770

Query: 776  XXXXXXXXXXXXXXXXXXXXKMYDNLMFN---RLIKREGDGDINDIKALEQIEGNKKWVI 832
                                  YD+ + +   R +   G+G+ +      ++E +K WVI
Sbjct: 771  TDKRSNSEISDSLSLVSSNNSSYDDAILHAQLRKVPSCGNGEDSGDSLGRKLEISKTWVI 830

Query: 833  RFEVIDNGPGIDQNLHDSVFKPFVQGDQTLSRQYGGTGLGLSICKQLCEMMKGTLELESE 892
              EV D GPGI+  LH+SVF+PFVQGDQTLSRQYGGTGLGLSIC+QL +MMKGT++LES+
Sbjct: 831  AIEVEDTGPGIEPALHESVFEPFVQGDQTLSRQYGGTGLGLSICRQLAKMMKGTMKLESK 890

Query: 893  LGKGSKFIYTIPLLQVGGXXXXXXXXXXXXXXXXXSSVDIDIIEDTPVSITSSSQTHSDL 952
            +G GSKF +T+PL Q                    S  +  +      + +  S++   +
Sbjct: 891  VGVGSKFTFTVPLTQTREVSFDDVENPFEDEFNAHSKKNRKVKFKMNKN-SGGSKSRPSV 949

Query: 953  NSLQSNSTNEVGLDDSFSEAENDSTVASLDKSVLQKTRMDAQKVEANEIDDIDHCNKGIP 1012
            N+  ++ T+      + SE+E       +D+  LQ T           I  +    K + 
Sbjct: 950  NTSLNSGTDSTAEKMALSESEVSVGSVRVDRPFLQST---GTATSTRSITTV----KSLE 1002

Query: 1013 SKLKVLVAEDNLVNQEVIKRMLKLENISDIELAFDGIEAFEKVKKNLLSYKKYDIIFMDI 1072
               K+LVAEDN VNQEV+KRML LE +SDI+LA DG EAF+KVK    +   Y IIFMD+
Sbjct: 1003 RPFKILVAEDNNVNQEVVKRMLNLEGLSDIDLACDGQEAFDKVKALQEANDHYRIIFMDV 1062

Query: 1073 QMPKMDGLESTTKIRQELKYEGKIVALTAFADESNIKECRDAGMDGFIEKPIKRVALHTL 1132
            QMP++DGL ST  IRQEL+Y   IVALTAFAD+SNIK C D+GM+GF+ KPIKR  L ++
Sbjct: 1063 QMPRVDGLLSTKMIRQELRYSHPIVALTAFADDSNIKVCLDSGMNGFLSKPIKRPKLKSV 1122

Query: 1133 LEEFQQDL 1140
            L EF  D 
Sbjct: 1123 LSEFCPDF 1130

 Score =  340 bits (871), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 172/376 (45%), Positives = 232/376 (61%), Gaps = 4/376 (1%)

Query: 14  KQTVKPPYRFSLRAQLTILVCXXXXXXXXXXXXXXGVYFTTHYKDLNVNRLYIASQLKSS 73
           +  +KPP++  +R QL  LVC              GVYFT +YK L  +RL++A+QLKSS
Sbjct: 8   RSKLKPPFKVGIRTQLIALVCVVALLSLVILAVTTGVYFTANYKSLRADRLHVAAQLKSS 67

Query: 74  QIDQTLNYLYYQCYWVASRNTIQTMVFSNHTGMHNASGIIESQSVLDKFVGTSDLFYYTM 133
           QIDQ LNYLYYQCYW+++R+T+Q  +     G        E++ VL+KF+G+SDLF    
Sbjct: 68  QIDQNLNYLYYQCYWLSTRDTLQDSLIRYRAGNTTKENWSEAEIVLEKFLGSSDLFSVAR 127

Query: 134 IYDKNLKSIMNSTNNESGSNVEXXXXXXXXXXXXXXXXXXXXXXXXGILTDPILNSTKYL 193
           IYD   K+++N+TNN SG N+                         GILTDP+LN T Y+
Sbjct: 128 IYDSTFKTVLNATNNGSG-NLVPEHVLTNLFPLSTDDPLASSLQTSGILTDPVLNDTVYV 186

Query: 194 MSMSLPISGPYSTATKIGNQSNIYGYLTVVMSAESLKSVFNDTAGLSDSTTALLSAIYTN 253
           MSMSLPI   +++ + +   S I GY+TVVMSAESLK VFNDT  L  S  A+LSA Y+N
Sbjct: 187 MSMSLPI---FASPSIMLTNSEISGYITVVMSAESLKIVFNDTTALDKSDVAILSAEYSN 243

Query: 254 DTLPRYFHFVFPPFDLDDSIIDERQTIKNGTFQYRAFDXXXXXXXXXXXXXXXXXYAIGY 313
            +LP  +HFVFPP  +   IID   TI+NG+F   AFD                  A+GY
Sbjct: 244 QSLPVSYHFVFPPHGVGADIIDYSFTIENGSFIQSAFDDRKSGSVKRTSFFYGKDVAVGY 303

Query: 314 APTNFPLCKWVAVVALPDHQFYSESRKLTKIICGTVVGIAVFVFLISLPLSYWAVQPIVR 373
           +P  F   +WVAV++ P++ F S S +LT II GT +GIAVF+ L++ PL++WAV+PIVR
Sbjct: 304 SPCLFKQVQWVAVISQPENVFLSPSTRLTNIIIGTALGIAVFMCLVTFPLAHWAVKPIVR 363

Query: 374 LQRASELITKRRGLRN 389
           LQ+A+E+IT RRGLR+
Sbjct: 364 LQKATEIITARRGLRS 379

>KNAG0L02110 Chr12 (376096..379698) [3603 bp, 1200 aa] {ON}
           Anc_5.700 YIL147C
          Length = 1200

 Score =  332 bits (850), Expect = 3e-95,   Method: Compositional matrix adjust.
 Identities = 198/450 (44%), Positives = 254/450 (56%), Gaps = 25/450 (5%)

Query: 463 NRLRRNVSVSTHVSLS-EFDEIQVPVYRKLFDDELTELTDTFNVMSNALDEHYALLEKRV 521
           +RL R  + S H + +    + +VP YR LF DEL++LT+TFN M++ALD+HYALLE+RV
Sbjct: 463 DRLERLSNTSKHYTTAVNLIQARVPSYRALFKDELSDLTETFNTMTDALDQHYALLEERV 522

Query: 522 HQRTXXXXXXXXXXXXXXXXXTVFIANISHELRTPLNGILGMTSTSLEENXXXXXXXXXX 581
             RT                 TVFIANISHELRTPLNGILGMT+ S+EE           
Sbjct: 523 RARTKQLEAAKIEAETANEAKTVFIANISHELRTPLNGILGMTAISMEETDIDKIRNSLK 582

Query: 582 XXFRSGXXXXXXXXXXXXFSKNVLNKTKLEYREFNIIEITSQIKTIFNKLIQLQEVKLFI 641
             FRSG            FSKNVL +TKLE R F I ++  QIK+IF K+ + Q V+L I
Sbjct: 583 LIFRSGELLLHILTELLTFSKNVLKRTKLEKRNFCITDVALQIKSIFGKVAKDQHVRLSI 642

Query: 642 RXXXXXXXXXXXXYGDSNRILQVLMNLISNAIKFTPTVNGKVEVNMYLLGEYDEEESKTE 701
                        YGDSNRI+Q++MNL+SNA+KFTP V+GKV+V M +LG YDE  S+  
Sbjct: 643 -ILSPNMIRSMVLYGDSNRIIQIVMNLVSNALKFTP-VDGKVDVRMKVLGLYDEALSEKY 700

Query: 702 NYSKVCIKPSTQIVTESGEL-IKSKIRCKIXXXXXXXXXXXXXXXXRIESNTNQYLSPYS 760
           N++KV +KP T+I   +  L +KS+ + K                     N     + Y 
Sbjct: 701 NHNKVYVKPGTEITDSTPSLNVKSEGQGK-----------DKFTSDTASKNNTSSDTAYD 749

Query: 761 HTNTRTHTHPGADXXXXXXXXXXXXXXXXXXXXXXKMYDNLMFNRLIKREG---DGDIND 817
            T T       +D                        YD+ +FN   K+     D D   
Sbjct: 750 ATPTTDRVAQESDEDNMYEDNESMISSTTSS------YDDAIFNSQFKKTTNLYDEDDES 803

Query: 818 IKALEQIEGNKKWVIRFEVIDNGPGIDQNLHDSVFKPFVQGDQTLSRQYGGTGLGLSICK 877
              +E +E  K WVI FEV D+GPGID+ L +SVF+PFVQGDQTLSRQYGGTGLGLSIC+
Sbjct: 804 EMGVE-LETPKTWVISFEVEDSGPGIDKGLQESVFEPFVQGDQTLSRQYGGTGLGLSICR 862

Query: 878 QLCEMMKGTLELESELGKGSKFIYTIPLLQ 907
           QL  MMKG + LES++G GSKF +T+PL Q
Sbjct: 863 QLAGMMKGKMLLESKVGVGSKFTFTLPLTQ 892

 Score =  332 bits (850), Expect = 4e-95,   Method: Compositional matrix adjust.
 Identities = 173/379 (45%), Positives = 231/379 (60%), Gaps = 4/379 (1%)

Query: 10  LKMNKQTVKPPYRFSLRAQLTILVCXXXXXXXXXXXXXXGVYFTTHYKDLNVNRLYIASQ 69
            ++   T KPPYR  +RAQLT+LV               GVYFT++YK+L  +RLYIA+Q
Sbjct: 3   FRLRSFTPKPPYRVGIRAQLTMLVSIVAIISLVILAVTTGVYFTSNYKNLRSDRLYIAAQ 62

Query: 70  LKSSQIDQTLNYLYYQCYWVASRNTIQTMVFSNHTGMHNASGIIESQSVLDKFVGTSDLF 129
           LKSSQIDQ LNYLYYQCYWVASR+T+QT + +   G  + +  ++SQSVL+KF+G+S+LF
Sbjct: 63  LKSSQIDQNLNYLYYQCYWVASRDTLQTGLANYVAGNKSDANWMDSQSVLEKFLGSSNLF 122

Query: 130 YYTMIYDKNLKSIMNSTNNESGSNVEXXXXXXXXXXXXXXXXXXXXXXXXGILTDPILNS 189
               +YD +  +++N+TNN +G  +                         GI+T+P+ N 
Sbjct: 123 SVARVYDSSFTTVLNTTNNSTGDLIP-EDVLTQLLPLSTNVPLPSSLETNGIVTNPVKNG 181

Query: 190 TKYLMSMSLPISGPYSTATKIGNQSNIYGYLTVVMSAESLKSVFNDTAGLSDSTTALLSA 249
           + YLMSMSLPI   ++  + I   S +YGY+TVVMSAE L SVFNDT  L  S  A++SA
Sbjct: 182 SSYLMSMSLPI---FANPSIILTDSRVYGYVTVVMSAEGLLSVFNDTTALERSYVAIVSA 238

Query: 250 IYTNDTLPRYFHFVFPPFDLDDSIIDERQTIKNGTFQYRAFDXXXXXXXXXXXXXXXXXY 309
           +YTN T    + FVFPPF    SI++E   + N TF   A                    
Sbjct: 239 VYTNATKLDAYRFVFPPFGSTSSILNETFPLNNNTFLSSALRQGKGGALKSTRLFYRLKL 298

Query: 310 AIGYAPTNFPLCKWVAVVALPDHQFYSESRKLTKIICGTVVGIAVFVFLISLPLSYWAVQ 369
           A+GY+P+   L  WVA+VA  +  F S + KL KII GTVVGI VF  LI+ PL++WAV+
Sbjct: 299 AVGYSPSTSNLANWVAIVAQAESVFISPATKLAKIIAGTVVGIGVFAMLITFPLAHWAVK 358

Query: 370 PIVRLQRASELITKRRGLR 388
           PIVRLQ+A+ELIT+ RGLR
Sbjct: 359 PIVRLQKATELITESRGLR 377

 Score =  166 bits (419), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 80/124 (64%), Positives = 98/124 (79%)

Query: 1016 KVLVAEDNLVNQEVIKRMLKLENISDIELAFDGIEAFEKVKKNLLSYKKYDIIFMDIQMP 1075
            K+LVAEDN VNQEVIKRML+LE + DI+LA DG +AF+KVK+      +Y++IFMD+QMP
Sbjct: 1066 KILVAEDNHVNQEVIKRMLQLEGVKDIDLACDGQDAFDKVKQLQDKGSRYNLIFMDVQMP 1125

Query: 1076 KMDGLESTTKIRQELKYEGKIVALTAFADESNIKECRDAGMDGFIEKPIKRVALHTLLEE 1135
            K+DGL ST  IR +L  +  IVALTAFAD+SNIKEC DAGMDGF+ KPIKR  L T+L+E
Sbjct: 1126 KVDGLTSTKMIRHDLHCDFPIVALTAFADDSNIKECLDAGMDGFLSKPIKRTKLKTILKE 1185

Query: 1136 FQQD 1139
            F  D
Sbjct: 1186 FCSD 1189

>ZYRO0G06644g Chr7 complement(528671..532171) [3501 bp, 1166 aa]
           {ON} similar to uniprot|P39928 Saccharomyces cerevisiae
           YIL147C SLN1 Histidine kinase osmosensor that regulates
           a MAP kinase cascade; transmembrane protein with an
           intracellular kinase domain that signals to Ypd1p and
           Ssk1p, thereby forming a phosphorelay system similar to
           bacterial two-component regulators
          Length = 1166

 Score =  331 bits (848), Expect = 4e-95,   Method: Compositional matrix adjust.
 Identities = 194/438 (44%), Positives = 249/438 (56%), Gaps = 31/438 (7%)

Query: 482 EIQVPVYRKLFDDELTELTDTFNVMSNALDEHYALLEKRVHQRTXXXXXXXXXXXXXXXX 541
           E +VPVYR+ F DEL+ELTDTFN M++ALD+HYALLE RV  RT                
Sbjct: 468 EARVPVYRRFFSDELSELTDTFNTMTDALDQHYALLEDRVRARTRQLEAAKIDAEAANEA 527

Query: 542 XTVFIANISHELRTPLNGILGMTSTSLEENXXXXXXXXXXXXFRSGXXXXXXXXXXXXFS 601
            TVFIANISHELRTPLNGILGMT+ S+EE             FRSG            FS
Sbjct: 528 KTVFIANISHELRTPLNGILGMTAISMEERDIDKIQNSLKLIFRSGELLLHILTELLTFS 587

Query: 602 KNVLNKTKLEYREFNIIEITSQIKTIFNKLIQLQEVKLFIRXXXXXXXXXXXXYGDSNRI 661
           KNVL +TKLE R F++ ++  QIK+IF K+ + Q V+L I             +GDSNRI
Sbjct: 588 KNVLKRTKLEKRNFSVTDVALQIKSIFGKVAKDQRVRLSI-TLYPNLIRTMVLFGDSNRI 646

Query: 662 LQVLMNLISNAIKFTPTVNGKVEVNMYLLGEYDEEESKTENYSKVCIKPSTQIVTESGEL 721
           +Q++MNL+SNA+KFTP V+GKV V M LLGEYD E S+ EN+ KV + P T+    + E 
Sbjct: 647 IQIVMNLVSNALKFTP-VDGKVNVYMSLLGEYDAERSENENHKKVYVIPGTE-PKGNDEK 704

Query: 722 IKSKIRCKIXXXXXXXXXXXXXXXXRIESNTNQYLSPYSHTNTRTHTHPG---------A 772
            K  I  K                  IE+  N   S  S+ ++ T T PG         +
Sbjct: 705 DKGGIEEK--------------ERFSIENTPNDTSSNSSNKHSDTETTPGLNDTDEKQAS 750

Query: 773 DXXXXXXXXXXXXXXXXXXXXXXKMYDNLMFNRLIKREGDGDINDIKALE---QIEGNKK 829
           D                        Y++ +F+   K+     + D  + E   +++  KK
Sbjct: 751 DDMDGGEEDVEDADEVSSFSTSTSSYNDTVFHSQFKKT--PKVCDDSSEELGVEVKDKKK 808

Query: 830 WVIRFEVIDNGPGIDQNLHDSVFKPFVQGDQTLSRQYGGTGLGLSICKQLCEMMKGTLEL 889
           WVI   V D GPGID +LH+SVF+PFVQGDQ LSRQYGGTGLGLSIC+QL  MM GT++L
Sbjct: 809 WVISIVVEDTGPGIDSSLHESVFEPFVQGDQALSRQYGGTGLGLSICRQLATMMNGTMDL 868

Query: 890 ESELGKGSKFIYTIPLLQ 907
           +S+LG GS+F +T+PL Q
Sbjct: 869 KSKLGVGSRFTFTVPLTQ 886

 Score =  303 bits (776), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 164/384 (42%), Positives = 226/384 (58%), Gaps = 8/384 (2%)

Query: 6   WKIKLKMNKQTVKPPYRFSLRAQLTILVCXXXXXXXXXXXXXXGVYFTTHYKDLNVNRLY 65
           W  +L   K   + P R  +RAQLT LV               GVYFT +YK+L   RLY
Sbjct: 2   WMRQLMFGK--FQSPIRLGIRAQLTALVSIVALVSLIILAVSTGVYFTDNYKNLRSERLY 59

Query: 66  IASQLKSSQIDQTLNYLYYQCYWVASRNTIQTMVFSNHTGMHNASGIIESQSVLDKFVGT 125
           +A+QLKS+QIDQ LNY+YYQCYW++SR+T+Q  + +   G    +  ++S +V+ KF+ +
Sbjct: 60  MAAQLKSTQIDQNLNYMYYQCYWLSSRDTLQEALANYVAGNKTYANWVDSGNVIQKFLTS 119

Query: 126 SDLFYYTMIYDKNLKSIMNSTNNESGSNVEXXXXXXXXXXXXXXXXXXXXXXXXGILTDP 185
           S LF    IYD     ++++TNN +G+++                         GILT+P
Sbjct: 120 SGLFSVATIYDATFTPVLSATNNGTGNHIP-ESTLDRLMPLSGNKPLPSSLQSEGILTNP 178

Query: 186 ILNSTKYLMSMSLPISGPYSTATKIGNQSNIYGYLTVVMSAESLKSVFNDTAGLSDSTTA 245
           +LN T YLMSMSLPI   ++  + I   S++YGY+T+VMSA+SLK+VF+DT  L  S  A
Sbjct: 179 VLNGTSYLMSMSLPI---FANPSIILTTSHVYGYITIVMSADSLKNVFDDTTALEKSNVA 235

Query: 246 LLSAIY-TNDTLPRYFHFVFPPFDLDDSIIDERQTIKNGTFQYRAFDXXXXXXXXXXXXX 304
           +LSA+Y  N+TL  Y +FVF P  +  SI+ E   IKNGTF   A               
Sbjct: 236 ILSAVYDQNETLSSY-NFVFAPLGVPSSILAETIPIKNGTFLSSALRQGKGGALERTKFL 294

Query: 305 XXXXYAIGYAPTNFPLCKWVAVVALPDHQFYSESRKLTKIICGTVVGIAVFVFLISLPLS 364
                A+GY+P +     W+AVV   +  F   + KLTKII GTVVGI VFV L++ PL+
Sbjct: 295 YTKKVAVGYSPCSVVFVNWIAVVLQSEAVFMEPATKLTKIISGTVVGIGVFVCLVTFPLA 354

Query: 365 YWAVQPIVRLQRASELITKRRGLR 388
           +WAV+PIVRLQ+A+ELIT+ RGLR
Sbjct: 355 HWAVKPIVRLQKATELITEGRGLR 378

 Score =  163 bits (412), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 79/124 (63%), Positives = 97/124 (78%)

Query: 1016 KVLVAEDNLVNQEVIKRMLKLENISDIELAFDGIEAFEKVKKNLLSYKKYDIIFMDIQMP 1075
            K+LVAEDN VNQEVIKRML LE + +IEL  DG EA +KVK+ + + + Y++IFMD+QMP
Sbjct: 983  KILVAEDNDVNQEVIKRMLNLEGVHNIELVCDGQEALDKVKQLVENGEHYNLIFMDVQMP 1042

Query: 1076 KMDGLESTTKIRQELKYEGKIVALTAFADESNIKECRDAGMDGFIEKPIKRVALHTLLEE 1135
            KMDGL ST  IR++L Y   IVALTAFAD+SNI+EC DAGMDGF+ KPIKR  L  ++EE
Sbjct: 1043 KMDGLLSTKMIRRDLNYTHPIVALTAFADDSNIRECLDAGMDGFLAKPIKRAQLRKIIEE 1102

Query: 1136 FQQD 1139
            F  D
Sbjct: 1103 FCPD 1106

>TDEL0B02210 Chr2 complement(396111..399398) [3288 bp, 1095 aa] {ON}
           Anc_5.700 YIL147C
          Length = 1095

 Score =  322 bits (826), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 190/436 (43%), Positives = 240/436 (55%), Gaps = 23/436 (5%)

Query: 474 HVSLSEFDEIQVPVYRKLFDDELTELTDTFNVMSNALDEHYALLEKRVHQRTXXXXXXXX 533
           +++ S   E +VPVYR  F DE +ELTDTFN M+NALD+HYALLE RV  RT        
Sbjct: 448 YMTSSNLVEARVPVYRIFFSDEFSELTDTFNTMTNALDQHYALLEDRVRARTKQLEAAKV 507

Query: 534 XXXXXXXXXTVFIANISHELRTPLNGILGMTSTSLEENXXXXXXXXXXXXFRSGXXXXXX 593
                    TVFIANISHELRTPLNGILGMT+ S+EE             FRSG      
Sbjct: 508 EAEAANEAKTVFIANISHELRTPLNGILGMTAISMEERDIDKIQSSLKLIFRSGELLLHI 567

Query: 594 XXXXXXFSKNVLNKTKLEYREFNIIEITSQIKTIFNKLIQLQEVKLFIRXXXXXXXXXXX 653
                 FSKNVL +TKLE R+F+I ++  QIK+IF K+ + Q VK  I            
Sbjct: 568 LTELLTFSKNVLQRTKLEKRDFSITDVAVQIKSIFGKVAKDQRVKFSI-TLFPNQIRKMV 626

Query: 654 XYGDSNRILQVLMNLISNAIKFTPTVNGKVEVNMYLLGEYDEEESKTENYSKVCIKPSTQ 713
            YGDSNRI+Q++MNL+SNA+KFTP V+GKV V M LLGEYD++ S+ E++  V +   T+
Sbjct: 627 LYGDSNRIIQIVMNLVSNALKFTP-VDGKVSVRMRLLGEYDKQRSENEDFKAVYVIDGTE 685

Query: 714 IVTESGELIKSKIRCKIXXXXXXXXXXXXXXXXRIESNTNQYLSPYSHTNTRTHTHPGAD 773
              E G LI   ++                   +I    N+        +T        D
Sbjct: 686 -PREDG-LIPPPVK--------QFEKQEDLEKEKISEKHNE-----EEASTSDSEKTNLD 730

Query: 774 XXXXXXXXXXXXXXXXXXXXXXKMYDNLMFNRLIKRE--GDGDINDIKALEQIEGNKKWV 831
                                   YD+ +F+   K+     GD N       +E  K W 
Sbjct: 731 DKTPDSKRSDADDQVSLISISTSSYDDTIFHTQFKKHTSSSGDENG----HLLEHPKNWA 786

Query: 832 IRFEVIDNGPGIDQNLHDSVFKPFVQGDQTLSRQYGGTGLGLSICKQLCEMMKGTLELES 891
           I  EV D GPGID +LH+SVF+PFVQGDQ LSRQYGGTGLGLSIC+QL  MM GT++L+S
Sbjct: 787 ISVEVEDTGPGIDPSLHESVFEPFVQGDQALSRQYGGTGLGLSICRQLATMMNGTMKLDS 846

Query: 892 ELGKGSKFIYTIPLLQ 907
           +LG GSKF +T+PL Q
Sbjct: 847 KLGVGSKFTFTLPLTQ 862

 Score =  290 bits (742), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 157/376 (41%), Positives = 222/376 (59%), Gaps = 4/376 (1%)

Query: 14  KQTVKPPYRFSLRAQLTILVCXXXXXXXXXXXXXXGVYFTTHYKDLNVNRLYIASQLKSS 73
           K+   PP+R S+R QLT LV               GVYFT++YK L   RLY+A+QLKSS
Sbjct: 8   KEKFSPPFRISIRTQLTALVSLVALVSLIILAVTTGVYFTSNYKSLRSERLYVAAQLKSS 67

Query: 74  QIDQTLNYLYYQCYWVASRNTIQTMVFSNHTGMHNASGIIESQSVLDKFVGTSDLFYYTM 133
           QIDQ LNYLYYQCYW++S++T+QT + +  +G    +  ++S SVL KF+ +S LF    
Sbjct: 68  QIDQNLNYLYYQCYWLSSQSTLQTSLANYVSGNKTDANWVDSSSVLQKFLSSSALFSVAR 127

Query: 134 IYDKNLKSIMNSTNNESGSNVEXXXXXXXXXXXXXXXXXXXXXXXXGILTDPILNSTKYL 193
           +YD + ++++N+TNN +G +V                         G+LTDP+LN T YL
Sbjct: 128 VYDADFQTVLNATNNGTG-DVLGDDVLAKLMPLSSNMALPASLESEGMLTDPVLNGTSYL 186

Query: 194 MSMSLPISGPYSTATKIGNQSNIYGYLTVVMSAESLKSVFNDTAGLSDSTTALLSAIYTN 253
           MSMSLPI   Y+  + I  +S +YGY+T++MSA+SLKSV++D   L  S+  ++SAIY  
Sbjct: 187 MSMSLPI---YANPSIILTESRVYGYVTIIMSADSLKSVYDDRTALEKSSVTIVSAIYKK 243

Query: 254 DTLPRYFHFVFPPFDLDDSIIDERQTIKNGTFQYRAFDXXXXXXXXXXXXXXXXXYAIGY 313
           D     + FVF P+     I+DE   I N +F   A                    A+GY
Sbjct: 244 DQGLGSYRFVFAPYGTTPGILDETWPINNNSFLSAALRQGKAGSEQRTDLFYNRPSAVGY 303

Query: 314 APTNFPLCKWVAVVALPDHQFYSESRKLTKIICGTVVGIAVFVFLISLPLSYWAVQPIVR 373
           +P +F    WVA+++  +  F   S +LTKII G VVGI  FV + + PL++WAVQPIVR
Sbjct: 304 SPCSFKFVNWVAIISQSEAVFMEPSTRLTKIIIGVVVGIGAFVCIATFPLAHWAVQPIVR 363

Query: 374 LQRASELITKRRGLRN 389
           LQ+A+E+IT+ RGLR+
Sbjct: 364 LQKATEIITEGRGLRS 379

 Score =  152 bits (383), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 83/170 (48%), Positives = 112/170 (65%), Gaps = 7/170 (4%)

Query: 970  SEAENDSTVASLDKSVLQKTRMDAQKVEANEIDDIDHCNKGIPSKLKVLVAEDNLVNQEV 1029
            SE+E      SLD+  LQ T        +  +  + + NK      ++LVAEDN VNQEV
Sbjct: 925  SESEFSVGNVSLDRPFLQST---GTASSSKNVTVVSNVNKS----YRILVAEDNHVNQEV 977

Query: 1030 IKRMLKLENISDIELAFDGIEAFEKVKKNLLSYKKYDIIFMDIQMPKMDGLESTTKIRQE 1089
            IKRML LE I  I+LA DG +AF+KVK      + Y++IFMD+QMPK+DGL +T  IR++
Sbjct: 978  IKRMLTLEGIDRIDLAADGQDAFDKVKALQEKGEHYELIFMDVQMPKVDGLLATKMIRKD 1037

Query: 1090 LKYEGKIVALTAFADESNIKECRDAGMDGFIEKPIKRVALHTLLEEFQQD 1139
            L Y+  IVALTAFAD+SNI+ C +AGM+GF+ KPIKR  L T++ ++  D
Sbjct: 1038 LDYQYPIVALTAFADDSNIRVCLEAGMNGFLSKPIKRPKLKTIIAQYCHD 1087

>TBLA0I01680 Chr9 (372270..375914) [3645 bp, 1214 aa] {ON} Anc_5.700
           YIL147C
          Length = 1214

 Score =  322 bits (826), Expect = 8e-92,   Method: Compositional matrix adjust.
 Identities = 168/381 (44%), Positives = 233/381 (61%), Gaps = 7/381 (1%)

Query: 11  KMNKQTVKPPYRFSLRAQLTILVCXXXXXXXXXXXXXXGVYFTTHYKDLNVNRLYIASQL 70
           +M +  ++PP    +R QLT LVC              G+YFT +YK + V+RL IA++L
Sbjct: 5   RMFRSILRPPLAIGIRTQLTALVCFVACVSLIILAVPTGIYFTVNYKHMRVDRLSIAAEL 64

Query: 71  KSSQIDQTLNYLYYQCYWVASRNTIQTMVFSNHTGMHNASGIIESQSVLDKFVGTSDLFY 130
           KSSQ+DQTLN+LYYQCYW++ R+T+QT + +   G  ++S   +SQ V++KF+ +SD+F 
Sbjct: 65  KSSQVDQTLNFLYYQCYWLSIRDTLQTAMANYFAGNKSSSVWYDSQVVVEKFLSSSDIFS 124

Query: 131 YTMIYDKNLKSIMNSTNNESGSNVEXXXXXXXXXXXXXXXXXXXXXXXXGILTDPILNST 190
            + +YD N   +MN+TNN +G NV                         G+LTDP+LNST
Sbjct: 125 ISRLYDANFNLVMNATNNGTG-NVVPNDVLAKLLPLSSSDPLPASLGSSGMLTDPVLNST 183

Query: 191 KYLMSMSLPISGPYSTATKIGNQSNIYGYLTVVMSAESLKSVFNDTAGLSDSTTALLSAI 250
            YLMSMSLPI    +  + I   S +YGY+T++MSAESL SV+NDT  L  S  A++S  
Sbjct: 184 TYLMSMSLPI---LANPSIILTDSKVYGYITIIMSAESLMSVYNDTTALEKSNVAIVSGE 240

Query: 251 YTN--DTLPRYFHFVFPPFDLDDSIIDERQTIKNGTFQYRAFDXXXXXXXXXXXXXXXXX 308
           Y++   +L  Y HFVFPP+     IID    ++NG+F Y A +                 
Sbjct: 241 YSDYSASLTEY-HFVFPPYGATPKIIDIYYPLQNGSFLYDAMNNQKKGSIMKTKFFYNND 299

Query: 309 YAIGYAPTNFPLCKWVAVVALPDHQFYSESRKLTKIICGTVVGIAVFVFLISLPLSYWAV 368
            AIGY+P +F L  WVA+V+ P+  F S S KLT+II GTVV IAVFV  ++ PLS+WAV
Sbjct: 300 VAIGYSPCSFDLVSWVAIVSQPESVFLSPSTKLTRIIAGTVVAIAVFVCFVTFPLSHWAV 359

Query: 369 QPIVRLQRASELITKRRGLRN 389
           +PIVRLQ+A+ELI + RGLR+
Sbjct: 360 KPIVRLQKATELIAEGRGLRS 380

 Score =  318 bits (815), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 195/447 (43%), Positives = 245/447 (54%), Gaps = 41/447 (9%)

Query: 477 LSEFDEIQVPVYRKLFDDELTELTDTFNVMSNALDEHYALLEKRVHQRTXXXXXXXXXXX 536
           +S   E +VPVYR+LF DEL+ELTDTFN MS+ALD+HYALLE+RV  RT           
Sbjct: 471 MSTILETKVPVYRRLFLDELSELTDTFNTMSDALDQHYALLEERVRARTKQLEAAKIEAE 530

Query: 537 XXXXXXTVFIANISHELRTPLNGILGMTSTSLEENXXXXXXXXXXXXFRSGXXXXXXXXX 596
                 TVFIANISHELRTPLNGILGMT+ S+EE+            FRSG         
Sbjct: 531 AANEAKTVFIANISHELRTPLNGILGMTAISMEEDDIDNIKSSLKLIFRSGELLLHILTE 590

Query: 597 XXXFSKNVLNKTKLEYREFNIIEITSQIKTIFNKLIQLQEVKLFIRXXXXXXXXXXXXYG 656
              FSKNVL +TKLE R+F I ++  QIK+IF K+ + Q VKL I             +G
Sbjct: 591 LLTFSKNVLQRTKLEERDFCITDVALQIKSIFGKVAKDQHVKLSI-YLIPNEIRTLVLWG 649

Query: 657 DSNRILQVLMNLISNAIKFTPTVNGKVEVNMYLLGEYDEEESKT---------------E 701
           DSNRI+Q++MNL+SNA+KFTP ++GKV V M LLGEYD+E+SK                E
Sbjct: 650 DSNRIIQIVMNLVSNALKFTP-IDGKVSVRMSLLGEYDKEKSKAADYKEVFVKTGTEPEE 708

Query: 702 NYSKVCIKPSTQIVTESGELIKSKIRCKIXXXXXXXXXXXXXXXXRIESNTNQYLSPYSH 761
           NYSK+  K +T+ +  +    +S   C                      ++N       H
Sbjct: 709 NYSKILQKLNTEKLIAT----RSARSCDNEERHNELIGEKNDIISNNHQSSNTTFDISIH 764

Query: 762 TNTRTHTHPGADXXXXXXXXXXXXXXXXXXXXXXKMYDNLMFNRLIKR-EGDGDINDIKA 820
             TR  T                             YD  +FN   K+  G  D ++ + 
Sbjct: 765 NRTRDDTL-------------------SLLSTSTSSYDETVFNDQFKKITGLQDHDEERL 805

Query: 821 LEQIEGNKKWVIRFEVIDNGPGIDQNLHDSVFKPFVQGDQTLSRQYGGTGLGLSICKQLC 880
             +I+  K WVI  EV D GPGI   L +SVF+PFVQGDQ LSRQYGGTGLGLSIC+QL 
Sbjct: 806 GVEIKEPKTWVICIEVEDTGPGIHPALQESVFEPFVQGDQALSRQYGGTGLGLSICRQLA 865

Query: 881 EMMKGTLELESELGKGSKFIYTIPLLQ 907
            MM GT+ LES++G GSKF +T+PL Q
Sbjct: 866 TMMNGTMVLESKVGSGSKFTFTVPLTQ 892

 Score =  161 bits (408), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 84/124 (67%), Positives = 97/124 (78%), Gaps = 5/124 (4%)

Query: 1018 LVAEDNLVNQEVIKRMLKLENISDIELAFDGIEAFEKVKK--NLLSYKK---YDIIFMDI 1072
            LV EDN VNQEVIKRMLKLE +S+I+LA DG EA+ KVK+  ++ + KK   YD+IFMD+
Sbjct: 1073 LVTEDNHVNQEVIKRMLKLEKLSNIDLACDGEEAYTKVKEITSISNPKKKNYYDLIFMDV 1132

Query: 1073 QMPKMDGLESTTKIRQELKYEGKIVALTAFADESNIKECRDAGMDGFIEKPIKRVALHTL 1132
            QMP+MDGLEST  IR ELKY   IVALTAFADESNIKEC D GMDGF+ KPIKR  L  +
Sbjct: 1133 QMPRMDGLESTKLIRSELKYTKPIVALTAFADESNIKECLDVGMDGFLSKPIKRPKLKDI 1192

Query: 1133 LEEF 1136
            L EF
Sbjct: 1193 LNEF 1196

>Smik_9.22 Chr9 complement(47449..51141) [3693 bp, 1230 aa] {ON}
           YIL147C (REAL)
          Length = 1230

 Score =  321 bits (823), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 188/428 (43%), Positives = 240/428 (56%), Gaps = 8/428 (1%)

Query: 482 EIQVPVYRKLFDDELTELTDTFNVMSNALDEHYALLEKRVHQRTXXXXXXXXXXXXXXXX 541
           E ++P YR+LF DEL++LT+TFN M++ALD+HYALLE RV  RT                
Sbjct: 507 EARLPDYRRLFSDELSDLTETFNTMTDALDQHYALLEDRVRARTKQLEAAKIEAEAANEA 566

Query: 542 XTVFIANISHELRTPLNGILGMTSTSLEENXXXXXXXXXXXXFRSGXXXXXXXXXXXXFS 601
            TVFIANISHELRTPLNGILGMT+ S+EE             FRSG            FS
Sbjct: 567 KTVFIANISHELRTPLNGILGMTAISMEETDVNKIRNSLKLIFRSGELLLHILTELLTFS 626

Query: 602 KNVLNKTKLEYREFNIIEITSQIKTIFNKLIQLQEVKLFIRXXXXXXXXXXXXYGDSNRI 661
           KNVL +TKLE R+F I ++  QIK+IF K+ + Q V+L I             +GDSNRI
Sbjct: 627 KNVLQRTKLEKRDFCITDVALQIKSIFGKVAKDQRVRLSI-SLFPNLIRTMVLWGDSNRI 685

Query: 662 LQVLMNLISNAIKFTPTVNGKVEVNMYLLGEYDEEESKTENYSKVCIKPSTQIVTESGEL 721
           +Q++MNL+SNA+KFTP V+G V+V M LLGEYD++ S+ + + +V +K  T+I   S E 
Sbjct: 686 IQIVMNLVSNALKFTP-VDGTVDVRMKLLGEYDKDLSEKKQFKEVHVKRGTEITEYSEET 744

Query: 722 IKSKIRCKIXXXXXXXXXX-XXXXXXRIESNTNQYLSPYSHTNTRTHTHPGADXXXXXXX 780
            K    C I                  I SN +  +     T   T  +           
Sbjct: 745 NK----CDIPISSNHRKHVDLESTTTSITSNRDTSIIQEEITKRNTAANENIYKRMNDAE 800

Query: 781 XXXXXXXXXXXXXXXKMYDNLMFNRLIKREGDGDINDIKAL-EQIEGNKKWVIRFEVIDN 839
                            YD+ +FN    +    D ++   L + IE  K WVI  EV D 
Sbjct: 801 KLSSDDVSSIVSTTTSSYDDAIFNSQFNKAPGSDEDEGGNLGKPIENPKTWVISIEVEDT 860

Query: 840 GPGIDQNLHDSVFKPFVQGDQTLSRQYGGTGLGLSICKQLCEMMKGTLELESELGKGSKF 899
           GPGID +L +SVF PFVQGDQTLSRQYGGTGLGLSIC+QL  MM GT+ LES++G GSKF
Sbjct: 861 GPGIDPSLQESVFHPFVQGDQTLSRQYGGTGLGLSICRQLANMMNGTMRLESKVGVGSKF 920

Query: 900 IYTIPLLQ 907
            +T+PL Q
Sbjct: 921 TFTLPLPQ 928

 Score =  308 bits (789), Expect = 7e-87,   Method: Compositional matrix adjust.
 Identities = 172/388 (44%), Positives = 234/388 (60%), Gaps = 12/388 (3%)

Query: 1   MRLPSWKIKLKMNKQTVKPPYRFSLRAQLTILVCXXXXXXXXXXXXXXGVYFTTHYKDLN 60
           +RLPS        K    PP+R  +RAQLT LV               GVYFT++YK+L 
Sbjct: 3   LRLPS--------KSEFTPPFRIGIRAQLTALVSIVALVSLIILAVTTGVYFTSNYKNLR 54

Query: 61  VNRLYIASQLKSSQIDQTLNYLYYQCYWVASRNTIQTMVFSNHTGMHNASGIIESQSVLD 120
            +RLYIA+QLKSSQIDQTLNYLYYQ Y++ASR+ +Q+ + S   G  +A   ++S SV+ 
Sbjct: 55  SDRLYIAAQLKSSQIDQTLNYLYYQAYYLASRDALQSSLTSFVAGNKSADNWVDSLSVVQ 114

Query: 121 KFVGTSDLFYYTMIYDKNLKSIMNSTNNESGSNVEXXXXXXXXXXXXXXXXXXXXXXXXG 180
           KF+ +S+LFY   +YD +  +++N+TNN +G  +                         G
Sbjct: 115 KFLSSSNLFYVAKVYDSSFTTVLNATNNGTGDLIP-EDVLDSLFPLSTDTPLPSSLETTG 173

Query: 181 ILTDPILNSTKYLMSMSLPISGPYSTATKIGNQSNIYGYLTVVMSAESLKSVFNDTAGLS 240
           ILTDP++N+T YLMSMSLPI   ++  + I   S +YGY+T++MSAE LKSVFNDT  L 
Sbjct: 174 ILTDPVVNNTDYLMSMSLPI---FANPSIILTDSRVYGYITIIMSAEGLKSVFNDTTALE 230

Query: 241 DSTTALLSAIYTNDTLPRYFHFVFPPFDLDDSIIDERQTIKNGTFQYRAFDXXXXXXXXX 300
            S  A++SA+Y N      +HF+FPP+    ++     +IKN TF   AF          
Sbjct: 231 KSNVAIISALYNNQGKASGYHFIFPPYGTASTLTQSVFSIKNNTFISSAFRNGKGGSLKQ 290

Query: 301 XXXXXXXXYAIGYAPTNFPLCKWVAVVALPDHQFYSESRKLTKIICGTVVGIAVFVFLIS 360
                    A+GY+P +F L  WVAVV+ P+  F S + KL KII GTV+ I VFV L++
Sbjct: 291 TNSFGIKNLALGYSPCSFQLVNWVAVVSQPESVFLSPATKLAKIITGTVIAIGVFVILLT 350

Query: 361 LPLSYWAVQPIVRLQRASELITKRRGLR 388
           LPL++WAVQPIVRLQ+A+ELIT+ RGLR
Sbjct: 351 LPLAHWAVQPIVRLQKATELITEGRGLR 378

 Score =  163 bits (413), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 87/156 (55%), Positives = 106/156 (67%), Gaps = 4/156 (2%)

Query: 981  LDKSVLQKTRMDAQKVEANEIDDIDHCNKGIPSKLKVLVAEDNLVNQEVIKRMLKLENIS 1040
            LD+  LQ T           I D D  +  I    K+LV EDN VNQEVIKRML LE I 
Sbjct: 1059 LDRPFLQSTGTATSSRNVPTIQDNDKNDTSI----KILVVEDNHVNQEVIKRMLNLEGIE 1114

Query: 1041 DIELAFDGIEAFEKVKKNLLSYKKYDIIFMDIQMPKMDGLESTTKIRQELKYEGKIVALT 1100
            +IELA DG EAF+KVK+       Y++IFMD+QMPK+DGL ST  IR++L Y+  IVALT
Sbjct: 1115 NIELACDGQEAFDKVKELTSKGGNYNMIFMDVQMPKVDGLLSTKMIRRDLGYKSPIVALT 1174

Query: 1101 AFADESNIKECRDAGMDGFIEKPIKRVALHTLLEEF 1136
            AFAD+SNIKEC ++GM+GF+ KPIKR  L T+L EF
Sbjct: 1175 AFADDSNIKECLESGMNGFLSKPIKRPKLKTILTEF 1210

>CAGL0H06567g Chr8 (645707..649216) [3510 bp, 1169 aa] {ON} similar
           to uniprot|P39928 Saccharomyces cerevisiae YIL147c SLN1
          Length = 1169

 Score =  320 bits (821), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 169/375 (45%), Positives = 227/375 (60%), Gaps = 4/375 (1%)

Query: 14  KQTVKPPYRFSLRAQLTILVCXXXXXXXXXXXXXXGVYFTTHYKDLNVNRLYIASQLKSS 73
           ++ +KPP+R  +RAQLT LV               GVYFT++YK+L  +RLYIA+QLKSS
Sbjct: 11  RRFLKPPFRIGIRAQLTALVSIVACLSLIILAVTTGVYFTSNYKNLRSDRLYIAAQLKSS 70

Query: 74  QIDQTLNYLYYQCYWVASRNTIQTMVFSNHTGMHNASGIIESQSVLDKFVGTSDLFYYTM 133
           Q+DQ LNYLYYQCYW+ASR+T+Q  + S   G        ES +V+ KF+ +S+LF+ + 
Sbjct: 71  QLDQNLNYLYYQCYWLASRDTLQNALASYVAGNKTEENWEESTNVIQKFLSSSNLFFLSR 130

Query: 134 IYDKNLKSIMNSTNNESGSNVEXXXXXXXXXXXXXXXXXXXXXXXXGILTDPILNSTKYL 193
           +YD + K ++N+TNN +G  V                         G+LTDP+LN T YL
Sbjct: 131 VYDYDFKPVLNTTNNGTGDEVP-ESIQNQLFPLSTDVPLPSSLMTNGMLTDPVLNGTDYL 189

Query: 194 MSMSLPISGPYSTATKIGNQSNIYGYLTVVMSAESLKSVFNDTAGLSDSTTALLSAIYTN 253
           MSMSLPI   ++  + I +   +YGY+TVVMSAE L+SVFNDT  L  S  A++SA Y+N
Sbjct: 190 MSMSLPI---FANPSIIFSDLKVYGYITVVMSAEGLRSVFNDTTALEKSNVAIVSARYSN 246

Query: 254 DTLPRYFHFVFPPFDLDDSIIDERQTIKNGTFQYRAFDXXXXXXXXXXXXXXXXXYAIGY 313
            T    + FVFPP+ +  SI++    + + +F   AF                   AIGY
Sbjct: 247 YTKIDSYRFVFPPYGVSPSILNRTFELDDSSFLNGAFKQAKGGSIKKTKFFYTKDVAIGY 306

Query: 314 APTNFPLCKWVAVVALPDHQFYSESRKLTKIICGTVVGIAVFVFLISLPLSYWAVQPIVR 373
            P +F    WVAVV+  +  F S S KLTKII GTVVGIAVFV L++ PL+ WAV+PIVR
Sbjct: 307 YPCSFNFVNWVAVVSQAESVFLSPSTKLTKIISGTVVGIAVFVSLLTFPLASWAVKPIVR 366

Query: 374 LQRASELITKRRGLR 388
           LQ+A+ELI + RGLR
Sbjct: 367 LQKATELIAEGRGLR 381

 Score =  211 bits (538), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 111/229 (48%), Positives = 144/229 (62%), Gaps = 2/229 (0%)

Query: 478 SEFDEIQVPVYRKLFDDELTELTDTFNVMSNALDEHYALLEKRVHQRTXXXXXXXXXXXX 537
           +  +E ++P YR+LF DEL++LT+TFN M++ALD+HYALLE RV  RT            
Sbjct: 466 TNLNEARLPDYRRLFSDELSDLTNTFNAMTDALDQHYALLEDRVRARTKQLEAAKIQAEA 525

Query: 538 XXXXXTVFIANISHELRTPLNGILGMTSTSLEENXXXXXXXXXXXXFRSGXXXXXXXXXX 597
                TVFIANISHELRTPLNGILGMT+ S+EE             FRSG          
Sbjct: 526 ANEAKTVFIANISHELRTPLNGILGMTAISMEETDIAKIRNSLKLIFRSGELLLHILTEL 585

Query: 598 XXFSKNVLNKTKLEYREFNIIEITSQIKTIFNKLIQLQEVKLFIRXXXXXXXXXXXXYGD 657
             FSKNVL +T LE R F I ++  QIK+IF K+ + Q V+L I             +GD
Sbjct: 586 LTFSKNVLKRTALEKRNFCITDVALQIKSIFGKVAKDQHVRLSI-SLTPNVIRTMVLWGD 644

Query: 658 SNRILQVLMNLISNAIKFTPTVNGKVEVNMYLLGEYDEEESKTENYSKV 706
           SNRI+Q++MNL+SNA+KFTP V+GKV V + LLGEYDEE +K +N+ ++
Sbjct: 645 SNRIIQIVMNLVSNALKFTP-VDGKVNVRIKLLGEYDEEATKADNFKQI 692

 Score =  163 bits (412), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 79/123 (64%), Positives = 99/123 (80%)

Query: 1014 KLKVLVAEDNLVNQEVIKRMLKLENISDIELAFDGIEAFEKVKKNLLSYKKYDIIFMDIQ 1073
            + K+LVAEDN VNQEVIKRML LE I++I+LA DG +AF+KV+  +     YD+IFMDIQ
Sbjct: 1019 RFKILVAEDNHVNQEVIKRMLNLEGINNIDLACDGQDAFDKVQSLVEQNDSYDMIFMDIQ 1078

Query: 1074 MPKMDGLESTTKIRQELKYEGKIVALTAFADESNIKECRDAGMDGFIEKPIKRVALHTLL 1133
            MPK+DGL ST  IR++L Y+G IVALTAFAD+SNIKEC +AGM+GF+ KPIKR  L  +L
Sbjct: 1079 MPKVDGLLSTKMIRRDLNYKGSIVALTAFADDSNIKECIEAGMNGFLSKPIKRPKLKMIL 1138

Query: 1134 EEF 1136
            EE+
Sbjct: 1139 EEY 1141

 Score =  140 bits (352), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 68/112 (60%), Positives = 80/112 (71%), Gaps = 3/112 (2%)

Query: 798 YDNLMFNRLIKREGD--GDINDIKALEQIEGNKKWVIRFEVIDNGPGIDQNLHDSVFKPF 855
           YDN +FN   K+  D   D ND    E +   K WV   EV D GPGID  LH+SVF+PF
Sbjct: 769 YDNALFNTQFKKTPDLYEDSNDGLGTE-LADQKTWVFAIEVEDTGPGIDPKLHESVFEPF 827

Query: 856 VQGDQTLSRQYGGTGLGLSICKQLCEMMKGTLELESELGKGSKFIYTIPLLQ 907
           VQGDQTLSRQYGGTGLGLSIC+QL  MM GT++LES++G GSKF +T+PL Q
Sbjct: 828 VQGDQTLSRQYGGTGLGLSICRQLATMMHGTMKLESKVGVGSKFTFTVPLKQ 879

>NDAI0F00310 Chr6 complement(66930..70709) [3780 bp, 1259 aa] {ON}
           Anc_5.700 YIL147C
          Length = 1259

 Score =  314 bits (805), Expect = 7e-89,   Method: Compositional matrix adjust.
 Identities = 165/377 (43%), Positives = 224/377 (59%), Gaps = 4/377 (1%)

Query: 13  NKQTVKPPYRFSLRAQLTILVCXXXXXXXXXXXXXXGVYFTTHYKDLNVNRLYIASQLKS 72
           +K  +KPP+R  +RAQLT LV               GVYFT +YK+L  +RLYIA+QLKS
Sbjct: 5   DKFVLKPPFRIGIRAQLTALVSIVACVSLMILAITTGVYFTANYKNLRSDRLYIAAQLKS 64

Query: 73  SQIDQTLNYLYYQCYWVASRNTIQTMVFSNHTGMHNASGIIESQSVLDKFVGTSDLFYYT 132
           SQIDQTLNYLYYQCY+V+SR+T+Q  + +   G  +     +S S+L KF+ +S+LF   
Sbjct: 65  SQIDQTLNYLYYQCYYVSSRDTLQYALTNYVAGNKSNENWADSASILQKFLSSSNLFSVA 124

Query: 133 MIYDKNLKSIMNSTNNESGSNVEXXXXXXXXXXXXXXXXXXXXXXXXGILTDPILNSTKY 192
            +YD +  +++N TNN +G  +                         GILTDP+LNS+ Y
Sbjct: 125 KVYDASFTTVLNVTNNGTGDQIP-DSILAKLLPLSTNIPLSSSLETTGILTDPVLNSSTY 183

Query: 193 LMSMSLPISGPYSTATKIGNQSNIYGYLTVVMSAESLKSVFNDTAGLSDSTTALLSAIYT 252
           LMSMSLPI   ++  + I  +S +YGYLTVVMSAE L++VFNDT  L  S  A++SA+Y 
Sbjct: 184 LMSMSLPI---FANPSVILAESRVYGYLTVVMSAEGLRTVFNDTTALEKSNVAIVSAVYN 240

Query: 253 NDTLPRYFHFVFPPFDLDDSIIDERQTIKNGTFQYRAFDXXXXXXXXXXXXXXXXXYAIG 312
           N +    + FVF P      II+    + NG+F   A                    AIG
Sbjct: 241 NVSALTAYRFVFAPMGAPSYIINSTYRLTNGSFLSSALREGKGGSLKSTKFFYSKNVAIG 300

Query: 313 YAPTNFPLCKWVAVVALPDHQFYSESRKLTKIICGTVVGIAVFVFLISLPLSYWAVQPIV 372
           Y+P  F    WVAVV+  +  F S S KL KII GTVV I VFVF+++ PL++WAV+PIV
Sbjct: 301 YSPCTFSFVNWVAVVSQAESVFLSPSTKLAKIIAGTVVAIGVFVFIMTFPLAHWAVKPIV 360

Query: 373 RLQRASELITKRRGLRN 389
           RLQ+A+ELI++ RGL++
Sbjct: 361 RLQKATELISEGRGLKS 377

 Score =  218 bits (554), Expect = 5e-57,   Method: Compositional matrix adjust.
 Identities = 125/273 (45%), Positives = 159/273 (58%), Gaps = 15/273 (5%)

Query: 465 LRRNVSVSTHVSLSEFD-------------EIQVPVYRKLFDDELTELTDTFNVMSNALD 511
           LRR+ SV      +EF              E +VP YR+LF DEL++LTDTFN M++ALD
Sbjct: 498 LRRSSSVGVFSDHTEFSTKSGHLTTSANLIEARVPDYRRLFSDELSDLTDTFNTMTDALD 557

Query: 512 EHYALLEKRVHQRTXXXXXXXXXXXXXXXXXTVFIANISHELRTPLNGILGMTSTSLEEN 571
           +HYALLE RV  RT                 TVFIANISHELRTPLNGILGMT+ S+EE 
Sbjct: 558 QHYALLEDRVRARTKQLEAAKIEAERANEAKTVFIANISHELRTPLNGILGMTAISMEET 617

Query: 572 XXXXXXXXXXXXFRSGXXXXXXXXXXXXFSKNVLNKTKLEYREFNIIEITSQIKTIFNKL 631
                       FRSG            FSKNVL +T LE R+F I ++  QIK+IF K+
Sbjct: 618 DISKIRSSLKLIFRSGELLLHILTELLTFSKNVLKRTTLEKRDFCITDVALQIKSIFGKV 677

Query: 632 IQLQEVKLFIRXXXXXXXXXXXXYGDSNRILQVLMNLISNAIKFTPTVNGKVEVNMYLLG 691
            + Q VKL I             YGDSNRI+Q++MNL+SNA+KFTP V+GKV V + L+G
Sbjct: 678 AKDQRVKLSI-TLTPNTIRTMVLYGDSNRIIQIVMNLVSNALKFTP-VDGKVNVKVKLIG 735

Query: 692 EYDEEESKTENYSKVCIKPSTQIVTESGELIKS 724
           EYDE  S   N+ +V +K  T+++  S  + K+
Sbjct: 736 EYDEALSAKNNFKEVYVKQGTELLGCSNPIEKT 768

 Score =  159 bits (403), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 85/159 (53%), Positives = 112/159 (70%), Gaps = 5/159 (3%)

Query: 980  SLDKSVLQKTRMDAQKVEANEIDDIDHCNKG-IPSK-LKVLVAEDNLVNQEVIKRMLKLE 1037
            SLD+  LQ T        +  +  +   NK   P++ +K+LVAEDN VNQEVIKRML LE
Sbjct: 1095 SLDRPFLQST---GTATSSRNVPVLSESNKDEDPAQNIKILVAEDNHVNQEVIKRMLNLE 1151

Query: 1038 NISDIELAFDGIEAFEKVKKNLLSYKKYDIIFMDIQMPKMDGLESTTKIRQELKYEGKIV 1097
             ++ I+LA DG EAF+KVK        Y+IIFMD+QMPK+DGL ST  IR++L Y+  IV
Sbjct: 1152 GVNKIDLACDGQEAFDKVKTLSEQNDSYNIIFMDVQMPKVDGLLSTKMIRKDLHYDHPIV 1211

Query: 1098 ALTAFADESNIKECRDAGMDGFIEKPIKRVALHTLLEEF 1136
            ALTAFAD+SNIKEC ++GM+GF+ KPIKR  L T+++E+
Sbjct: 1212 ALTAFADDSNIKECLESGMNGFLSKPIKRPKLRTIIKEY 1250

 Score =  137 bits (345), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 66/114 (57%), Positives = 81/114 (71%), Gaps = 6/114 (5%)

Query: 798 YDNLMFNRLIKRE----GDGDINDIKALEQIEGNKKWVIRFEVIDNGPGIDQNLHDSVFK 853
           YD+ +FN   K+      D + ND   L  IE  K WVI+  V D GPGID+ L +SVF+
Sbjct: 849 YDDAIFNSQFKKSPGLYDDDENNDAGVL--IEDPKTWVIQISVEDTGPGIDKTLQESVFQ 906

Query: 854 PFVQGDQTLSRQYGGTGLGLSICKQLCEMMKGTLELESELGKGSKFIYTIPLLQ 907
           PFVQGDQTLSRQYGGTGLGLSIC+QL  MM GT++L+SE+G GS F +T+PL Q
Sbjct: 907 PFVQGDQTLSRQYGGTGLGLSICRQLANMMHGTMKLKSEVGVGSTFTFTVPLKQ 960

>Suva_9.41 Chr9 complement(64510..68166) [3657 bp, 1219 aa] {ON}
           YIL147C (REAL)
          Length = 1219

 Score =  310 bits (795), Expect = 8e-88,   Method: Compositional matrix adjust.
 Identities = 175/388 (45%), Positives = 232/388 (59%), Gaps = 12/388 (3%)

Query: 1   MRLPSWKIKLKMNKQTVKPPYRFSLRAQLTILVCXXXXXXXXXXXXXXGVYFTTHYKDLN 60
            RLPS        +    PP+R S+RAQLT LV               GVYFT++YK+L 
Sbjct: 3   FRLPS--------RSVFTPPFRISIRAQLTALVSIVALISLVILAVTTGVYFTSNYKNLR 54

Query: 61  VNRLYIASQLKSSQIDQTLNYLYYQCYWVASRNTIQTMVFSNHTGMHNASGIIESQSVLD 120
            +RLYIA+QLKSSQIDQTLNYLYYQ Y++ASR+ +Q  +     G  ++   ++S S++ 
Sbjct: 55  SDRLYIAAQLKSSQIDQTLNYLYYQAYYLASRDALQNSLTGYVAGNKSSDNWVDSVSIVQ 114

Query: 121 KFVGTSDLFYYTMIYDKNLKSIMNSTNNESGSNVEXXXXXXXXXXXXXXXXXXXXXXXXG 180
           KF+ +S+LF+   +YD +  +++N+TNN +G  +                         G
Sbjct: 115 KFLSSSNLFFVAKVYDSSFTTVLNATNNGTGDLIP-KDISDELFPLSTDMALPSSLETTG 173

Query: 181 ILTDPILNSTKYLMSMSLPISGPYSTATKIGNQSNIYGYLTVVMSAESLKSVFNDTAGLS 240
           ILTDPILNST YLMSMSLPI   ++  + I   S +YGY+T++MSAE LKSVFNDT  L 
Sbjct: 174 ILTDPILNSTDYLMSMSLPI---FANPSIILTDSRVYGYITIIMSAEGLKSVFNDTTALE 230

Query: 241 DSTTALLSAIYTNDTLPRYFHFVFPPFDLDDSIIDERQTIKNGTFQYRAFDXXXXXXXXX 300
            S  A++SA+Y N +    +HFVFPP+    SI      IKN TF   AF          
Sbjct: 231 KSNVAIISAVYNNQSKAYAYHFVFPPYGTSSSITKTIFPIKNNTFISSAFKNGKGGSLKK 290

Query: 301 XXXXXXXXYAIGYAPTNFPLCKWVAVVALPDHQFYSESRKLTKIICGTVVGIAVFVFLIS 360
                    A+GY+P +F L  WVAVV+ P+  F S S KL KII GTV+ I VFV L++
Sbjct: 291 TNSFGIKNLALGYSPCSFQLVNWVAVVSQPESVFLSPSTKLAKIITGTVIAIGVFVILLT 350

Query: 361 LPLSYWAVQPIVRLQRASELITKRRGLR 388
           LPL++WAVQPIVRLQ+A+ELIT+ RGLR
Sbjct: 351 LPLAHWAVQPIVRLQKATELITEGRGLR 378

 Score =  216 bits (550), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 118/249 (47%), Positives = 155/249 (62%), Gaps = 16/249 (6%)

Query: 482 EIQVPVYRKLFDDELTELTDTFNVMSNALDEHYALLEKRVHQRTXXXXXXXXXXXXXXXX 541
           E ++P YR+LF DEL++LT+TFN M++ALD+HYALLE RV  RT                
Sbjct: 507 EARLPDYRRLFSDELSDLTETFNTMTDALDQHYALLEDRVRARTKQLEAAKIEAEAANEA 566

Query: 542 XTVFIANISHELRTPLNGILGMTSTSLEENXXXXXXXXXXXXFRSGXXXXXXXXXXXXFS 601
            TVFIANISHELRTPLNGILGMT+ S+EE             FRSG            FS
Sbjct: 567 KTVFIANISHELRTPLNGILGMTAISMEETDVNKIRNSLKLIFRSGELLLHILTELLTFS 626

Query: 602 KNVLNKTKLEYREFNIIEITSQIKTIFNKLIQLQEVKL-------FIRXXXXXXXXXXXX 654
           KNVL +TKLE R+F I ++  QIK+IF K+ + Q V+L       FIR            
Sbjct: 627 KNVLQRTKLEKRDFCITDVALQIKSIFGKVAKDQRVRLSISLFPNFIR--------TMVL 678

Query: 655 YGDSNRILQVLMNLISNAIKFTPTVNGKVEVNMYLLGEYDEEESKTENYSKVCIKPSTQI 714
           +GDSNRI+Q++MNL+SNA+KFTP V+G VEV M LLGEYD+E S+ + + +V ++  T+I
Sbjct: 679 WGDSNRIIQIVMNLVSNALKFTP-VDGTVEVRMKLLGEYDKELSEKKQFKEVHVRKGTEI 737

Query: 715 VTESGELIK 723
           + + G + K
Sbjct: 738 IEDIGNINK 746

 Score =  159 bits (403), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 84/156 (53%), Positives = 107/156 (68%), Gaps = 4/156 (2%)

Query: 981  LDKSVLQKTRMDAQKVEANEIDDIDHCNKGIPSKLKVLVAEDNLVNQEVIKRMLKLENIS 1040
            LD+  LQ T           + + D  +    S +K+LV EDN VNQEVIKRML LE I 
Sbjct: 1059 LDRPFLQSTGTATSNRNIPTVSNSDKSD----SSIKILVVEDNHVNQEVIKRMLNLEGIE 1114

Query: 1041 DIELAFDGIEAFEKVKKNLLSYKKYDIIFMDIQMPKMDGLESTTKIRQELKYEGKIVALT 1100
            +IELA DG +AF+KVK+     + Y++IFMD+QMPK+DGL ST  IR++L Y   IVALT
Sbjct: 1115 NIELACDGQDAFDKVKELTSRGESYNMIFMDVQMPKVDGLLSTKMIRRDLGYTSPIVALT 1174

Query: 1101 AFADESNIKECRDAGMDGFIEKPIKRVALHTLLEEF 1136
            AFAD+SNIKEC ++GM+GF+ KPIKR  L T+L EF
Sbjct: 1175 AFADDSNIKECLESGMNGFLSKPIKRPKLKTILIEF 1210

 Score =  134 bits (336), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 64/111 (57%), Positives = 79/111 (71%), Gaps = 1/111 (0%)

Query: 798 YDNLMFNRLIKREGDGDINDIKAL-EQIEGNKKWVIRFEVIDNGPGIDQNLHDSVFKPFV 856
           YD+ +FN    +    D ++   L + IE  K W I  EV D GPGID +L +SVF PFV
Sbjct: 818 YDDAIFNSQFNKALGSDDDEGGDLGKPIENPKTWAISIEVEDTGPGIDPSLQESVFHPFV 877

Query: 857 QGDQTLSRQYGGTGLGLSICKQLCEMMKGTLELESELGKGSKFIYTIPLLQ 907
           QGDQTLSRQYGGTGLGLSIC+QL  MM GT++LES++G GSKF +T+PL Q
Sbjct: 878 QGDQTLSRQYGGTGLGLSICRQLANMMHGTMKLESKVGVGSKFTFTLPLHQ 928

>YIL147C Chr9 complement(69791..73453) [3663 bp, 1220 aa] {ON}
           SLN1Histidine kinase osmosensor that regulates a MAP
           kinase cascade; transmembrane protein with an
           intracellular kinase domain that signals to Ypd1p and
           Ssk1p, thereby forming a phosphorelay system similar to
           bacterial two-component regulators
          Length = 1220

 Score =  305 bits (780), Expect = 9e-86,   Method: Compositional matrix adjust.
 Identities = 169/376 (44%), Positives = 231/376 (61%), Gaps = 4/376 (1%)

Query: 13  NKQTVKPPYRFSLRAQLTILVCXXXXXXXXXXXXXXGVYFTTHYKDLNVNRLYIASQLKS 72
           +K  + PP+R  +R QLT LV               GVYFT++YK+L  +RLYIA+QLKS
Sbjct: 7   SKLELTPPFRIGIRTQLTALVSIVALGSLIILAVTTGVYFTSNYKNLRSDRLYIAAQLKS 66

Query: 73  SQIDQTLNYLYYQCYWVASRNTIQTMVFSNHTGMHNASGIIESQSVLDKFVGTSDLFYYT 132
           SQIDQTLNYLYYQ Y++ASR+ +Q+ + S   G  +A   ++S SV+ KF+ +S+LFY  
Sbjct: 67  SQIDQTLNYLYYQAYYLASRDALQSSLTSYVAGNKSADNWVDSLSVIQKFLSSSNLFYVA 126

Query: 133 MIYDKNLKSIMNSTNNESGSNVEXXXXXXXXXXXXXXXXXXXXXXXXGILTDPILNSTKY 192
            +YD +  +++N+TNN +G  +                         GILTDP+LNST Y
Sbjct: 127 KVYDSSFNAVLNATNNGTGDLIP-EDVLDSLFPLSTDTPLPSSLETIGILTDPVLNSTDY 185

Query: 193 LMSMSLPISGPYSTATKIGNQSNIYGYLTVVMSAESLKSVFNDTAGLSDSTTALLSAIYT 252
           LMSMSLPI   ++  + I   S +YGY+T++MSAE LKSVFNDT  L  ST A++SA+Y 
Sbjct: 186 LMSMSLPI---FANPSIILTDSRVYGYITIIMSAEGLKSVFNDTTALEHSTIAIISAVYN 242

Query: 253 NDTLPRYFHFVFPPFDLDDSIIDERQTIKNGTFQYRAFDXXXXXXXXXXXXXXXXXYAIG 312
           +      +HFVFPP+     +  +  +IKN TF   AF                   A+G
Sbjct: 243 SQGKASGYHFVFPPYGSRSDLPQKVFSIKNDTFISSAFRNGKGGSLKQTNILSTRNTALG 302

Query: 313 YAPTNFPLCKWVAVVALPDHQFYSESRKLTKIICGTVVGIAVFVFLISLPLSYWAVQPIV 372
           Y+P +F L  WVA+V+ P+  F S + KL KII GTV+ I VFV L++LPL++WAVQPIV
Sbjct: 303 YSPCSFNLVNWVAIVSQPESVFLSPATKLAKIITGTVIAIGVFVILLTLPLAHWAVQPIV 362

Query: 373 RLQRASELITKRRGLR 388
           RLQ+A+ELIT+ RGLR
Sbjct: 363 RLQKATELITEGRGLR 378

 Score =  214 bits (545), Expect = 6e-56,   Method: Compositional matrix adjust.
 Identities = 115/233 (49%), Positives = 149/233 (63%), Gaps = 2/233 (0%)

Query: 482 EIQVPVYRKLFDDELTELTDTFNVMSNALDEHYALLEKRVHQRTXXXXXXXXXXXXXXXX 541
           E ++P YR+LF DEL++LT+TFN M++ALD+HYALLE+RV  RT                
Sbjct: 507 EARLPDYRRLFSDELSDLTETFNTMTDALDQHYALLEERVRARTKQLEAAKIEAEAANEA 566

Query: 542 XTVFIANISHELRTPLNGILGMTSTSLEENXXXXXXXXXXXXFRSGXXXXXXXXXXXXFS 601
            TVFIANISHELRTPLNGILGMT+ S+EE             FRSG            FS
Sbjct: 567 KTVFIANISHELRTPLNGILGMTAISMEETDVNKIRNSLKLIFRSGELLLHILTELLTFS 626

Query: 602 KNVLNKTKLEYREFNIIEITSQIKTIFNKLIQLQEVKLFIRXXXXXXXXXXXXYGDSNRI 661
           KNVL +TKLE R+F I ++  QIK+IF K+ + Q V+L I             +GDSNRI
Sbjct: 627 KNVLQRTKLEKRDFCITDVALQIKSIFGKVAKDQRVRLSI-SLFPNLIRTMVLWGDSNRI 685

Query: 662 LQVLMNLISNAIKFTPTVNGKVEVNMYLLGEYDEEESKTENYSKVCIKPSTQI 714
           +Q++MNL+SNA+KFTP V+G V+V M LLGEYD+E S+ + Y +V IK  T++
Sbjct: 686 IQIVMNLVSNALKFTP-VDGTVDVRMKLLGEYDKELSEKKQYKEVYIKKGTEV 737

 Score =  161 bits (407), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 85/156 (54%), Positives = 105/156 (67%), Gaps = 4/156 (2%)

Query: 981  LDKSVLQKTRMDAQKVEANEIDDIDHCNKGIPSKLKVLVAEDNLVNQEVIKRMLKLENIS 1040
            LD+  LQ T           + D D     +    K+LV EDN VNQEVIKRML LE I 
Sbjct: 1058 LDRPFLQSTGTATSSRNIPTVKDDDKNETSV----KILVVEDNHVNQEVIKRMLNLEGIE 1113

Query: 1041 DIELAFDGIEAFEKVKKNLLSYKKYDIIFMDIQMPKMDGLESTTKIRQELKYEGKIVALT 1100
            +IELA DG EAF+KVK+     + Y++IFMD+QMPK+DGL ST  IR++L Y   IVALT
Sbjct: 1114 NIELACDGQEAFDKVKELTSKGENYNMIFMDVQMPKVDGLLSTKMIRRDLGYTSPIVALT 1173

Query: 1101 AFADESNIKECRDAGMDGFIEKPIKRVALHTLLEEF 1136
            AFAD+SNIKEC ++GM+GF+ KPIKR  L T+L EF
Sbjct: 1174 AFADDSNIKECLESGMNGFLSKPIKRPKLKTILTEF 1209

 Score =  137 bits (346), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 67/111 (60%), Positives = 78/111 (70%), Gaps = 1/111 (0%)

Query: 798 YDNLMFN-RLIKREGDGDINDIKALEQIEGNKKWVIRFEVIDNGPGIDQNLHDSVFKPFV 856
           YDN +FN +  K  G  D         IE  K WVI  EV D GPGID +L +SVF PFV
Sbjct: 818 YDNAIFNSQFNKAPGSDDEEGGNLGRPIENPKTWVISIEVEDTGPGIDPSLQESVFHPFV 877

Query: 857 QGDQTLSRQYGGTGLGLSICKQLCEMMKGTLELESELGKGSKFIYTIPLLQ 907
           QGDQTLSRQYGGTGLGLSIC+QL  MM GT++LES++G GSKF +T+PL Q
Sbjct: 878 QGDQTLSRQYGGTGLGLSICRQLANMMHGTMKLESKVGVGSKFTFTLPLNQ 928

>NCAS0G00250 Chr7 complement(40367..43918) [3552 bp, 1183 aa] {ON}
           Anc_5.700 YIL147C
          Length = 1183

 Score =  303 bits (777), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 156/383 (40%), Positives = 226/383 (59%), Gaps = 5/383 (1%)

Query: 8   IKLKMNKQTV-KPPYRFSLRAQLTILVCXXXXXXXXXXXXXXGVYFTTHYKDLNVNRLYI 66
           +K+ ++K  V KPP+R  +R QLT+LV               GVYFT++YK+L  +RLYI
Sbjct: 1   MKVNLSKWYVLKPPFRLGIRTQLTVLVSVVALCSLVILAITTGVYFTSNYKNLRSDRLYI 60

Query: 67  ASQLKSSQIDQTLNYLYYQCYWVASRNTIQTMVFSNHTGMHNASGIIESQSVLDKFVGTS 126
           A+QLKSSQIDQ LNYLYYQ YW++SR+T+Q  + +   G   A    +S+ V+ KF+ ++
Sbjct: 61  AAQLKSSQIDQNLNYLYYQSYWLSSRDTLQIGLTNYVAGNKTAENWADSEQVIQKFLTSN 120

Query: 127 DLFYYTMIYDKNLKSIMNSTNNESGSNVEXXXXXXXXXXXXXXXXXXXXXXXXGILTDPI 186
           +LF    +YD +  +++ +TNN +G  +                         GILTDP+
Sbjct: 121 NLFSNAQLYDSSFNAVLTATNNGTGDLIP-ESVLKKLYPLATNQPLSSSLETIGILTDPV 179

Query: 187 LNSTKYLMSMSLPISGPYSTATKIGNQSNIYGYLTVVMSAESLKSVFNDTAGLSDSTTAL 246
           LN + Y+MSMSLPI   ++  + I   S +YGY+T+VMSAE LK+VFNDT  L  S  A+
Sbjct: 180 LNGSTYIMSMSLPI---FANPSIILTDSKVYGYITIVMSAEGLKTVFNDTTALEQSNVAI 236

Query: 247 LSAIYTNDTLPRYFHFVFPPFDLDDSIIDERQTIKNGTFQYRAFDXXXXXXXXXXXXXXX 306
           +S +Y N++    +HFVF P+     +I+    I N +F   A                 
Sbjct: 237 VSGVYNNESTLNAYHFVFAPYGAPSYVINSTFRIMNNSFLNTALREGKGGSVKKTKFFYT 296

Query: 307 XXYAIGYAPTNFPLCKWVAVVALPDHQFYSESRKLTKIICGTVVGIAVFVFLISLPLSYW 366
              A+GY+P  F    W+A+V+  +  F S S KL KII GTVV I VFVFLI+ PL++W
Sbjct: 297 KNIAVGYSPCTFSFVNWIAIVSQDESVFLSPSTKLAKIISGTVVAIGVFVFLITFPLAHW 356

Query: 367 AVQPIVRLQRASELITKRRGLRN 389
           AV+PIVRLQ+A+EL+++ RGL++
Sbjct: 357 AVKPIVRLQKATELMSEGRGLKS 379

 Score =  216 bits (550), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 115/241 (47%), Positives = 148/241 (61%), Gaps = 2/241 (0%)

Query: 482 EIQVPVYRKLFDDELTELTDTFNVMSNALDEHYALLEKRVHQRTXXXXXXXXXXXXXXXX 541
           E +VP YR+LF DEL++LTDTFN M++ALD+HYALLE RV  RT                
Sbjct: 488 EARVPDYRRLFSDELSDLTDTFNAMTDALDQHYALLEDRVRARTKQLEAAKIEAETANEA 547

Query: 542 XTVFIANISHELRTPLNGILGMTSTSLEENXXXXXXXXXXXXFRSGXXXXXXXXXXXXFS 601
            T+FIANISHELRTPLNGILGMT+ S+EE             FRSG            FS
Sbjct: 548 KTIFIANISHELRTPLNGILGMTAISMEETDIAKIRSSLKLIFRSGELLLHILTELLTFS 607

Query: 602 KNVLNKTKLEYREFNIIEITSQIKTIFNKLIQLQEVKLFIRXXXXXXXXXXXXYGDSNRI 661
           KNVL +T LE R+F I ++  QIK+IF K+ + Q V+L I             +GDSNRI
Sbjct: 608 KNVLKRTTLEKRDFCITDVALQIKSIFGKVAKDQRVRLSI-VLLPNIIRTMILFGDSNRI 666

Query: 662 LQVLMNLISNAIKFTPTVNGKVEVNMYLLGEYDEEESKTENYSKVCIKPSTQIVTESGEL 721
           +Q++MNL+SNA+KFTP V+GKV V + L+GEYDE  S+  N+ KV +K  T+ +    + 
Sbjct: 667 IQIVMNLVSNALKFTP-VDGKVNVRIKLMGEYDENLSRESNFKKVLVKSGTEFIETKAKA 725

Query: 722 I 722
           I
Sbjct: 726 I 726

 Score =  159 bits (401), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 77/123 (62%), Positives = 96/123 (78%)

Query: 1014 KLKVLVAEDNLVNQEVIKRMLKLENISDIELAFDGIEAFEKVKKNLLSYKKYDIIFMDIQ 1073
            K K+LVAEDN VNQEVIKRML LE + +IELA DG +AF +VK  +   + +D+IFMD+Q
Sbjct: 1044 KFKILVAEDNHVNQEVIKRMLNLEGVENIELARDGQDAFNEVKAMVEQGEHFDMIFMDVQ 1103

Query: 1074 MPKMDGLESTTKIRQELKYEGKIVALTAFADESNIKECRDAGMDGFIEKPIKRVALHTLL 1133
            MPK+DGL ST  IR +L Y   IVALTAFAD+SNIKEC +AGM+GF+ KPIKR  + T+L
Sbjct: 1104 MPKVDGLLSTKMIRNDLHYTYPIVALTAFADDSNIKECLEAGMNGFLSKPIKRPKVKTIL 1163

Query: 1134 EEF 1136
            EE+
Sbjct: 1164 EEY 1166

 Score =  134 bits (337), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 64/116 (55%), Positives = 81/116 (69%), Gaps = 11/116 (9%)

Query: 798 YDNLMFNRLIKR------EGDGDINDIKALEQIEGNKKWVIRFEVIDNGPGIDQNLHDSV 851
           YD+ +FN   K+      + DG++       ++   K WVI  EV D GPGID +L  SV
Sbjct: 804 YDDAVFNNQFKKTPELYEDEDGNLGI-----ELTNPKTWVIAIEVQDTGPGIDPSLQKSV 858

Query: 852 FKPFVQGDQTLSRQYGGTGLGLSICKQLCEMMKGTLELESELGKGSKFIYTIPLLQ 907
           F+PFVQGDQTLSRQYGGTGLGLSIC+QL  MM GT+EL+SE+G GS F +T+PL+Q
Sbjct: 859 FEPFVQGDQTLSRQYGGTGLGLSICRQLANMMNGTMELKSEVGVGSTFTFTVPLMQ 914

>Kpol_1043.68 s1043 (141962..145090) [3129 bp, 1042 aa] {ON}
           (141962..145090) [3129 nt, 1043 aa]
          Length = 1042

 Score =  295 bits (756), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 157/370 (42%), Positives = 210/370 (56%), Gaps = 6/370 (1%)

Query: 18  KPPYRFSLRAQLTILVCXXXXXXXXXXXXXXGVYFTTHYKDLNVNRLYIASQLKSSQIDQ 77
           K PY+  LR QLT LVC              GVYFT +Y+DL + +LYIA++LKSSQIDQ
Sbjct: 11  KAPYKVKLRTQLTTLVCFVAIISLLILAISTGVYFTKNYRDLRLQQLYIAARLKSSQIDQ 70

Query: 78  TLNYLYYQCYWVASRNTIQTMVFSNHTGMHNASGIIESQSVLDKFVGTSDLFYYTMIYDK 137
           T+N LYYQC W+  R+ I++ +     G  +A     +  VL  F+ +S +F  T +YD 
Sbjct: 71  TINLLYYQCVWLTRRDEIESALTDYTAGNRSAENWASTSDVLSTFLESSVVFLTTTLYDS 130

Query: 138 NLKSIMNSTNNESGSNVEXXXXXXXXXXXXXXXXXXXXXXXXGILTDPILNSTKYLMSMS 197
               I+N TNNE+   +                         G+LTDP+LN + YLMSMS
Sbjct: 131 QFNLILNETNNETNDYIP-DDVLSHLLPLSGTDSLPSYLGTTGLLTDPVLNDSTYLMSMS 189

Query: 198 LP-ISGPYSTATKIGNQSNIYGYLTVVMSAESLKSVFNDTAGLSDSTTALLSAIYTNDTL 256
           LP I+ P  T +     S ++GYLTVVMSAE++++V NDT  L  S  A++S+  TN T 
Sbjct: 190 LPIIANPSVTLS----DSRVFGYLTVVMSAETIRAVVNDTTALEKSIVAVISSTNTNGTS 245

Query: 257 PRYFHFVFPPFDLDDSIIDERQTIKNGTFQYRAFDXXXXXXXXXXXXXXXXXYAIGYAPT 316
            + +HFVFPP    D I++    ++N TF   AF                   AIGY P 
Sbjct: 246 GQEYHFVFPPHGASDDIVNTAYPVENSTFLSDAFSSPEGGSINKSKSLYSKAVAIGYWPC 305

Query: 317 NFPLCKWVAVVALPDHQFYSESRKLTKIICGTVVGIAVFVFLISLPLSYWAVQPIVRLQR 376
           +F L  WV  V+ P+H F S S KLTKII GTV+ I VFV +I+ PLS W+VQPIVRLQ+
Sbjct: 306 SFGLANWVGTVSQPEHVFMSSSIKLTKIIAGTVIAITVFVCVITFPLSRWSVQPIVRLQK 365

Query: 377 ASELITKRRG 386
           A+E+I+KR G
Sbjct: 366 ATEVISKRDG 375

 Score =  197 bits (501), Expect = 8e-51,   Method: Compositional matrix adjust.
 Identities = 110/242 (45%), Positives = 146/242 (60%), Gaps = 5/242 (2%)

Query: 482 EIQVPVYRKLFDDELTELTDTFNVMSNALDEHYALLEKRVHQRTXXXXXXXXXXXXXXXX 541
           + QVP  R+   DEL+ELT+T+ +M++ALDEH  LLE RV +RT                
Sbjct: 453 DFQVPASRRFVKDELSELTETYKLMTDALDEHSQLLEYRVKERTKQLEAAKIEAESANEA 512

Query: 542 XTVFIANISHELRTPLNGILGMTSTSLEENXXXXXXXXXXXXFRSGXXXXXXXXXXXXFS 601
            TVFIAN++HELRTPLNGILGMT+ ++EE             +RSG            FS
Sbjct: 513 KTVFIANVTHELRTPLNGILGMTAIAMEETDMERIQSSLKLIYRSGELLLHILTELLTFS 572

Query: 602 KNVLNKTKLEYREFNIIEITSQIKTIFNKLIQLQEVKLFIRXXXXXXXXXXXXYGDSNRI 661
           KNVL +TKLE   F +I++  QI++IF K+ + Q VKL I             +GD NRI
Sbjct: 573 KNVLKQTKLEKTHFCVIDLALQIESIFGKISKDQHVKLSI-FILPNKLRSMVLWGDQNRI 631

Query: 662 LQVLMNLISNAIKFTPTVNGKVEVNMYLLGEYDEEESKTENYSKVCIKPSTQIVTESGEL 721
           LQV+MNL+SNA+KFTP V+GK+ VN+ LLGEYD++ S  ENY  V +K   +I   +G+ 
Sbjct: 632 LQVIMNLVSNALKFTP-VDGKITVNIKLLGEYDKDRSAAENYKDVYMK---EIRNSNGDK 687

Query: 722 IK 723
           IK
Sbjct: 688 IK 689

 Score =  140 bits (352), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 69/122 (56%), Positives = 88/122 (72%)

Query: 1015 LKVLVAEDNLVNQEVIKRMLKLENISDIELAFDGIEAFEKVKKNLLSYKKYDIIFMDIQM 1074
             K+L+ EDN VNQ V+ RMLKLE I +  +A DG EA EK+K+     + Y ++ MDIQM
Sbjct: 917  FKLLIVEDNKVNQLVVIRMLKLEGIENFTIACDGQEAVEKIKEIQSRGEYYGLVLMDIQM 976

Query: 1075 PKMDGLESTTKIRQELKYEGKIVALTAFADESNIKECRDAGMDGFIEKPIKRVALHTLLE 1134
            PK+DG+ +T  IRQELKY+  IVALTAFAD+SNI+ C  +GMDGF+ KPIKR  L  +L 
Sbjct: 977  PKVDGITATKIIRQELKYDKPIVALTAFADDSNIQACYKSGMDGFLAKPIKREQLKGILT 1036

Query: 1135 EF 1136
            EF
Sbjct: 1037 EF 1038

 Score =  134 bits (336), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 71/84 (84%)

Query: 824 IEGNKKWVIRFEVIDNGPGIDQNLHDSVFKPFVQGDQTLSRQYGGTGLGLSICKQLCEMM 883
           ++  +KWVI  EV D GPGI+ +L  SVF+PFVQGDQTLSRQYGGTGLGLSIC+QL  +M
Sbjct: 746 LDKKRKWVISVEVEDTGPGIEPSLQKSVFEPFVQGDQTLSRQYGGTGLGLSICRQLANLM 805

Query: 884 KGTLELESELGKGSKFIYTIPLLQ 907
            GT++LESE+G GSKFI+T+PLLQ
Sbjct: 806 HGTMKLESEVGVGSKFIFTVPLLQ 829

>Skud_9.21 Chr9 complement(46872..50537) [3666 bp, 1221 aa] {ON}
           YIL147C (REAL)
          Length = 1221

 Score =  296 bits (759), Expect = 6e-83,   Method: Compositional matrix adjust.
 Identities = 167/370 (45%), Positives = 224/370 (60%), Gaps = 4/370 (1%)

Query: 19  PPYRFSLRAQLTILVCXXXXXXXXXXXXXXGVYFTTHYKDLNVNRLYIASQLKSSQIDQT 78
           PP+R  +RAQLT LV               GVYFT++YK+L  +RLYIA+QLKSSQ+DQT
Sbjct: 13  PPFRIGIRAQLTALVSIVALVSLTILAVTTGVYFTSNYKNLRSDRLYIAAQLKSSQVDQT 72

Query: 79  LNYLYYQCYWVASRNTIQTMVFSNHTGMHNASGIIESQSVLDKFVGTSDLFYYTMIYDKN 138
           LNYLYYQ Y++ASR+ +Q+ + S   G  +    ++S SV+ KF+ +S+LFY   +YD +
Sbjct: 73  LNYLYYQAYYLASRDALQSSLTSYVAGNKSEDNWVDSLSVVQKFLSSSNLFYVARVYDSS 132

Query: 139 LKSIMNSTNNESGSNVEXXXXXXXXXXXXXXXXXXXXXXXXGILTDPILNSTKYLMSMSL 198
             +++N+TNN +G  +                         GILTDPI+N+T YLMSMSL
Sbjct: 133 FTTVLNATNNGTGDLIP-EDVLDNLFPLSTDIPLPSSLETTGILTDPIVNNTDYLMSMSL 191

Query: 199 PISGPYSTATKIGNQSNIYGYLTVVMSAESLKSVFNDTAGLSDSTTALLSAIYTNDTLPR 258
           PI   ++  + I   S +YGY+T+VMSAE LKSVFNDT  L  S  A++SA Y       
Sbjct: 192 PI---FANPSIILTDSRVYGYITIVMSAEGLKSVFNDTTALEKSNVAIISATYNAQGRAS 248

Query: 259 YFHFVFPPFDLDDSIIDERQTIKNGTFQYRAFDXXXXXXXXXXXXXXXXXYAIGYAPTNF 318
            +HFVFPP+    SI      I+N TF    F                   A+GY+P +F
Sbjct: 249 GYHFVFPPYGTLLSITQRIFPIENNTFISSTFRNGKGGSLKKTNNFGTKNLALGYSPCSF 308

Query: 319 PLCKWVAVVALPDHQFYSESRKLTKIICGTVVGIAVFVFLISLPLSYWAVQPIVRLQRAS 378
            L  WVAVV+ P+  F S + KLTKII GTV+ I VFV L++LPL++WAV+PIVRLQ+A+
Sbjct: 309 QLVNWVAVVSQPESVFLSPATKLTKIIAGTVIAIGVFVILLTLPLTHWAVKPIVRLQKAT 368

Query: 379 ELITKRRGLR 388
           ELIT+ RGLR
Sbjct: 369 ELITEGRGLR 378

 Score =  210 bits (534), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 118/258 (45%), Positives = 157/258 (60%), Gaps = 8/258 (3%)

Query: 463 NRLRRN----VSVSTHV--SLSEFDEIQVPVYRKLFDDELTELTDTFNVMSNALDEHYAL 516
           N LR N     S  +H+  + +   E ++P Y++LF DEL++LT+TFN M++ALD+HYAL
Sbjct: 482 NSLRNNDTDRSSSRSHILTTSANLTEARLPDYKRLFSDELSDLTETFNTMTDALDQHYAL 541

Query: 517 LEKRVHQRTXXXXXXXXXXXXXXXXXTVFIANISHELRTPLNGILGMTSTSLEENXXXXX 576
           LE RV  RT                 TVFIANISHELRTPLNGILGMT+ S+EE      
Sbjct: 542 LEDRVRARTKQLEAAKIEAEAANEAKTVFIANISHELRTPLNGILGMTAISMEETDVNKI 601

Query: 577 XXXXXXXFRSGXXXXXXXXXXXXFSKNVLNKTKLEYREFNIIEITSQIKTIFNKLIQLQE 636
                  FRSG            FSKNVL +TKLE R+F I ++  QIK+IF K+ + Q 
Sbjct: 602 RNNLKLIFRSGELLLHILTELLTFSKNVLQRTKLERRDFCITDVALQIKSIFGKVAKDQR 661

Query: 637 VKLFIRXXXXXXXXXXXXYGDSNRILQVLMNLISNAIKFTPTVNGKVEVNMYLLGEYDEE 696
           V+L I             +GDSNRI+Q++MNL+SNA+KFTP V+G V+V M LLGEYD++
Sbjct: 662 VRLSI-SLFPNLIRTMVLWGDSNRIIQIVMNLVSNALKFTP-VDGTVDVRMKLLGEYDKD 719

Query: 697 ESKTENYSKVCIKPSTQI 714
            S+   + +V +K  T+I
Sbjct: 720 SSEKRQFKEVHVKKGTEI 737

 Score =  160 bits (406), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 77/124 (62%), Positives = 99/124 (79%)

Query: 1013 SKLKVLVAEDNLVNQEVIKRMLKLENISDIELAFDGIEAFEKVKKNLLSYKKYDIIFMDI 1072
            + +K+LV EDN VNQEVI+RML LE I +IELA DG EAF+KVK+     + Y++IFMD+
Sbjct: 1087 TSIKILVVEDNHVNQEVIRRMLNLEGIDNIELACDGQEAFDKVKELTSKGENYNMIFMDV 1146

Query: 1073 QMPKMDGLESTTKIRQELKYEGKIVALTAFADESNIKECRDAGMDGFIEKPIKRVALHTL 1132
            QMPK+DGL ST  IR++L Y+  IVALTAFAD+SNIKEC ++GM+GF+ KPIKR  L+T+
Sbjct: 1147 QMPKVDGLLSTKMIRRDLGYKSPIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLNTI 1206

Query: 1133 LEEF 1136
            L EF
Sbjct: 1207 LSEF 1210

 Score =  137 bits (345), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 64/111 (57%), Positives = 82/111 (73%), Gaps = 1/111 (0%)

Query: 798 YDNLMFNRLIKREGDGDINDIKALEQ-IEGNKKWVIRFEVIDNGPGIDQNLHDSVFKPFV 856
           YD+ +FN    +  D D ++   + + IE  K WVI  EV D GPGI+ +L +SVF+PFV
Sbjct: 818 YDDAIFNSQFNKALDSDSDESGNVGRPIENPKTWVISIEVEDTGPGIEPSLQESVFQPFV 877

Query: 857 QGDQTLSRQYGGTGLGLSICKQLCEMMKGTLELESELGKGSKFIYTIPLLQ 907
           QGDQTLSRQYGGTGLGLSIC+QL  MM GT++LES++G GSKF +T+PL Q
Sbjct: 878 QGDQTLSRQYGGTGLGLSICRQLANMMHGTMKLESQVGVGSKFTFTLPLHQ 928

>KLTH0E01100g Chr5 complement(106377..109910) [3534 bp, 1177 aa]
           {ON} similar to uniprot|P39928 Saccharomyces cerevisiae
           YIL147C SLN1 Histidine kinase osmosensor that regulates
           a MAP kinase cascade; transmembrane protein with an
           intracellular kinase domain that signals to Ypd1p and
           Ssk1p, thereby forming a phosphorelay system similar to
           bacterial two-component regulators
          Length = 1177

 Score =  287 bits (734), Expect = 7e-80,   Method: Compositional matrix adjust.
 Identities = 159/376 (42%), Positives = 222/376 (59%), Gaps = 5/376 (1%)

Query: 14  KQTVKPPYRFSLRAQLTILVCXXXXXXXXXXXXXXGVYFTTHYKDLNVNRLYIASQLKSS 73
           K+ +KPP+  S+R QLT LVC              GVYFT+ +K +   RLY+ASQLK+S
Sbjct: 14  KRKLKPPFLISIRTQLTALVCLVALLSLIILAVITGVYFTSSFKSMRAERLYVASQLKAS 73

Query: 74  QIDQTLNYLYYQCYWVASRNTIQTMVFSNHTGMHNASGIIESQSVLDKFVGTSDLFYYTM 133
           QIDQ L YLYYQCY++++R+ +Q  +     G        ++ + LDKF+G+S+LF    
Sbjct: 74  QIDQNLYYLYYQCYYLSTRDVLQNALTQYLAGNTTTENWADAVTTLDKFLGSSNLFSLAR 133

Query: 134 IYDKNLKSIMNSTNNESGSNVEXXXXXXXXXXXXXXXXXXXXXXXXGILTDPILNSTKYL 193
           +YD + + ++N++NN SG N+                         G+LTDP+LN T YL
Sbjct: 134 VYDSSFQDVLNASNNASG-NLVPESVLTQLFPLSTNVSLPSSLEVKGMLTDPVLNDTGYL 192

Query: 194 MSMSLPISGPYSTATKIGNQSNIYGYLTVVMSAESLKSVFNDTAGLSDSTTALLSAIYTN 253
           MSMSLPI   ++  + I + S +YGY+TVV+SAE LK+VFNDT  L DS+  L+S +Y N
Sbjct: 193 MSMSLPI---FANPSIILSTSKVYGYITVVISAEGLKTVFNDTTALEDSSVILVSTVYDN 249

Query: 254 DTLPRYFHFVFPPFDLDDSIIDERQTIKNGTFQYRAFDXXXXXXXXXXXXXXXXXYAIGY 313
             L  Y H VFPP+ +   IID+R TI N +F   AF                   AIGY
Sbjct: 250 RELAGY-HLVFPPYGMPSDIIDKRYTIGNDSFLMDAFKQSKGGSIKSTHFLYSKAVAIGY 308

Query: 314 APTNFPLCKWVAVVALPDHQFYSESRKLTKIICGTVVGIAVFVFLISLPLSYWAVQPIVR 373
           +P +  L +WVA++  P+ +F   S +L +II GT V IAV    ++ PLS+WAVQPIVR
Sbjct: 309 SPCSSDLVQWVAIITQPESKFLYPSTRLARIIVGTCVAIAVVTCAVTFPLSHWAVQPIVR 368

Query: 374 LQRASELITKRRGLRN 389
           LQ+A+E+IT  RGLR+
Sbjct: 369 LQKATEIITAGRGLRS 384

 Score =  257 bits (657), Expect = 7e-70,   Method: Compositional matrix adjust.
 Identities = 145/339 (42%), Positives = 197/339 (58%), Gaps = 17/339 (5%)

Query: 798  YDNLMFNRLIKREGDGDINDIKALEQIEGNKKWVIRFEVIDNGPGIDQNLHDSVFKPFVQ 857
            YD+ +F+  +++   G+  D + LE     ++  I  EV D GPGI+  L +SVF+PFVQ
Sbjct: 837  YDDAIFHSRLRKGNSGENEDGRPLEH---PRRLAIAMEVQDTGPGIEPALQESVFEPFVQ 893

Query: 858  GDQTLSRQYGGTGLGLSICKQLCEMMKGTLELESELGKGSKFIYTIPLLQVGGXXXXXXX 917
            GDQTLSRQYGGTGLGLSIC+QL  MM G++ L+S++G GSKF +T+PL Q          
Sbjct: 894  GDQTLSRQYGGTGLGLSICRQLAAMMNGSMSLDSKVGVGSKFTFTVPLTQT------KEL 947

Query: 918  XXXXXXXXXXSSVDIDIIEDTPVSITSSSQTHSDLNSLQSNSTNEVGLDDSFSEAENDST 977
                         + D  ++  V    S       +   S+  N      + SE+E    
Sbjct: 948  CFEEDENPFEDEFNPDSKKNRKVKFKVSKNNKRKKSHSSSSGQNSSVGTPTVSESEVSVG 1007

Query: 978  VASLDKSVLQKTRMDAQKVEANEIDDIDHCNKGIPSKLKVLVAEDNLVNQEVIKRMLKLE 1037
               +D+  LQ T           +         + +K KVLVAEDN VNQEVIKRML LE
Sbjct: 1008 SVRVDRPFLQST--------GTALSTRSVTTTSVANKCKVLVAEDNNVNQEVIKRMLNLE 1059

Query: 1038 NISDIELAFDGIEAFEKVKKNLLSYKKYDIIFMDIQMPKMDGLESTTKIRQELKYEGKIV 1097
             + D++LA DG +AF+KVK    + K YD+IFMD+QMP++DGL +T  IR EL Y   IV
Sbjct: 1060 GLDDVDLACDGQDAFDKVKARNEAGKFYDLIFMDVQMPRVDGLSATRMIRNELSYTHPIV 1119

Query: 1098 ALTAFADESNIKECRDAGMDGFIEKPIKRVALHTLLEEF 1136
            ALTA+AD+ NIKEC DAGM+GF+ KPI+R  +  +L E+
Sbjct: 1120 ALTAYADDRNIKECIDAGMNGFLAKPIRRPKIKEILSEY 1158

 Score =  206 bits (525), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 112/256 (43%), Positives = 148/256 (57%), Gaps = 2/256 (0%)

Query: 466 RRNVSVSTHVSLSEFDEIQVPVYRKLFDDELTELTDTFNVMSNALDEHYALLEKRVHQRT 525
           +R+     +++ +   E +VP Y +LF DEL+ELT+TFN M++ LD HYALLE RV  RT
Sbjct: 470 QRSARSERYITSTNLIEARVPTYNRLFSDELSELTETFNTMTDELDRHYALLEDRVRART 529

Query: 526 XXXXXXXXXXXXXXXXXTVFIANISHELRTPLNGILGMTSTSLEENXXXXXXXXXXXXFR 585
                            TVFIANISHELRTPLNGILGMT+ ++ EN            FR
Sbjct: 530 RQLEAAKIEAEGANEAKTVFIANISHELRTPLNGILGMTAIAMAENDMQKVKSSLKLIFR 589

Query: 586 SGXXXXXXXXXXXXFSKNVLNKTKLEYREFNIIEITSQIKTIFNKLIQLQEVKLFIRXXX 645
           SG            FSKNVL +TKLE R+F + EI  Q+++IF KL + Q V L I    
Sbjct: 590 SGELLLHIMTELLTFSKNVLKRTKLEERDFTVHEIALQVESIFGKLAKDQHVNLTI-SII 648

Query: 646 XXXXXXXXXYGDSNRILQVLMNLISNAIKFTPTVNGKVEVNMYLLGEYDEEESKTENYSK 705
                    +GDSNRI+Q++MNL+SNA+KFTP V+G+V V   LLGEYDE ++    + +
Sbjct: 649 PNVLRTMVLWGDSNRIVQIVMNLVSNALKFTP-VDGRVNVKFTLLGEYDESKASNGCFDR 707

Query: 706 VCIKPSTQIVTESGEL 721
             + P  +   ES  L
Sbjct: 708 AAVVPIQESEKESSTL 723

>TPHA0D04590 Chr4 (1001887..1005270) [3384 bp, 1127 aa] {ON}
           Anc_5.700 YIL147C
          Length = 1127

 Score =  283 bits (725), Expect = 7e-79,   Method: Compositional matrix adjust.
 Identities = 164/376 (43%), Positives = 219/376 (58%), Gaps = 5/376 (1%)

Query: 14  KQTVKPPYRFSLRAQLTILVCXXXXXXXXXXXXXXGVYFTTHYKDLNVNRLYIASQLKSS 73
           K+  KPPYR S+RAQLT LV               GVYFT +YK+L   RLYIA+QLK+S
Sbjct: 6   KKFWKPPYRISIRAQLTALVSLVAIISLIILAVTAGVYFTANYKNLKTGRLYIAAQLKAS 65

Query: 74  QIDQTLNYLYYQCYWVASRNTIQTMVFSNHTGMHNASGIIESQSVLDKFVGTSDLFYYTM 133
           QIDQTLNYLYYQCY+++S  T+Q  + S   G  +++   ES  VL+KF+ +SDLF    
Sbjct: 66  QIDQTLNYLYYQCYYLSSGETLQNSLVSYSAGNISSTNWYESSLVLEKFLTSSDLFSVAR 125

Query: 134 IYDKNLKSIMNSTNNESGSNVEXXXXXXXXXXXXXXXXXXXXXXXXGILTDPILNSTKYL 193
           +YD N   ++N+TNN SG+ V                         GI TDP+LN + +L
Sbjct: 126 LYDTNFNIMINATNNASGNYVP-ESVIDKLFTLSLNISLPSSLETIGICTDPVLNGSNFL 184

Query: 194 MSMSLPISGPYSTATKIGNQSNIYGYLTVVMSAESLKSVFNDTAGLSDSTTALLSAIYTN 253
           MSMSLPI   ++  + I + S IYGYL+V+MSAE LKSVFNDT  L +S   ++SA Y+ 
Sbjct: 185 MSMSLPI---FANPSIILSDSRIYGYLSVIMSAEGLKSVFNDTTALENSEVFVISADYSI 241

Query: 254 DTLPRYFHFVFP-PFDLDDSIIDERQTIKNGTFQYRAFDXXXXXXXXXXXXXXXXXYAIG 312
            T   YF+F+F   +D  D   D    I N TF Y                      A+G
Sbjct: 242 TTNLEYFNFLFASAYDNADKDYDLHYRIDNDTFVYNGLVNGKGGAVKKTNGFLGTAAAVG 301

Query: 313 YAPTNFPLCKWVAVVALPDHQFYSESRKLTKIICGTVVGIAVFVFLISLPLSYWAVQPIV 372
           Y+  +F L  W+A+VA P+  F   + KL +II G VV +AVFV L++ PLS+WAVQP++
Sbjct: 302 YSSCSFSLVNWLAIVAQPEAAFSESATKLERIISGVVVAVAVFVCLLTFPLSHWAVQPLI 361

Query: 373 RLQRASELITKRRGLR 388
           RLQ+A+E I + RGLR
Sbjct: 362 RLQKATERIAEGRGLR 377

 Score =  225 bits (574), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 122/233 (52%), Positives = 149/233 (63%), Gaps = 2/233 (0%)

Query: 482 EIQVPVYRKLFDDELTELTDTFNVMSNALDEHYALLEKRVHQRTXXXXXXXXXXXXXXXX 541
           E +VPVY +L  DEL+ELTDTFN M++ALD+HY LLE+RV  RT                
Sbjct: 474 EARVPVYWRLLQDELSELTDTFNTMTDALDQHYCLLEERVRARTKQLEAAKIQAESANEA 533

Query: 542 XTVFIANISHELRTPLNGILGMTSTSLEENXXXXXXXXXXXXFRSGXXXXXXXXXXXXFS 601
            TVFIANISHELRTPLNGILGMT+ S+EE+            FRSG            FS
Sbjct: 534 KTVFIANISHELRTPLNGILGMTAISMEEDDVDKIRGNLKLIFRSGELLLHILTELLTFS 593

Query: 602 KNVLNKTKLEYREFNIIEITSQIKTIFNKLIQLQEVKLFIRXXXXXXXXXXXXYGDSNRI 661
           KNVL +TKLE R+F I E+  QIK+IF KL + Q VKL I             +GDSNRI
Sbjct: 594 KNVLQRTKLEKRDFCITEVALQIKSIFGKLAKDQHVKLSI-ILMPNILRSYVLWGDSNRI 652

Query: 662 LQVLMNLISNAIKFTPTVNGKVEVNMYLLGEYDEEESKTENYSKVCIKPSTQI 714
           +QV+MNL+SNA+KFTP V+G V+V + LLGEYDEE SK E+Y KV +K  T++
Sbjct: 653 IQVVMNLVSNALKFTP-VDGNVDVRINLLGEYDEERSKAEDYKKVYVKQGTEL 704

 Score =  146 bits (368), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 71/124 (57%), Positives = 92/124 (74%)

Query: 1017 VLVAEDNLVNQEVIKRMLKLENISDIELAFDGIEAFEKVKKNLLSYKKYDIIFMDIQMPK 1076
            +LVAEDN VNQEVIKRMLKLE I++I+LA DG +AF+K K    +   YDIIFMD+QMP+
Sbjct: 1003 ILVAEDNHVNQEVIKRMLKLEGINNIDLARDGQDAFDKTKMLSENNGNYDIIFMDVQMPR 1062

Query: 1077 MDGLESTTKIRQELKYEGKIVALTAFADESNIKECRDAGMDGFIEKPIKRVALHTLLEEF 1136
            +DGL +T  IR+EL Y   IVAL+AF  E N+KEC D GM+ F+ KPIKR  L  +L+++
Sbjct: 1063 LDGLAATKMIREELNYTQPIVALSAFPKEENVKECLDVGMNDFLSKPIKRPDLKIILKKY 1122

Query: 1137 QQDL 1140
             +D 
Sbjct: 1123 IEDF 1126

 Score =  134 bits (338), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 65/112 (58%), Positives = 80/112 (71%)

Query: 796 KMYDNLMFNRLIKREGDGDINDIKALEQIEGNKKWVIRFEVIDNGPGIDQNLHDSVFKPF 855
           K YD+    + + +  D D ++ K   +++  K WVI  EV D G GID  L +SVF+PF
Sbjct: 773 KSYDDTALMKQLIKSTDLDDDENKLGVELKEQKTWVISVEVKDTGSGIDPKLQESVFEPF 832

Query: 856 VQGDQTLSRQYGGTGLGLSICKQLCEMMKGTLELESELGKGSKFIYTIPLLQ 907
           VQGDQ LSRQYGGTGLGLSICKQL  MM GT+ELESE+G GSKFI+T+PL Q
Sbjct: 833 VQGDQALSRQYGGTGLGLSICKQLSTMMNGTMELESEVGVGSKFIFTLPLKQ 884

>Ecym_4020 Chr4 complement(49684..53061) [3378 bp, 1125 aa] {ON}
            similar to Ashbya gossypii AFR284W
          Length = 1125

 Score =  278 bits (711), Expect = 5e-77,   Method: Compositional matrix adjust.
 Identities = 162/344 (47%), Positives = 208/344 (60%), Gaps = 16/344 (4%)

Query: 798  YDNLMFNRLIKREG---DGDINDIKALEQIEGNKKWVIRFEVIDNGPGIDQNLHDSVFKP 854
            YD+ +F+   K+     D D  D+ ++ + E  K WVI  EV D GPGID +L +SVFKP
Sbjct: 767  YDDAIFHSRFKKIPAVLDVDEGDLSSIGKSEKKKVWVISIEVEDTGPGIDPSLQESVFKP 826

Query: 855  FVQGDQTLSRQYGGTGLGLSICKQLCEMMKGTLELESELGKGSKFIYTIPLLQVGGXXXX 914
            FVQGDQTLSRQYGGTGLGLSIC+QL  MMKGT++L SE+G GSKFI+T+PL Q G     
Sbjct: 827  FVQGDQTLSRQYGGTGLGLSICRQLSTMMKGTMKLHSEVGVGSKFIFTVPLRQTGTVEDL 886

Query: 915  XXXXXXXXXXXXXSSVD--IDIIEDTPVSITSSSQTHSDLNSLQSNSTNEVGLDDSFSEA 972
                         S ++  +    +       SS +  +++ +  +  N +G     SE+
Sbjct: 887  DDEDLFEDEFNAQSKINRRVKFKLNKGGKSRQSSLSVPEISGVPDSPLNSMGR----SES 942

Query: 973  ENDSTVASLDKSVLQKTRMDAQKVEANEIDDIDHCNKGIPSKLKVLVAEDNLVNQEVIKR 1032
            E   +   +D+  LQ T           +  ++       S  KVLVAEDN VNQEVIKR
Sbjct: 943  ELSVSSVRVDRPFLQSTGTATSTRSIPTVGSLE-------SNFKVLVAEDNNVNQEVIKR 995

Query: 1033 MLKLENISDIELAFDGIEAFEKVKKNLLSYKKYDIIFMDIQMPKMDGLESTTKIRQELKY 1092
            ML+LE I DIELA DG EA EKV      Y  Y+I+FMD+QMPKMDGL +T  IR+EL Y
Sbjct: 996  MLQLEGIYDIELACDGEEALEKVANLTNQYDHYNIVFMDVQMPKMDGLIATRNIRKELNY 1055

Query: 1093 EGKIVALTAFADESNIKECRDAGMDGFIEKPIKRVALHTLLEEF 1136
               IVALTAFAD+SNIK C ++GMDGF+ KPIKR  L  +L E+
Sbjct: 1056 TYPIVALTAFADDSNIKVCLESGMDGFLSKPIKREKLRKILLEY 1099

 Score =  251 bits (642), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 136/378 (35%), Positives = 211/378 (55%), Gaps = 5/378 (1%)

Query: 11  KMNKQTVKPPYRFSLRAQLTILVCXXXXXXXXXXXXXXGVYFTTHYKDLNVNRLYIASQL 70
           ++ K   +PPY+  L  QLTILVC              GVYFTT+YK L  +RL +A+QL
Sbjct: 17  RIRKHMFRPPYKAGLSTQLTILVCIIALCSLIILAVTTGVYFTTNYKSLRADRLTVAAQL 76

Query: 71  KSSQIDQTLNYLYYQCYWVASRNTIQTMVFSNHTGMHNASGIIESQSVLDKFVGTSDLFY 130
            S+QI+QTLN +YYQCYW++SR++IQ  + S   G  ++  +  ++ VL KF+ +S+  +
Sbjct: 77  TSAQINQTLNIIYYQCYWLSSRDSIQNALVSYKVGNTSSLNLDNAKEVLVKFLDSSNSIF 136

Query: 131 YTMIYDKNLKSIMNSTNNESGSNVEXXXXXXXXXXXXXXXXXXXXXXXXGILTDPILNST 190
            T +YD     +++ + N +G N+                         G+L++P+ N +
Sbjct: 137 RTHLYDSAFNEVLSVSTNSTG-NIIGDDLLRDLLPLSSNSPLPSSIIDDGMLSNPVFNGS 195

Query: 191 KYLMSMSLPISGPYSTATKIGNQSNIYGYLTVVMSAESLKSVFNDTAGLSDSTTALLSAI 250
            + MSMSLP+S   + A+ +  +S+  GY+T+VMSA+ + SV      L+ ST ++L+ +
Sbjct: 196 SFFMSMSLPVS---AKASILYPKSDTVGYITMVMSADQVSSVCAGKPALNGSTVSVLAGV 252

Query: 251 YTNDTLPRYFHFVFPPFDLD-DSIIDERQTIKNGTFQYRAFDXXXXXXXXXXXXXXXXXY 309
           Y  + +   +  +FPP  +    +++    I N +F Y AF                   
Sbjct: 253 YDENNILNSYQVLFPPSIVQVPRLLEIVFPIANNSFLYNAFVNRSSGSVSKTNAFYEPNV 312

Query: 310 AIGYAPTNFPLCKWVAVVALPDHQFYSESRKLTKIICGTVVGIAVFVFLISLPLSYWAVQ 369
           A+GYA  +F L  WVAVVA  +  F S S KLTKII GTV+GIA F+ +++  ++ WAV+
Sbjct: 313 AVGYAACSFKLVNWVAVVAQQEAVFLSPSTKLTKIIIGTVIGIAFFICIVTFIVANWAVK 372

Query: 370 PIVRLQRASELITKRRGL 387
           PIVRLQ+A+ELI   RGL
Sbjct: 373 PIVRLQKATELIAAGRGL 390

 Score =  217 bits (553), Expect = 5e-57,   Method: Compositional matrix adjust.
 Identities = 116/237 (48%), Positives = 149/237 (62%), Gaps = 2/237 (0%)

Query: 482 EIQVPVYRKLFDDELTELTDTFNVMSNALDEHYALLEKRVHQRTXXXXXXXXXXXXXXXX 541
           E +VPVYR+LF DEL+ELTDTFN M++ LD HYALLE RV  RT                
Sbjct: 483 ETRVPVYRRLFSDELSELTDTFNSMTDELDRHYALLEDRVRARTKQLEAAKIQAESANEA 542

Query: 542 XTVFIANISHELRTPLNGILGMTSTSLEENXXXXXXXXXXXXFRSGXXXXXXXXXXXXFS 601
            T+FIANISHELRTPLNGILGMT+ ++ EN            FRSG            FS
Sbjct: 543 KTMFIANISHELRTPLNGILGMTAIAMAENDMEKVQNSLKLIFRSGELLLHILTELLTFS 602

Query: 602 KNVLNKTKLEYREFNIIEITSQIKTIFNKLIQLQEVKLFIRXXXXXXXXXXXXYGDSNRI 661
           KN+L + KLE R F+++++  Q+K+IF KL + Q VK  I             +GDSNRI
Sbjct: 603 KNILKRNKLEQRNFSMVDVALQVKSIFGKLAKDQNVKFSI-FLMPNLIRKMVLWGDSNRI 661

Query: 662 LQVLMNLISNAIKFTPTVNGKVEVNMYLLGEYDEEESKTENYSKVCIKPSTQIVTES 718
           +Q++MNL+SNA+KFTP V+GKV + + LLGEYDEEES+  N ++V IK  T+I  E+
Sbjct: 662 IQIVMNLVSNALKFTP-VDGKVSLRIKLLGEYDEEESEKCNNAEVFIKQGTEISDET 717

>TPHA0E00250 Chr5 complement(34875..38081) [3207 bp, 1068 aa] {ON}
           Anc_5.700 YIL147C
          Length = 1068

 Score =  269 bits (688), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 148/382 (38%), Positives = 208/382 (54%), Gaps = 5/382 (1%)

Query: 8   IKLKMNKQTVKPPYRFSLRAQLTILVCXXXXXXXXXXXXXXGVYFTTHYKDLNVNRLYIA 67
           + LK  +    PPY  +LRAQL  L C              GVYFT +YK L   +L+IA
Sbjct: 1   MNLKNLRLATSPPYPMNLRAQLITLCCIVSIISLLILSISTGVYFTNNYKSLRAEQLFIA 60

Query: 68  SQLKSSQIDQTLNYLYYQCYWVASRNTIQTMVFSNHTGMHNASGIIESQSVLDKFVGTSD 127
           +QLKSSQ+DQ+LNYLYYQ  W    + +   +    +G       +ES S +  F+ +S 
Sbjct: 61  AQLKSSQLDQSLNYLYYQSIWFRDNDVLTDALIRYFSGNKTTENWVESISSVSAFLTSSS 120

Query: 128 LFYYTMIYDKNLKSIMNSTNNESGSNVEXXXXXXXXXXXXXXXXXXXXXXXXGILTDPIL 187
           +F    IYD N   I N +NN +G+++                         G LTDP+L
Sbjct: 121 IFSRATIYDTNFMEIYNVSNNGTGAHIP-DDIIRQLTPLSSDERLPASIGTIGFLTDPVL 179

Query: 188 NSTKYLMSMSLPISGPYSTATKIGNQSNIYGYLTVVMSAESLKSVFNDTAGLSDSTTALL 247
           N++ YLMS+SLPI G  S    I + S +YGY+T++  A S+ +VFNDT  L +S  A++
Sbjct: 180 NTSNYLMSLSLPIFGNPSI---ILSDSRVYGYVTIITGASSIVAVFNDTTALENSNVAII 236

Query: 248 SAIYTND-TLPRYFHFVFPPFDLDDSIIDERQTIKNGTFQYRAFDXXXXXXXXXXXXXXX 306
           SA Y N  T    +HFVFPP+  D S+ID    + N +F + AF                
Sbjct: 237 SAKYRNSTTYADGYHFVFPPYGSDASVIDIFYPLSNNSFLFDAFTEDTTGSVSSTTFFYS 296

Query: 307 XXYAIGYAPTNFPLCKWVAVVALPDHQFYSESRKLTKIICGTVVGIAVFVFLISLPLSYW 366
              A+GY+   F L  WVAVV+ P+  F S + KLTKII GTVVGIA  V  ++  +SY+
Sbjct: 297 SLVAVGYSTCTFSLANWVAVVSQPESVFTSSTVKLTKIISGTVVGIAAVVCFVTFIMSYY 356

Query: 367 AVQPIVRLQRASELITKRRGLR 388
            V+PI++L++A+ELI++ RGLR
Sbjct: 357 IVKPIIKLKQATELISRGRGLR 378

 Score =  250 bits (638), Expect = 7e-68,   Method: Compositional matrix adjust.
 Identities = 146/316 (46%), Positives = 187/316 (59%), Gaps = 36/316 (11%)

Query: 828  KKWVIRFEVIDNGPGIDQNLHDSVFKPFVQGDQTLSRQYGGTGLGLSICKQLCEMMKGTL 887
            KKWVI  +V D GPGI   L  SVF+PFVQGDQTLSRQYGGTGLGLSIC+QL  +M GT+
Sbjct: 777  KKWVISVDVEDTGPGISPTLQKSVFEPFVQGDQTLSRQYGGTGLGLSICRQLASIMHGTM 836

Query: 888  ELESELGKGSKFIYTIPLLQVGGXXXXXXXXXXXXXXXXXSSVDIDIIEDTPVSITSSSQ 947
            EL+S  G GSKF +T+PLLQ                          I  +T  +      
Sbjct: 837  ELDSTTGLGSKFTFTVPLLQERKI----------------------IFSETEKAFEDEFN 874

Query: 948  THSDLNSLQSNSTNEV---GLDDSFSEAENDSTV---ASLDKSVLQKTRMDAQKVEANEI 1001
             +S  N   +  T++V   G+    +E  +D+      +L+     KT +    +  +E 
Sbjct: 875  FNSKKNRKVNFKTDKVTSRGIPSKAAEKNDDANTNGQTTLNAEAKSKT-LKPTHITISE- 932

Query: 1002 DDIDHCNKGIPSKLKVLVAEDNLVNQEVIKRMLKLENISDIELAFDGIEAFEKVKKNLLS 1061
            D+ID  +       KVL+ EDN+VNQEVIKR+LKLE I  IE A DG EA + VKK +  
Sbjct: 933  DNIDQHD------FKVLIVEDNMVNQEVIKRLLKLEKIKTIEYAVDGQEAIDIVKKKISE 986

Query: 1062 YKKYDIIFMDIQMPKMDGLESTTKIRQELKYEGKIVALTAFADESNIKECRDAGMDGFIE 1121
              K+DIIFMDIQMP +DG  +T  IR EL Y   IVALTAFAD+SN KEC ++GM+ F+ 
Sbjct: 987  KDKFDIIFMDIQMPNVDGHTATRVIRNELNYPYPIVALTAFADDSNKKECENSGMNAFLA 1046

Query: 1122 KPIKRVALHTLLEEFQ 1137
            KPIKR  L  +++EFQ
Sbjct: 1047 KPIKRFELKEIIKEFQ 1062

 Score =  198 bits (504), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 115/248 (46%), Positives = 145/248 (58%), Gaps = 2/248 (0%)

Query: 483 IQVPVYRKLFDDELTELTDTFNVMSNALDEHYALLEKRVHQRTXXXXXXXXXXXXXXXXX 542
           ++VPV+     DELTEL +TFN+M+++LDEH  LLE+RV  RT                 
Sbjct: 468 VRVPVHSTYITDELTELKETFNIMADSLDEHSNLLEERVKARTKELEAAKIVAEATNEAK 527

Query: 543 TVFIANISHELRTPLNGILGMTSTSLEENXXXXXXXXXXXXFRSGXXXXXXXXXXXXFSK 602
           TVFIANISHELRTPLNGILGMT+ +LEE+            +RSG            FSK
Sbjct: 528 TVFIANISHELRTPLNGILGMTAIALEEDDNEKLQGSLKLIYRSGELLLHILTELLTFSK 587

Query: 603 NVLNKTKLEYREFNIIEITSQIKTIFNKLIQLQEVKLFIRXXXXXXXXXXXXYGDSNRIL 662
           NVL KTKLE   F I +I  QIK+IF K+ + Q V   I             +GDSNRI+
Sbjct: 588 NVLQKTKLEKIHFCIHDIALQIKSIFGKIAKDQGVNFSI-LISPNLIRTMVFFGDSNRII 646

Query: 663 QVLMNLISNAIKFTPTVNGKVEVNMYLLGEYDEEESKTENYSKVCIKPSTQIVTESGELI 722
           QV+MNL+SNA+KFTP ++G V+V + LLGEYDEE+S   NY KV IK  T    ++  + 
Sbjct: 647 QVIMNLVSNALKFTP-IDGNVDVRIKLLGEYDEEKSSLNNYDKVYIKEGTSFTGDNDAIP 705

Query: 723 KSKIRCKI 730
              I  KI
Sbjct: 706 TEPISDKI 713

>AFR284W Chr6 (947118..950429) [3312 bp, 1103 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YIL147C (SLN1)
          Length = 1103

 Score =  266 bits (681), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 148/322 (45%), Positives = 202/322 (62%), Gaps = 12/322 (3%)

Query: 821  LEQIEGNKKWVIRFEVIDNGPGIDQNLHDSVFKPFVQGDQTLSRQYGGTGLGLSICKQLC 880
            + ++E  + WVI  EV D GPGI+ +LH+SVFKPFVQGDQTLSRQYGGTGLGLSIC+QL 
Sbjct: 790  MSKLEKPRSWVIVIEVQDTGPGIEPSLHESVFKPFVQGDQTLSRQYGGTGLGLSICRQLA 849

Query: 881  EMMKGTLELESELGKGSKFIYTIPLLQVGGXXXXXXXXXXXXXXXXXSSVDIDIIEDTPV 940
             MMKGT++LES++G GSKF +T+PL Q G                  S  +  +     +
Sbjct: 850  TMMKGTMKLESKVGSGSKFTFTVPLQQTGTVKFNDGDTLFEDEFNIFSKKNRKV--KFQL 907

Query: 941  SITSSSQTHSDLNSLQSNSTNEVGLDDSFSEAENDSTVASL--DKSVLQKTRMDAQKVEA 998
            + +  S+     NS  + S  E  ++ SF ++E++++  S+  D+  LQ T         
Sbjct: 908  NRSGKSRKGKMNNSNGAGSIAESAIE-SFGKSESEASFGSVRVDRPFLQSTGTATSTRSV 966

Query: 999  NEIDDIDHCNKGIPSKLKVLVAEDNLVNQEVIKRMLKLENISDIELAFDGIEAFEKVKKN 1058
              +   +       S L++LVAEDN VNQEVIKRML LE   +I+LA DG +A++KV   
Sbjct: 967  PTLSSAE-------SSLRILVAEDNNVNQEVIKRMLHLEGAHNIDLACDGEDAYQKVSAL 1019

Query: 1059 LLSYKKYDIIFMDIQMPKMDGLESTTKIRQELKYEGKIVALTAFADESNIKECRDAGMDG 1118
            +   + YD+IFMD+QMP+MDGL +T  +RQ+L YE  IVALTAFAD+SNIKEC ++GM+ 
Sbjct: 1020 VEQGEHYDLIFMDVQMPRMDGLLTTKLLRQKLHYEYPIVALTAFADDSNIKECLESGMNS 1079

Query: 1119 FIEKPIKRVALHTLLEEFQQDL 1140
            F+ KPIKR  L  +L E    L
Sbjct: 1080 FLAKPIKRPMLKKILLEHTSQL 1101

 Score =  225 bits (574), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 138/397 (34%), Positives = 208/397 (52%), Gaps = 22/397 (5%)

Query: 1   MRLPSWKIKLKMNKQTVKPPYRFSLRAQLTILVCXXXXXXXXXXXXXXGVYFTTHYKDLN 60
           MRL   + +L +    +KPP++  LR QLTILVC              GVYFT++Y+ L 
Sbjct: 1   MRLGYLRKRLAV----LKPPFKAGLRTQLTILVCIIALSSLIILACTTGVYFTSNYRTLR 56

Query: 61  VNRLYIASQLKSSQIDQTLNYLYYQCYWVASRNTIQTMVFSNHTGMHNASGIIESQSVLD 120
            +RL++A++L SSQ+DQ+L  LYYQC  +++++TIQ  +     G  +A   IE+  +L 
Sbjct: 57  ADRLHVAARLMSSQVDQSLTLLYYQCNMLSTKDTIQNALSDYRAGNRSAENWIEADKILG 116

Query: 121 KFVGTSDLFYYTMIYDKNLKSIMNSTNNES-GSNVEXXXXXXXXXXXXXXXXXXXXXXXX 179
            F+  S  FY   +YD+  + +++  NN++ GS  E                        
Sbjct: 117 GFLERSKTFYIAYLYDEMYQEVLSRWNNDTEGSLAEESLVRLRPLEMDKYEYNEALDVQV 176

Query: 180 GILTDPILNSTKYLMSMSLPISGPYSTATKIGNQSNIYGYLTVVMSAESLKSVFNDTAGL 239
             L     N T  LMSM+LP+      A+ I  + N+ G+LT+VMSA+ + +V NDT+ L
Sbjct: 177 ETLP---YNKTLNLMSMTLPVE-----ASTIIGRGNVVGFLTIVMSADPITAV-NDTSVL 227

Query: 240 SDSTTALLSAIYTNDTLPRYFHFVFPPFDLDDSIIDERQTIKNGTFQYRAF--------D 291
            +S  ++L+ I  +      + FVFPP + D S+ +    IKN +F   AF         
Sbjct: 228 GESMVSILTGIPNDKGNLVKYRFVFPPGETDRSVTETEYPIKNASFLRDAFLNRSDNYVT 287

Query: 292 XXXXXXXXXXXXXXXXXYAIGYAPTNFPLCKWVAVVALPDHQFYSESRKLTKIICGTVVG 351
                             A+GY+   F    WVAVV+  +  F S + KLTKII GTV+G
Sbjct: 288 STSSFYHFGALGHDFKKVAVGYSACKFRQLDWVAVVSQDESVFLSPAFKLTKIIIGTVLG 347

Query: 352 IAVFVFLISLPLSYWAVQPIVRLQRASELITKRRGLR 388
           +AVF+ +++  L+ WAV+PIVRLQ+A+E I   RGLR
Sbjct: 348 VAVFMCIVTFILASWAVKPIVRLQKATEFIAAGRGLR 384

 Score =  213 bits (541), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 115/243 (47%), Positives = 148/243 (60%), Gaps = 2/243 (0%)

Query: 476 SLSEFDEIQVPVYRKLFDDELTELTDTFNVMSNALDEHYALLEKRVHQRTXXXXXXXXXX 535
           S + + + +VPVYR+LF DEL+ELTDTFN M++ LD  Y +LE RV  RT          
Sbjct: 472 SATNWIDTRVPVYRRLFTDELSELTDTFNTMTDELDRQYVVLEDRVRARTKQLEAAKIQA 531

Query: 536 XXXXXXXTVFIANISHELRTPLNGILGMTSTSLEENXXXXXXXXXXXXFRSGXXXXXXXX 595
                  TVFIANI HELRTPLNGILGMT+ ++ E             FRSG        
Sbjct: 532 EAANEAKTVFIANIFHELRTPLNGILGMTAIAMAEQDQEKIQNSLKLIFRSGELLLHILT 591

Query: 596 XXXXFSKNVLNKTKLEYREFNIIEITSQIKTIFNKLIQLQEVKLFIRXXXXXXXXXXXXY 655
               FSKNVL +TKLE R F+II+I  Q+K+IF KL + Q VKL I             +
Sbjct: 592 ELLTFSKNVLKRTKLEERHFSIIDIALQVKSIFGKLAKDQHVKLSI-YLMPNAIRTMVLW 650

Query: 656 GDSNRILQVLMNLISNAIKFTPTVNGKVEVNMYLLGEYDEEESKTENYSKVCIKPSTQIV 715
           GDSNRI+Q++MNL+SNA+KFTP V+GKV+V + L+GEYD   S+  N+S+V I P T++ 
Sbjct: 651 GDSNRIIQIVMNLVSNALKFTP-VDGKVDVRIKLVGEYDSARSEACNFSEVYILPGTEVT 709

Query: 716 TES 718
             S
Sbjct: 710 NSS 712

>Ecym_5077 Chr5 (166792..169179) [2388 bp, 795 aa] {ON} similar to
            Ashbya gossypii ADR343C
          Length = 795

 Score = 67.8 bits (164), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 46/151 (30%), Positives = 74/151 (49%), Gaps = 34/151 (22%)

Query: 1014 KLKVLVAEDNLVNQEVIKRMLKLENISDIELAFDGIEAFEKVKKNLLSYKKYDIIFMDIQ 1073
            K+ VL+ EDN++NQ ++   LK   IS  E+A +G EA EK ++  +      +I MD+Q
Sbjct: 548  KINVLIVEDNIINQAILVSFLKRHRIS-YEIAKNGAEAVEKWRQGGI-----HLILMDLQ 601

Query: 1074 MPKMDGLESTTKIRQELKYEG----------------------------KIVALTAFADE 1105
            +P + GLE+T +IR   K  G                             IVALTAF+  
Sbjct: 602  LPLLSGLEATKQIRDMEKLNGINKFHKSDLKPGRDTSLDLDRSKFRSPVIIVALTAFSSH 661

Query: 1106 SNIKECRDAGMDGFIEKPIKRVALHTLLEEF 1136
            ++ +E   AG + ++ KP+    L + + E+
Sbjct: 662  ADRREALVAGCNDYLTKPVNLDWLSSKITEW 692

>ADR343C Chr4 complement(1311984..1314233) [2250 bp, 749 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YLR006C
            (SSK1)
          Length = 749

 Score = 63.2 bits (152), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 40/139 (28%), Positives = 68/139 (48%), Gaps = 34/139 (24%)

Query: 1014 KLKVLVAEDNLVNQEVIKRMLKLENISDIELAFDGIEAFEKVKKNLLSYKKYDIIFMDIQ 1073
            K+ VL+ EDN++NQ ++   L+   IS  E+A +G+EA EK +K  +      +I MD+Q
Sbjct: 508  KINVLIVEDNIINQAILSSFLRKHKIS-YEIAKNGVEAVEKWRKGGI-----HLILMDLQ 561

Query: 1074 MPKMDGLESTTKIRQELKYEG----------------------------KIVALTAFADE 1105
            +P + G+++  +IR   +  G                             IVALTAF+  
Sbjct: 562  LPLLSGIDAAKQIRNLERASGICAFQKHCEARSQETYSELNRAKFRAPVIIVALTAFSSH 621

Query: 1106 SNIKECRDAGMDGFIEKPI 1124
            ++  E   AG + ++ KP+
Sbjct: 622  ADRNEALVAGCNDYLTKPV 640

>CAGL0D02882g Chr4 complement(300025..302028) [2004 bp, 667 aa] {ON}
            similar to uniprot|Q07084 Saccharomyces cerevisiae
            YLR006c SSK1 two-component signal transducer
          Length = 667

 Score = 60.8 bits (146), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 43/150 (28%), Positives = 73/150 (48%), Gaps = 33/150 (22%)

Query: 1014 KLKVLVAEDNLVNQEVIKRMLKLENISDIELAFDGIEAFEKVKKNLLSYKKYDIIFMDIQ 1073
            K+ VL+ EDN++NQ ++   L+   IS  ++A +G EA +K K+  L      +IFMD+Q
Sbjct: 462  KINVLIVEDNVINQAILGSFLRKNKIS-YKIAKNGKEAVDKWKEGNLH-----LIFMDLQ 515

Query: 1074 MPKMDGLESTTKIRQELKYEG---------------------------KIVALTAFADES 1106
            +P + G+E+  KIR+  K  G                            IVALTA   + 
Sbjct: 516  LPVLSGIEAAKKIRELEKERGIANQSERVSTPGSLSSINMNGSTNSPVIIVALTASNSQE 575

Query: 1107 NIKECRDAGMDGFIEKPIKRVALHTLLEEF 1136
            + +E   +G + ++ KP+  + L   + E+
Sbjct: 576  DKREALISGCNDYLTKPVNLLWLSKKITEW 605

>Ecym_7474 Chr7 (967242..968732) [1491 bp, 496 aa] {ON} similar to
            Ashbya gossypii ADL388W
          Length = 496

 Score = 60.1 bits (144), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 37/123 (30%), Positives = 67/123 (54%), Gaps = 7/123 (5%)

Query: 1017 VLVAEDNLVNQEVIKRMLKLENISDIELAFDGIEAFEKVKKNLLSYKKYDIIFMDIQMPK 1076
            VL+ ED+ V  ++  + L+    S +E+  DG+ A E V+K      +YD++ MDI MP 
Sbjct: 331  VLLVEDDSVCIQLCSKFLRKYGCS-VEVVTDGLSAIETVEK-----FQYDLVLMDIVMPN 384

Query: 1077 MDGLESTTKIRQELKYEGKIVALTAFADESNIKECRDAGMDGFIEKPIKRVALHTLLEEF 1136
            +DG  +T+ IR     +  I+A+T   ++ ++      GM+  + KP  +  LH++L  +
Sbjct: 385  LDGATATSVIR-SFDNQTPIIAMTGNIEDQDLVTYLQHGMNDILAKPFTKDDLHSMLIRY 443

Query: 1137 QQD 1139
             +D
Sbjct: 444  LKD 446

>ADL388W Chr4 (30355..31803) [1449 bp, 482 aa] {ON} Syntenic homolog
            of Saccharomyces cerevisiae YHR206W (SKN7) and YJR147W
            (HMS2)
          Length = 482

 Score = 60.1 bits (144), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 37/123 (30%), Positives = 67/123 (54%), Gaps = 7/123 (5%)

Query: 1017 VLVAEDNLVNQEVIKRMLKLENISDIELAFDGIEAFEKVKKNLLSYKKYDIIFMDIQMPK 1076
            VL+ ED+ V  ++  + L+    S +E+  DG+ A E V+K      +YD++ MDI MP 
Sbjct: 320  VLLVEDDSVCIQLCSKFLRKYGCS-VEVVTDGLSAIETVEK-----FQYDLVLMDIVMPN 373

Query: 1077 MDGLESTTKIRQELKYEGKIVALTAFADESNIKECRDAGMDGFIEKPIKRVALHTLLEEF 1136
            +DG  +T+ IR     +  I+A+T   ++ ++      GM+  + KP  +  LH++L  +
Sbjct: 374  LDGATATSVIR-SFDNQTPIIAMTGNIEDQDLVTYLQHGMNDILAKPFTKDDLHSMLVRY 432

Query: 1137 QQD 1139
             +D
Sbjct: 433  LKD 435

>KAFR0B06990 Chr2 (1455520..1457157) [1638 bp, 545 aa] {ON} Anc_4.385
            YJR147W
          Length = 545

 Score = 58.9 bits (141), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 34/123 (27%), Positives = 67/123 (54%), Gaps = 7/123 (5%)

Query: 1017 VLVAEDNLVNQEVIKRMLKLENISDIELAFDGIEAFEKVKKNLLSYKKYDIIFMDIQMPK 1076
            VL+ ED+ ++ ++  + L+    + +E+  DG+ A   ++K      +YD++ MDI MP 
Sbjct: 355  VLLVEDDAISIQLCSKFLRKYGCT-VEVVTDGLSAISTLEK-----FRYDLVLMDIVMPN 408

Query: 1077 MDGLESTTKIRQELKYEGKIVALTAFADESNIKECRDAGMDGFIEKPIKRVALHTLLEEF 1136
            +DG  +T+ IR     +  I+A+T   ++ ++      GM+  + KP  R  LH++L  +
Sbjct: 409  LDGATATSIIR-SFDNQTPIIAMTGNIEDQDLITYLQHGMNDILAKPFTRDDLHSMLIRY 467

Query: 1137 QQD 1139
             +D
Sbjct: 468  LKD 470

>KLLA0A10219g Chr1 (896931..898358) [1428 bp, 475 aa] {ON} similar to
            uniprot|Q75BF2 Ashbya gossypii ADL388W ADL388Wp and some
            similarites with YHR206W uniprot|P38889 Saccharomyces
            cerevisiae
          Length = 475

 Score = 58.2 bits (139), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 35/123 (28%), Positives = 67/123 (54%), Gaps = 7/123 (5%)

Query: 1017 VLVAEDNLVNQEVIKRMLKLENISDIELAFDGIEAFEKVKKNLLSYKKYDIIFMDIQMPK 1076
            VL+ ED+ V  ++  + L+    S +E+  DG+ A   ++K     +++D++ MDI MP 
Sbjct: 331  VLLVEDDSVCIQLCSKFLRKYGCS-VEVVTDGLSAISTLEK-----QRFDLVLMDIVMPN 384

Query: 1077 MDGLESTTKIRQELKYEGKIVALTAFADESNIKECRDAGMDGFIEKPIKRVALHTLLEEF 1136
            +DG  +T+ +R     E  I+A+T   D+ ++      GM+  + KP  +  LH++L  +
Sbjct: 385  LDGATATSIVR-SFDNETPIIAMTGNIDDQDLVTYLQHGMNDILAKPFTKDDLHSMLIRY 443

Query: 1137 QQD 1139
             +D
Sbjct: 444  LKD 446

>TDEL0E03980 Chr5 (741644..743836) [2193 bp, 730 aa] {ON} Anc_5.230
            YLR006C
          Length = 730

 Score = 58.2 bits (139), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 46/146 (31%), Positives = 73/146 (50%), Gaps = 29/146 (19%)

Query: 1007 CNKGIPSKLKVLVAEDNLVNQEVIKRMLKLENISDIELAFDGIEAFEKVKKNLLSYKKYD 1066
             N  I  K+ VL+ EDN++NQ +++  LK   IS  ++A +G EA ++ K+  +     D
Sbjct: 493  ANHEIFPKITVLIVEDNVINQAILRSFLKKHKIS-YKVAKNGQEAVDRWKEGGI-----D 546

Query: 1067 IIFMDIQMPKMDGLESTTKIRQELKY-----------EGK---------IVALTAFADES 1106
            +IFMD+Q+P   G+++  KIR   K            EG          IVA TA    +
Sbjct: 547  LIFMDLQLPVFSGMDAAKKIRDLEKLNASSETLPDSKEGDKKRSKAPVIIVAFTASNTRA 606

Query: 1107 NIKECRDAGMDGFIEKPIKRVALHTL 1132
            + +E   +G + ++ KP   V LH L
Sbjct: 607  DKREALLSGCNDYLTKP---VNLHWL 629

>KNAG0M00180 Chr13 complement(22500..24347) [1848 bp, 615 aa] {ON}
            Anc_4.385 YJR147W
          Length = 615

 Score = 58.2 bits (139), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 34/123 (27%), Positives = 65/123 (52%), Gaps = 7/123 (5%)

Query: 1017 VLVAEDNLVNQEVIKRMLKLENISDIELAFDGIEAFEKVKKNLLSYKKYDIIFMDIQMPK 1076
            VL+ ED+ ++ ++  + L+    + +++  DG+ A        L   +YD++ MDI MP 
Sbjct: 405  VLLVEDDAISIQLCSKFLRKYGCT-VQVVTDGLSAI-----TTLENSRYDLVLMDIVMPN 458

Query: 1077 MDGLESTTKIRQELKYEGKIVALTAFADESNIKECRDAGMDGFIEKPIKRVALHTLLEEF 1136
            +DG  +T+ IR     +  I+A+T   D+ ++      GM+  + KP  R  LH++L  +
Sbjct: 459  LDGATATSIIR-SFDNQTPIIAMTGNIDDGDLITYLQHGMNDILAKPFTRDDLHSMLIRY 517

Query: 1137 QQD 1139
             +D
Sbjct: 518  LKD 520

>Skud_8.273 Chr8 (481627..483498) [1872 bp, 623 aa] {ON} YHR206W
            (REAL)
          Length = 623

 Score = 58.2 bits (139), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 34/123 (27%), Positives = 66/123 (53%), Gaps = 7/123 (5%)

Query: 1017 VLVAEDNLVNQEVIKRMLKLENISDIELAFDGIEAFEKVKKNLLSYKKYDIIFMDIQMPK 1076
            VL+ ED++V+ ++  + L+    + +++  DG+ A   ++K      +YD++ MDI MP 
Sbjct: 381  VLLVEDDVVSIQLCSKFLRKYGCT-VQVVTDGLSAISTLEK-----FRYDLVLMDIVMPN 434

Query: 1077 MDGLESTTKIRQELKYEGKIVALTAFADESNIKECRDAGMDGFIEKPIKRVALHTLLEEF 1136
            +DG  +T+ +R     E  I+A+T      ++      GM+  + KP  R  LH++L  +
Sbjct: 435  LDGATATSIVR-SFDNETPIIAMTGNIMNQDLITYLQHGMNDILAKPFTRDDLHSILIRY 493

Query: 1137 QQD 1139
             +D
Sbjct: 494  LKD 496

>YHR206W Chr8 (512732..514600) [1869 bp, 622 aa] {ON}  SKN7Nuclear
            response regulator and transcription factor; physically
            interacts with the Tup1-Cyc8 complex and recruits Tup1p
            to its targets; part of a branched two-component
            signaling system; required for optimal induction of
            heat-shock genes in response to oxidative stress;
            involved in osmoregulation
          Length = 622

 Score = 57.4 bits (137), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 34/123 (27%), Positives = 65/123 (52%), Gaps = 7/123 (5%)

Query: 1017 VLVAEDNLVNQEVIKRMLKLENISDIELAFDGIEAFEKVKKNLLSYKKYDIIFMDIQMPK 1076
            VL+ ED+ V+ ++  + L+    + +++  DG+ A   ++K      +YD++ MDI MP 
Sbjct: 379  VLLVEDDAVSIQLCSKFLRKYGCT-VQVVSDGLSAISTLEK-----YRYDLVLMDIVMPN 432

Query: 1077 MDGLESTTKIRQELKYEGKIVALTAFADESNIKECRDAGMDGFIEKPIKRVALHTLLEEF 1136
            +DG  +T+ +R     E  I+A+T      ++      GM+  + KP  R  LH++L  +
Sbjct: 433  LDGATATSIVR-SFDNETPIIAMTGNIMNQDLITYLQHGMNDILAKPFTRDDLHSILIRY 491

Query: 1137 QQD 1139
             +D
Sbjct: 492  LKD 494

>Kwal_33.15288 s33 complement(1045147..1046910) [1764 bp, 587 aa] {ON}
            YLR006C (SSK1) - Two-component signal transducer that
            with Sln1p regulates osmosensing MAP kinase
            cascade(suppressor of sensor kinase) [contig 94] FULL
          Length = 587

 Score = 57.4 bits (137), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 40/134 (29%), Positives = 68/134 (50%), Gaps = 29/134 (21%)

Query: 1014 KLKVLVAEDNLVNQEVIKRMLKLENISDIELAFDGIEAFEKVKKNLLSYKKYDIIFMDIQ 1073
            K+ VLV EDN++NQ ++   L+   IS  ++A +GIEA ++ K+  +      +I MD++
Sbjct: 418  KISVLVVEDNMINQTILSSFLRKHKIS-YKVAKNGIEAVDRWKEGGMH-----LILMDLE 471

Query: 1074 MPKMDGLESTTKIRQELKYEG-----------------------KIVALTAFADESNIKE 1110
            MP + G+++  +IR+  K  G                        IVALTA   +S+  E
Sbjct: 472  MPLLSGIDAAKEIRRLEKLNGIGSGKPSTGEHAPAKRSTSKAPVIIVALTASNSQSDKTE 531

Query: 1111 CRDAGMDGFIEKPI 1124
               AG + ++ KP+
Sbjct: 532  ALLAGCNDYLTKPV 545

>KAFR0J00700 Chr10 (127858..129720) [1863 bp, 620 aa] {ON} Anc_5.230
            YLR006C
          Length = 620

 Score = 57.4 bits (137), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 41/124 (33%), Positives = 65/124 (52%), Gaps = 14/124 (11%)

Query: 1014 KLKVLVAEDNLVNQEVIKRMLKLENISDIELAFDGIEAFEKVKKNLLSYKKYDIIFMDIQ 1073
            K+ VL+ EDN++NQ ++   L+   IS  ++A +G EA E  K   L      +IFMD+Q
Sbjct: 474  KINVLIVEDNVINQAILGGFLRKHKIS-YKVAKNGKEAVEMWKNGGLH-----LIFMDLQ 527

Query: 1074 MPKMDGLESTTKIRQELKYEGK-----IVALTAFADESNIKECRDAGMDGFIEKPIKRVA 1128
            +P + G+++  +IR   K         IVALTA     + +    +G + ++ KP   V 
Sbjct: 528  LPVLSGIDAAKQIRDFEKERPSCAPVIIVALTASNSAEDKRNALVSGCNDYLTKP---VN 584

Query: 1129 LHTL 1132
            LH L
Sbjct: 585  LHWL 588

>SAKL0B12408g Chr2 (1065161..1066558) [1398 bp, 465 aa] {ON} similar
            to uniprot|Q75BF2 Ashbya gossypii ADL388W ADL388Wp and
            weakly similar to YHR206W uniprot|P38889 Saccharomyces
            cerevisiae
          Length = 465

 Score = 56.6 bits (135), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 34/123 (27%), Positives = 67/123 (54%), Gaps = 7/123 (5%)

Query: 1017 VLVAEDNLVNQEVIKRMLKLENISDIELAFDGIEAFEKVKKNLLSYKKYDIIFMDIQMPK 1076
            VL+ ED+ V  ++  + L L+    +E+  DG+ A   ++K      +YD++ MDI MP 
Sbjct: 309  VLLVEDDSVCIQLCSKFL-LKYGCSVEVVTDGLSAISTLEK-----FRYDLVLMDIVMPN 362

Query: 1077 MDGLESTTKIRQELKYEGKIVALTAFADESNIKECRDAGMDGFIEKPIKRVALHTLLEEF 1136
            +DG  +T+ +R     +  I+A+T   ++ ++    + GM+  + KP  +  LH++L  +
Sbjct: 363  LDGATATSIVR-SFDNQTPIIAMTGNIEDQDLVTYLEHGMNDILAKPFTKDDLHSMLIRY 421

Query: 1137 QQD 1139
             +D
Sbjct: 422  LKD 424

>KLLA0E09505g Chr5 (840647..842554) [1908 bp, 635 aa] {ON} weakly
            similar to uniprot|Q07084 Saccharomyces cerevisiae
            YLR006C SSK1 Cytoplasmic response regulator part of a
            two-component signal transducer that mediates osmosensing
            via a phosphorelay mechanism dephosphorylated form is
            degraded by the ubiquitin-proteasome system potential
            Cdc28p substrate
          Length = 635

 Score = 57.0 bits (136), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 47/75 (62%), Gaps = 6/75 (8%)

Query: 1014 KLKVLVAEDNLVNQEVIKRMLKLENISDIELAFDGIEAFEKVKKNLLSYKKYDIIFMDIQ 1073
            ++ VL+ EDN +NQ ++   L+   IS  ++A DG+EA EK K+         +I MD+Q
Sbjct: 393  RINVLIVEDNAINQAILALFLRKNGIS-YKVAKDGVEAIEKWKEG-----DSHLILMDLQ 446

Query: 1074 MPKMDGLESTTKIRQ 1088
            +P + GLE+T KIR+
Sbjct: 447  LPLLSGLEATKKIRE 461

>NCAS0A06450 Chr1 (1273459..1275288) [1830 bp, 609 aa] {ON} Anc_4.385
          Length = 609

 Score = 57.0 bits (136), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 34/123 (27%), Positives = 66/123 (53%), Gaps = 7/123 (5%)

Query: 1017 VLVAEDNLVNQEVIKRMLKLENISDIELAFDGIEAFEKVKKNLLSYKKYDIIFMDIQMPK 1076
            VL+ ED+ V+  +  + L+    + +E+  DG+ A   ++K      +YD++ MDI MP 
Sbjct: 383  VLLVEDDAVSIRLCSKFLRKYGCT-VEVVTDGLSAISTLEK-----FRYDLVLMDIVMPN 436

Query: 1077 MDGLESTTKIRQELKYEGKIVALTAFADESNIKECRDAGMDGFIEKPIKRVALHTLLEEF 1136
            +DG  +T+ IR     +  I+A+T   ++ ++      GM+  + KP  +  LH++L  +
Sbjct: 437  LDGATATSIIR-NFDNQTPIIAMTGNIEDQDLITYLQHGMNDILAKPFTKDDLHSMLIRY 495

Query: 1137 QQD 1139
             +D
Sbjct: 496  LKD 498

>Smik_8.296 Chr8 (487452..489329) [1878 bp, 625 aa] {ON} YHR206W
            (REAL)
          Length = 625

 Score = 56.6 bits (135), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 34/123 (27%), Positives = 65/123 (52%), Gaps = 7/123 (5%)

Query: 1017 VLVAEDNLVNQEVIKRMLKLENISDIELAFDGIEAFEKVKKNLLSYKKYDIIFMDIQMPK 1076
            VL+ ED+ V+ ++  + L+    + +++  DG+ A   ++K      +YD++ MDI MP 
Sbjct: 381  VLLVEDDAVSIQLCSKFLRKYGCT-VQVVTDGLSAISTLEK-----FRYDLVLMDIVMPN 434

Query: 1077 MDGLESTTKIRQELKYEGKIVALTAFADESNIKECRDAGMDGFIEKPIKRVALHTLLEEF 1136
            +DG  +T+ +R     E  I+A+T      ++      GM+  + KP  R  LH++L  +
Sbjct: 435  LDGATATSIVR-SFDNETPIIAMTGNIMNQDLITYLQHGMNDILAKPFTRDDLHSILIRY 493

Query: 1137 QQD 1139
             +D
Sbjct: 494  LKD 496

>Suva_15.412 Chr15 (719438..721291) [1854 bp, 617 aa] {ON} YHR206W
            (REAL)
          Length = 617

 Score = 56.6 bits (135), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 34/123 (27%), Positives = 65/123 (52%), Gaps = 7/123 (5%)

Query: 1017 VLVAEDNLVNQEVIKRMLKLENISDIELAFDGIEAFEKVKKNLLSYKKYDIIFMDIQMPK 1076
            VL+ ED+ V+ ++  + L+    + +++  DG+ A   ++K      +YD++ MDI MP 
Sbjct: 380  VLLVEDDAVSIQLCSKFLRKYGCT-VQVVTDGLSAISTLEK-----FRYDLVLMDIVMPN 433

Query: 1077 MDGLESTTKIRQELKYEGKIVALTAFADESNIKECRDAGMDGFIEKPIKRVALHTLLEEF 1136
            +DG  +T+ +R     E  I+A+T      ++      GM+  + KP  R  LH++L  +
Sbjct: 434  LDGATATSIVR-SFDNETPIIAMTGNIMNQDLITYLQHGMNDILAKPFTRDDLHSILIRY 492

Query: 1137 QQD 1139
             +D
Sbjct: 493  LKD 495

>CAGL0F09097g Chr6 (898706..900598) [1893 bp, 630 aa] {ON} similar to
            uniprot|P38889 Saccharomyces cerevisiae YHR206w SKN7
            transcription factor
          Length = 630

 Score = 56.6 bits (135), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 32/117 (27%), Positives = 64/117 (54%), Gaps = 7/117 (5%)

Query: 1017 VLVAEDNLVNQEVIKRMLKLENISDIELAFDGIEAFEKVKKNLLSYKKYDIIFMDIQMPK 1076
            VL+ ED+ V+ ++  + L+    + +++  DG+ A   ++K      +YD++ MDI MP 
Sbjct: 407  VLLVEDDSVSIQLCSKFLRKYGCT-VQVVTDGLSAISNLEK-----FRYDLVLMDIVMPN 460

Query: 1077 MDGLESTTKIRQELKYEGKIVALTAFADESNIKECRDAGMDGFIEKPIKRVALHTLL 1133
            +DG  +T+ +R     +  I+A+T   ++ ++      GM+  + KP  R  LH++L
Sbjct: 461  LDGATATSIVR-SFDNQTPIIAMTGNIEDQDLITYLQHGMNDILAKPFTRNDLHSIL 516

>ZYRO0G00484g Chr7 complement(35793..37736) [1944 bp, 647 aa] {ON}
            similar to uniprot|P38889 Saccharomyces cerevisiae
            YHR206W
          Length = 647

 Score = 55.8 bits (133), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 33/123 (26%), Positives = 65/123 (52%), Gaps = 7/123 (5%)

Query: 1017 VLVAEDNLVNQEVIKRMLKLENISDIELAFDGIEAFEKVKKNLLSYKKYDIIFMDIQMPK 1076
            VL+ ED+ V  ++  + L+    + +E+  DG+ A   ++K      +YD++ MDI MP 
Sbjct: 378  VLLVEDDAVCIQLCSKFLRKYGCT-VEVVTDGLAAISTLEK-----FRYDLVLMDIVMPN 431

Query: 1077 MDGLESTTKIRQELKYEGKIVALTAFADESNIKECRDAGMDGFIEKPIKRVALHTLLEEF 1136
            +DG  +T+ +R        I+A+T   ++ ++      GM+  + KP  +  LH++L  +
Sbjct: 432  LDGATATSIVR-SFDIHTPIIAMTGNIEDQDLITYLQHGMNDILAKPFTKDDLHSMLIRY 490

Query: 1137 QQD 1139
             +D
Sbjct: 491  LRD 493

>Kpol_1004.4 s1004 complement(9754..11898) [2145 bp, 714 aa] {ON}
            complement(9754..11898) [2145 nt, 715 aa]
          Length = 714

 Score = 55.1 bits (131), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 29/81 (35%), Positives = 52/81 (64%), Gaps = 6/81 (7%)

Query: 1014 KLKVLVAEDNLVNQEVIKRMLKLENISDIELAFDGIEAFEKVKKNLLSYKKYDIIFMDIQ 1073
            K+ VL+ EDN++NQ ++   L+   IS  ++A +G EA +K K+  L      +IFMD+Q
Sbjct: 510  KINVLIVEDNVINQTILASFLRKHKIS-YKVAKNGREAVDKWKEGGL-----HLIFMDLQ 563

Query: 1074 MPKMDGLESTTKIRQELKYEG 1094
            +P + G+++  +IR+  K++G
Sbjct: 564  LPVLSGIDAAKEIREYEKHKG 584

>NDAI0D03430 Chr4 (809977..811770) [1794 bp, 597 aa] {ON} Anc_4.385
          Length = 597

 Score = 54.7 bits (130), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 43/157 (27%), Positives = 78/157 (49%), Gaps = 16/157 (10%)

Query: 977  TVASLDKSVLQKTRMDAQKVEANEIDDIDHCNKGIPSKLKVLVAEDNLVNQEVIKRMLKL 1036
            +V+S+ KS +   + ++Q   A E        KG      VL+ ED+ V+ ++  + L+ 
Sbjct: 395  SVSSISKSDVDIKQENSQSPTATE-----ELRKG----YHVLLVEDDAVSIQLCSKFLRK 445

Query: 1037 ENISDIELAFDGIEAFEKVKKNLLSYKKYDIIFMDIQMPKMDGLESTTKIRQELKYEGKI 1096
               + +E+  DG+ A      ++L   +YD++ MDI MP +DG  +T+ IR     E  I
Sbjct: 446  SGCT-VEVVTDGLAAI-----SILEAFRYDLVLMDIVMPNLDGATATSIIR-NFDKETPI 498

Query: 1097 VALTAFADESNIKECRDAGMDGFIEKPIKRVALHTLL 1133
            +A+T   ++ ++      GM   + KP  R  L ++L
Sbjct: 499  IAMTGNIEDQDLITYLQHGMTDILAKPFTRDDLLSML 535

>NCAS0D02900 Chr4 complement(551013..553301) [2289 bp, 762 aa] {ON}
            Anc_5.230 YLR006C
          Length = 762

 Score = 54.7 bits (130), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 42/138 (30%), Positives = 68/138 (49%), Gaps = 28/138 (20%)

Query: 1014 KLKVLVAEDNLVNQEVIKRMLKLENISDIELAFDGIEAFEKVKKNLLSYKKYDIIFMDIQ 1073
            K+ VL+ EDN++NQ ++   L+   IS  ++A +G EA +  K+  L      +IFMD+Q
Sbjct: 544  KINVLIVEDNVINQAILGSFLRKHKIS-YKVAKNGKEAVDIWKEGGLH-----LIFMDLQ 597

Query: 1074 MPKMDGLESTTKIRQELKYEG-------------------KIVALTAFADESNIKECRDA 1114
            +P + G+E+  +IR   K  G                    IVALTA   + + +    +
Sbjct: 598  LPVLSGIEAARQIRAFEKENGIGIQEHSNSLKKNKTKAPVIIVALTASNSQDDKRNALIS 657

Query: 1115 GMDGFIEKPIKRVALHTL 1132
            G + ++ KP   V LH L
Sbjct: 658  GCNDYLTKP---VNLHWL 672

>TDEL0D00320 Chr4 complement(53243..54886) [1644 bp, 547 aa] {ON}
            Anc_4.385 YJR147W
          Length = 547

 Score = 54.3 bits (129), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 33/123 (26%), Positives = 65/123 (52%), Gaps = 7/123 (5%)

Query: 1017 VLVAEDNLVNQEVIKRMLKLENISDIELAFDGIEAFEKVKKNLLSYKKYDIIFMDIQMPK 1076
            VL+ ED+ V  ++  + L+    + +E+  DG+ A   ++K      +YD++ MDI MP 
Sbjct: 336  VLLVEDDAVCIQLCSKFLRKYGCT-VEVVTDGLSAISTLEKF-----RYDLVLMDIVMPN 389

Query: 1077 MDGLESTTKIRQELKYEGKIVALTAFADESNIKECRDAGMDGFIEKPIKRVALHTLLEEF 1136
            +DG  +T+ +R        I+A+T   ++ ++      GM+  + KP  +  LH++L  +
Sbjct: 390  LDGATATSIVR-SFDNHTPIIAMTGNIEDQDLITYLQHGMNDILAKPFTKDDLHSMLIRY 448

Query: 1137 QQD 1139
             +D
Sbjct: 449  LKD 451

>KLTH0B02684g Chr2 (207260..209047) [1788 bp, 595 aa] {ON} some
            similarities with uniprot|Q07084 Saccharomyces cerevisiae
            YLR006C SSK1 Cytoplasmic response regulator part of a
            two-component signal transducer that mediates osmosensing
            via a phosphorelay mechanism dephosphorylated form is
            degraded by the ubiquitin-proteasome system potential
            Cdc28p substrate
          Length = 595

 Score = 54.3 bits (129), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 37/133 (27%), Positives = 67/133 (50%), Gaps = 28/133 (21%)

Query: 1014 KLKVLVAEDNLVNQEVIKRMLKLENISDIELAFDGIEAFEKVKKNLLSYKKYDIIFMDIQ 1073
            K+ VLV EDN++NQ ++   L+   I   ++A +G+EA ++ K+  +      +I MD++
Sbjct: 405  KISVLVVEDNMINQAILSSFLRKHKIH-YKVAKNGVEAVDRWKEGGMH-----LILMDLE 458

Query: 1074 MPKMDGLESTTKIRQELKYEG----------------------KIVALTAFADESNIKEC 1111
            MP + G+++  +IR+  K  G                       IVALTA   +++  E 
Sbjct: 459  MPLLSGIDAAKEIRKLEKQNGIGTGDPLGKHAELKGLTCKAPVIIVALTASNSQTDKTEA 518

Query: 1112 RDAGMDGFIEKPI 1124
              AG + ++ KP+
Sbjct: 519  LLAGCNDYLTKPV 531

>KNAG0B05140 Chr2 (985361..987307) [1947 bp, 648 aa] {ON} Anc_5.230
            YLR006C
          Length = 648

 Score = 53.9 bits (128), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 40/126 (31%), Positives = 67/126 (53%), Gaps = 16/126 (12%)

Query: 1014 KLKVLVAEDNLVNQEVIKRMLKLENISDIELAFDGIEAFEKVKKNLLSYKKYDIIFMDIQ 1073
            K+ VL+ EDN++NQ ++   L+   IS  ++A +G EA +  K+  L      +IFMD+Q
Sbjct: 516  KINVLIVEDNVINQAILGSFLRKHKIS-YKVAKNGKEAVDIWKEGGLH-----LIFMDLQ 569

Query: 1074 MPKMDGLESTTKIRQELKYEGK-------IVALTAFADESNIKECRDAGMDGFIEKPIKR 1126
            +P + G+++  +IR   K           IVALTA     + ++   +G + ++ KP   
Sbjct: 570  LPVLSGIDAAKQIRDCEKKRTASQNAPVIIVALTASNSIEDKRKALISGCNDYLTKP--- 626

Query: 1127 VALHTL 1132
            V LH L
Sbjct: 627  VNLHWL 632

>TPHA0N00850 Chr14 complement(189011..191023) [2013 bp, 670 aa] {ON}
            Anc_5.230 YLR006C
          Length = 670

 Score = 52.8 bits (125), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 40/143 (27%), Positives = 68/143 (47%), Gaps = 31/143 (21%)

Query: 1015 LKVLVAEDNLVNQEVIKRMLKLENISDIELAFDGIEAFEKVKKNLLSYKKYDIIFMDIQM 1074
            + VL+ EDN++NQ ++   L+   IS   +A +G EA EK K+  +      +IFMD+Q+
Sbjct: 471  ITVLIVEDNVINQTILASFLRKHKIS-YRIAKNGREAVEKWKEGGIH-----LIFMDLQL 524

Query: 1075 PKMDGLESTTKIRQELKYE-------------------------GKIVALTAFADESNIK 1109
            P M G+++  +IR+  K +                         G  V + AF   +++ 
Sbjct: 525  PVMSGIDAAKEIRECEKLKGIGIRNPMASSSSLSIVESVEKPVLGAPVIMVAFTASNSLT 584

Query: 1110 ECRDAGMDGFIEKPIKRVALHTL 1132
            + R+A + G  +   K V LH L
Sbjct: 585  DKREALVSGCNDYLTKPVNLHWL 607

>TBLA0A10700 Chr1 (2646036..2647799) [1764 bp, 587 aa] {ON} Anc_4.385
            YJR147W
          Length = 587

 Score = 52.4 bits (124), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 32/123 (26%), Positives = 65/123 (52%), Gaps = 7/123 (5%)

Query: 1017 VLVAEDNLVNQEVIKRMLKLENISDIELAFDGIEAFEKVKKNLLSYKKYDIIFMDIQMPK 1076
            VL+ ED+ V  ++  + L+    + + +  DG+ A      ++L   ++D++ MDI MP 
Sbjct: 418  VLLVEDDEVCIQLCSKFLRKYGCT-VRVVTDGLTAI-----SVLENHRFDLVLMDIVMPN 471

Query: 1077 MDGLESTTKIRQELKYEGKIVALTAFADESNIKECRDAGMDGFIEKPIKRVALHTLLEEF 1136
            +DG  +T+ +R    Y   I+A+T   ++ ++      GM+  + KP  +  LH++L  +
Sbjct: 472  LDGATATSIVRNFDNYT-PIIAMTGNIEDQDLITYLQHGMNDILAKPFTKRDLHSMLVRY 530

Query: 1137 QQD 1139
             +D
Sbjct: 531  LRD 533

>KLTH0D17182g Chr4 complement(1424948..1426342) [1395 bp, 464 aa] {ON}
            similar to uniprot|P38889 Saccharomyces cerevisiae
            YHR206W
          Length = 464

 Score = 52.4 bits (124), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 31/117 (26%), Positives = 63/117 (53%), Gaps = 7/117 (5%)

Query: 1017 VLVAEDNLVNQEVIKRMLKLENISDIELAFDGIEAFEKVKKNLLSYKKYDIIFMDIQMPK 1076
            VL+ ED+ +  ++  + L ++    +E+  DG+ A   ++K      +YD++ MDI MP 
Sbjct: 307  VLLVEDDSICIQLCSKFL-MKYGCTVEVVTDGLSAISTLEK-----FRYDLVLMDIVMPN 360

Query: 1077 MDGLESTTKIRQELKYEGKIVALTAFADESNIKECRDAGMDGFIEKPIKRVALHTLL 1133
            +DG  +T+ +R     +  I+A+T   ++ ++      GM+  + KP  +  LH++L
Sbjct: 361  LDGATATSIVR-SFDNQTPIIAMTGNIEDQDLVTYLQHGMNDILAKPFTKDDLHSML 416

>Kwal_47.16770 s47 (103208..104593) [1386 bp, 461 aa] {ON} YHR206W
            (SKN7) - transcription factor involved in oxidative
            stress response [contig 376] FULL
          Length = 461

 Score = 52.0 bits (123), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 30/117 (25%), Positives = 63/117 (53%), Gaps = 7/117 (5%)

Query: 1017 VLVAEDNLVNQEVIKRMLKLENISDIELAFDGIEAFEKVKKNLLSYKKYDIIFMDIQMPK 1076
            VL+ ED+ +  ++  + L ++    +E+  DG+ A   ++K      ++D++ MDI MP 
Sbjct: 304  VLLVEDDSICIQLCSKFL-MKYACTVEVVTDGLSAISTLEK-----FRFDLVLMDIVMPN 357

Query: 1077 MDGLESTTKIRQELKYEGKIVALTAFADESNIKECRDAGMDGFIEKPIKRVALHTLL 1133
            +DG  +T+ +R     +  I+A+T   ++ ++      GM+  + KP  +  LH++L
Sbjct: 358  LDGATATSIVR-SFDNQTPIIAMTGNIEDQDLVTYLQHGMNDILAKPFTKDDLHSML 413

>TPHA0C00150 Chr3 complement(15029..16561) [1533 bp, 510 aa] {ON}
            Anc_4.385 YJR147W
          Length = 510

 Score = 51.6 bits (122), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 47/203 (23%), Positives = 97/203 (47%), Gaps = 19/203 (9%)

Query: 935  IEDTPVSITSSSQTHSDLNSLQSNSTNEVGLDDSFSEAENDSTVASLDKSVLQKTRMDAQ 994
            +E T   I++    H+++N L  NS + + +     +A    +++ L   +L+       
Sbjct: 280  LELTTSGISNPQSVHNEIN-LGENSDDPLPI----HKANKTPSISDLPNPILENDE---- 330

Query: 995  KVEANEID-DIDHCNKGIPSKLKVLVAEDNLVNQEVIKRMLKLENISDIELAFDGIEAFE 1053
                N ID D+   +  +     VL+ ED+ V+ ++  + L ++    +++  DG+ A  
Sbjct: 331  --NINTIDGDLAQGDTILKKGFNVLLVEDDEVSIQLCSKFL-IKYGCTVQVVTDGLAAIS 387

Query: 1054 KVKKNLLSYKKYDIIFMDIQMPKMDGLESTTKIRQELKYEGKIVALTAFADESNIKECRD 1113
             ++K      ++D++ MDI MP +DG  +T+ IR     E  I+A+T   +  ++     
Sbjct: 388  TLEK-----YRFDLVLMDIVMPNLDGATATSIIRN-FDNETPIIAMTGSIEHQDLITYLQ 441

Query: 1114 AGMDGFIEKPIKRVALHTLLEEF 1136
             GM+  + KP  R  L+++L  +
Sbjct: 442  HGMNDILAKPFTRRDLYSMLTRY 464

>Suva_10.84 Chr10 complement(167272..169359) [2088 bp, 695 aa] {ON}
            YLR006C (REAL)
          Length = 695

 Score = 52.0 bits (123), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 42/146 (28%), Positives = 67/146 (45%), Gaps = 36/146 (24%)

Query: 1014 KLKVLVAEDNLVNQEVIKRMLKLENISDIELAFDGIEAFEKVKKNLLSYKKYDIIFMDIQ 1073
            K+ VL+ EDN++NQ ++   L+   IS  +LA +G EA      N+       +IFMD+Q
Sbjct: 485  KINVLIVEDNVINQAILGSFLRKHKIS-YKLAKNGQEAV-----NIWKEGGLHLIFMDLQ 538

Query: 1074 MPKMDGLESTTKIRQELKYEG---------------------------KIVALTAFADES 1106
            +P + G+E+  +IR   K  G                            IVALTA   + 
Sbjct: 539  LPVLSGIEAAKQIRDFEKQNGIGIQKSLNNSYPNHEKLPCKKFSQAPVIIVALTASNSQM 598

Query: 1107 NIKECRDAGMDGFIEKPIKRVALHTL 1132
            + ++   +G + ++ KP   V LH L
Sbjct: 599  DKRKALVSGCNDYLTKP---VNLHWL 621

>YLR006C Chr12 complement(161755..163893) [2139 bp, 712 aa] {ON}
            SSK1Cytoplasmic response regulator; part of a
            two-component signal transducer that mediates osmosensing
            via a phosphorelay mechanism; required for mitophagy;
            dephosphorylated form is degraded by the
            ubiquitin-proteasome system; potential Cdc28p substrate
          Length = 712

 Score = 52.0 bits (123), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 41/146 (28%), Positives = 67/146 (45%), Gaps = 36/146 (24%)

Query: 1014 KLKVLVAEDNLVNQEVIKRMLKLENISDIELAFDGIEAFEKVKKNLLSYKKYDIIFMDIQ 1073
            K+ VL+ EDN++NQ ++   L+   IS  +LA +G EA      N+       +IFMD+Q
Sbjct: 503  KINVLIVEDNVINQAILGSFLRKHKIS-YKLAKNGQEAV-----NIWKEGGLHLIFMDLQ 556

Query: 1074 MPKMDGLESTTKIRQELKYEG---------------------------KIVALTAFADES 1106
            +P + G+E+  +IR   K  G                            IVALTA   + 
Sbjct: 557  LPVLSGIEAAKQIRDFEKQNGIGIQKSLNNSHSNLEKGTSKRFSQAPVIIVALTASNSQM 616

Query: 1107 NIKECRDAGMDGFIEKPIKRVALHTL 1132
            + ++   +G + ++ KP+    LH L
Sbjct: 617  DKRKALLSGCNDYLTKPVN---LHWL 639

>NDAI0I02000 Chr9 complement(464492..467164) [2673 bp, 890 aa] {ON}
            Anc_5.230 YLR006C
          Length = 890

 Score = 51.6 bits (122), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 42/142 (29%), Positives = 69/142 (48%), Gaps = 32/142 (22%)

Query: 1014 KLKVLVAEDNLVNQEVIKRMLKLENISDIELAFDGIEAFEKVKKNLLSYKKYDIIFMDIQ 1073
            K+ VL+ EDN++NQ ++   L+   IS  ++A +G EA +  K+  L      +IFMD+Q
Sbjct: 669  KINVLIVEDNVINQAILGSFLRKHKIS-YKVAKNGKEAVDIWKEGGLH-----LIFMDLQ 722

Query: 1074 MPKMDGLESTTKIRQELKYEG-----------------------KIVALTAFADESNIKE 1110
            +P + G+E+  +IR   K +G                        IVALTA     + ++
Sbjct: 723  LPVLSGIEAARQIRDFEKEKGIGIQENNLKQKIIPASNINQAPVIIVALTASNSLDDKRK 782

Query: 1111 CRDAGMDGFIEKPIKRVALHTL 1132
               +G + ++ KP   V LH L
Sbjct: 783  ALLSGCNDYLTKP---VNLHWL 801

>Smik_12.68 Chr12 complement(148821..150959) [2139 bp, 712 aa] {ON}
            YLR006C (REAL)
          Length = 712

 Score = 51.6 bits (122), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 42/146 (28%), Positives = 67/146 (45%), Gaps = 36/146 (24%)

Query: 1014 KLKVLVAEDNLVNQEVIKRMLKLENISDIELAFDGIEAFEKVKKNLLSYKKYDIIFMDIQ 1073
            K+ VL+ EDN++NQ ++   L+   IS  +LA +G EA      N+       +IFMD+Q
Sbjct: 502  KINVLIVEDNVINQAILGSFLRKHKIS-YKLAKNGQEAV-----NIWKEGGLHLIFMDLQ 555

Query: 1074 MPKMDGLESTTKIRQELKYEG---------------------------KIVALTAFADES 1106
            +P + G+E+  +IR   K  G                            IVALTA   + 
Sbjct: 556  LPVLSGIEAAKQIRDFEKQNGIGIQKTPNNSHYNFEKSASKRFSQAPVIIVALTASNSQM 615

Query: 1107 NIKECRDAGMDGFIEKPIKRVALHTL 1132
            + ++   +G + ++ KP   V LH L
Sbjct: 616  DKRKALLSGCNDYLTKP---VNLHWL 638

>Skud_12.72 Chr12 complement(153012..155120) [2109 bp, 702 aa] {ON}
            YLR006C (REAL)
          Length = 702

 Score = 51.2 bits (121), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 42/146 (28%), Positives = 67/146 (45%), Gaps = 36/146 (24%)

Query: 1014 KLKVLVAEDNLVNQEVIKRMLKLENISDIELAFDGIEAFEKVKKNLLSYKKYDIIFMDIQ 1073
            K+ VL+ EDN++NQ ++   L+   IS  +LA +G EA      N+       +IFMD+Q
Sbjct: 492  KINVLIVEDNVINQAILGSFLRKHKIS-YKLAKNGQEAV-----NIWKEGGLHLIFMDLQ 545

Query: 1074 MPKMDGLESTTKIRQELKYEG---------------------------KIVALTAFADES 1106
            +P + G+E+  +IR   K  G                            IVALTA   + 
Sbjct: 546  LPVLSGIEAAKQIRDFEKQNGIGIQKGLNNSHSNFDKGTSKKFSQAPVIIVALTASNSQM 605

Query: 1107 NIKECRDAGMDGFIEKPIKRVALHTL 1132
            + ++   +G + ++ KP   V LH L
Sbjct: 606  DKRKALLSGCNDYLTKP---VNLHWL 628

>Kpol_265.2 s265 (9842..11491) [1650 bp, 549 aa] {ON} (9842..11491)
            [1650 nt, 550 aa]
          Length = 549

 Score = 50.4 bits (119), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 35/141 (24%), Positives = 73/141 (51%), Gaps = 9/141 (6%)

Query: 999  NEIDDIDHCNKGIPSKLKVLVAEDNLVNQEVIKRMLKLENISDIELAFDGIEAFEKVKKN 1058
            ++I D+D  +  +     VL+ ED+ V+ ++  + L+    + +++  DG+ A      +
Sbjct: 368  DDIGDVD--SNELKKGFHVLLVEDDDVSIQLCSKFLRKYGCT-VQVVTDGLAAI-----S 419

Query: 1059 LLSYKKYDIIFMDIQMPKMDGLESTTKIRQELKYEGKIVALTAFADESNIKECRDAGMDG 1118
            +L   ++D++ MDI MP +DG  +T+ IR        I+A+T   +  ++      GM+ 
Sbjct: 420  ILEKFRFDLVLMDIVMPNLDGATATSIIRN-FDNRTPIIAMTGSIEHQDLITYLQHGMND 478

Query: 1119 FIEKPIKRVALHTLLEEFQQD 1139
             + KP  R  L+++L  + +D
Sbjct: 479  ILAKPFTRKDLYSILIRYLKD 499

>ZYRO0A11154g Chr1 (893793..896123) [2331 bp, 776 aa] {ON} similar to
            uniprot|Q07084 Saccharomyces cerevisiae YLR006C SSK1
            Cytoplasmic response regulator part of a two- component
            signal transducer that mediates osmosensing via a
            phosphorelay mechanism dephosphorylated form is degraded
            by the ubiquitin-proteasome system potential Cdc28p
            substrate
          Length = 776

 Score = 50.8 bits (120), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 40/145 (27%), Positives = 69/145 (47%), Gaps = 35/145 (24%)

Query: 1014 KLKVLVAEDNLVNQEVIKRMLKLENISDIELAFDGIEAFEKVKKNLLSYKKYDIIFMDIQ 1073
            K+ VL+ EDN++NQ ++   L+   I   ++A +G EA +  ++  +      +IFMD+Q
Sbjct: 564  KINVLIVEDNVINQTILSSFLRKHKIF-YKVAKNGQEAIDVWREGGIH-----LIFMDLQ 617

Query: 1074 MPKMDGLESTTKIRQELKYEG--------------------------KIVALTAFADESN 1107
            +P + G+++  KIR+  +  G                           IVA TA   +S+
Sbjct: 618  LPVLSGIDAAKKIRELEREHGIGIQKSRKTPHIESNKINKDQINAPVIIVAFTASKSQSD 677

Query: 1108 IKECRDAGMDGFIEKPIKRVALHTL 1132
             KE   +G + ++ KP   V LH L
Sbjct: 678  KKEALISGCNDYLTKP---VNLHWL 699

>SAKL0G12100g Chr7 (1029250..1031466) [2217 bp, 738 aa] {ON} weakly
            similar to uniprot|Q07084 Saccharomyces cerevisiae
            YLR006C SSK1 Cytoplasmic response regulator part of a
            two-component signal transducer that mediates osmosensing
            via a phosphorelay mechanism dephosphorylated form is
            degraded by the ubiquitin-proteasome system potential
            Cdc28p substrate
          Length = 738

 Score = 50.1 bits (118), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 49/81 (60%), Gaps = 6/81 (7%)

Query: 1014 KLKVLVAEDNLVNQEVIKRMLKLENISDIELAFDGIEAFEKVKKNLLSYKKYDIIFMDIQ 1073
            K+ VL+ EDN++NQ ++   L+   IS  ++A +G EA +K K+  +      +I +D+Q
Sbjct: 461  KINVLIVEDNVINQAILGSFLRKHKIS-YKVAKNGREAVDKWKQGGIH-----LILLDLQ 514

Query: 1074 MPKMDGLESTTKIRQELKYEG 1094
            +P + G+E+T +IR   K  G
Sbjct: 515  LPILSGIEATKEIRNLEKLNG 535

>TBLA0D03170 Chr4 complement(771345..773642) [2298 bp, 765 aa] {ON}
            Anc_5.230 YLR006C
          Length = 765

 Score = 48.5 bits (114), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 28/83 (33%), Positives = 50/83 (60%), Gaps = 9/83 (10%)

Query: 1014 KLKVLVAEDNLVNQEVIKRMLKLENISDIELAFDGIEAFEKVKKNLLSYKKYDIIFMDIQ 1073
            ++ +L+ EDN++NQ ++   L+   I   ++A +G EA +K K+  +      +IFMD+Q
Sbjct: 564  RINILIVEDNVINQTILGSFLRKNKIF-YKVAKNGREAVDKWKEGGIH-----LIFMDLQ 617

Query: 1074 MPKMDGLESTTKIRQELKYEGKI 1096
            +P + G ++  +IRQ   YE KI
Sbjct: 618  LPVLSGTDAAKEIRQ---YEKKI 637

>KLLA0E04533g Chr5 (408415..409680) [1266 bp, 421 aa] {ON} similar
           to uniprot|P40530 Saccharomyces cerevisiae YIL042C
           Hypothetical ORF
          Length = 421

 Score = 37.7 bits (86), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 34/81 (41%), Gaps = 15/81 (18%)

Query: 832 IRFEVIDNGPGIDQNLHDSVF-----------KPFVQGDQTLSRQ----YGGTGLGLSIC 876
           +   + D G GID  + D VF           K     D  L  Q      G G GL +C
Sbjct: 325 LEIRIRDFGGGIDPQVEDRVFDYSFSTTVKEEKDSGMSDYVLPGQEVQNVAGMGFGLPMC 384

Query: 877 KQLCEMMKGTLELESELGKGS 897
           K   E+  GTL+++S  G G+
Sbjct: 385 KAYLELFNGTLDIQSLWGWGT 405

>Kwal_47.18151 s47 (709368..710612) [1245 bp, 414 aa] {ON} YIL042C -
           Hypothetical ORF [contig 197] FULL
          Length = 414

 Score = 35.4 bits (80), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 16/35 (45%), Positives = 22/35 (62%), Gaps = 1/35 (2%)

Query: 868 GTGLGLSICKQLCEMMKGTLELESELGKGS-KFIY 901
           G G GL +CK   EM  GTL+++S  G G+  +IY
Sbjct: 370 GMGFGLPMCKAYMEMFNGTLDIQSLWGWGTDAYIY 404

>Smik_3.30 Chr3 complement(46053..48428) [2376 bp, 791 aa] {ON}
           YCL045C (REAL)
          Length = 791

 Score = 34.3 bits (77), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 29/49 (59%)

Query: 197 SLPISGPYSTATKIGNQSNIYGYLTVVMSAESLKSVFNDTAGLSDSTTA 245
           S P   P+STA KI     +Y ++++ ++   +K+VF+D A ++D   A
Sbjct: 21  SHPRHNPFSTAMKITCTGLVYVFISLFLNTSCVKAVFSDDAFVTDWQLA 69

>SAKL0F08184g Chr6 (623521..624759) [1239 bp, 412 aa] {ON} similar
           to uniprot|P40530 Saccharomyces cerevisiae YIL042C
           Hypothetical ORF
          Length = 412

 Score = 33.5 bits (75), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 19/30 (63%)

Query: 868 GTGLGLSICKQLCEMMKGTLELESELGKGS 897
           G G GL +CK   EM  G+L+++S  G G+
Sbjct: 368 GMGFGLPMCKAYLEMFDGSLDIQSLYGWGT 397

>SAKL0D12914g Chr4 complement(1080337..1083492) [3156 bp, 1051 aa]
            {ON} highly similar to uniprot|Q753A0 Ashbya gossypii
            AFR424C AFR424Cp and similar to YKL205W uniprot|P33418
            Saccharomyces cerevisiae YKL205W LOS1 Nuclear pore
            protein involved in nuclear export of pre-tRNA
          Length = 1051

 Score = 33.5 bits (75), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 42/159 (26%), Positives = 70/159 (44%), Gaps = 32/159 (20%)

Query: 986  LQKTRMDAQKVEANEIDDIDHCNKGIPSKLKVLVAEDNLVNQEV--------IKRMLKLE 1037
            ++K ++D +  + + ID+ID  N+ + SKLKV      ++N  V        I+ ++   
Sbjct: 414  MKKMKID-ETCDEDSIDEIDEFNETVRSKLKVFQDSIAIINPSVYMDNMSKHIETLMSST 472

Query: 1038 NISDIELAFDGIEAF-EKVKKNLLSYKKYDI------IFMDIQMPKMDGLESTTKIRQ-- 1088
            +  D+ELA   +  F E V+ NL    K +I      IFM      M  L S+T + Q  
Sbjct: 473  DWRDLELATYQMHNFAESVRNNLFGLNKNEITNSQPHIFMS---KCMATLLSSTVLFQIN 529

Query: 1089 ----ELKYEGKIVALTAFADESNIKE-------CRDAGM 1116
                ++ +   +V    F D +N  E       C + GM
Sbjct: 530  NPLIQISFFELVVRHYGFLDSTNKDEVTLLNVFCSEFGM 568

>SAKL0B01210g Chr2 complement(109892..114658) [4767 bp, 1588 aa] {ON}
            similar to uniprot|Q75BQ3 Ashbya gossypii ACR218W
            ACR218Wp and some similarites with YFL033C uniprot|P43565
            Saccharomyces cerevisiae YFL033C RIM15
            Glucose-repressible protein kinase involved in signal
            transduction during cell proliferation in response to
            nutrients specifically the establishment of stationary
            phase originally identified as a regulator of IME2
          Length = 1588

 Score = 33.5 bits (75), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 41/201 (20%), Positives = 89/201 (44%), Gaps = 26/201 (12%)

Query: 938  TPVSITSSSQTHSDLNSLQSNSTNEVGLDDSFSEAENDSTVASLDKSVLQKTRMDAQKVE 997
            +P S TS S+ HS  +S ++N  +E+  DDS    E    ++ ++ +  ++         
Sbjct: 1378 SPPSNTSRSRMHSRTSSQRTN-VSELSADDS----ERSYALSKVNTARSRRRSGRKSSSG 1432

Query: 998  ANEIDDIDHCNKGIPSKLKVLVAEDNLVNQEVIKRMLKLENISDIELAFDGIEAFEKVKK 1057
              E+     CN      + VL+ E        I R   ++++  +  +  G+ A +++ +
Sbjct: 1433 VGEVG----CN------MDVLLCE-----PIPIHRYRLVKDLESLGCSVVGVGAGDELVR 1477

Query: 1058 NLLSYKKYDIIFMDIQMPKMDGLESTTKIRQ--ELKYEGKIVALTAFADESNIKECRDAG 1115
               +  K+D+I   +++PK+  ++    +R          IVA+TA+  E+   +     
Sbjct: 1478 RATAGVKFDLIITALKLPKLGAVDIAKLLRHTNSANCNTPIVAVTAYYGEAESTQV---- 1533

Query: 1116 MDGFIEKPIKRVALHTLLEEF 1136
             D  +EKP+    +  L+ ++
Sbjct: 1534 FDDVLEKPVGIEQIRCLIAKY 1554

>KLTH0G18612g Chr7 (1604066..1608640) [4575 bp, 1524 aa] {ON} similar
            to uniprot|P43565 Saccharomyces cerevisiae YFL033C RIM15
            Glucose-repressible protein kinase involved in signal
            transduction during cell proliferation in response to
            nutrients specifically the establishment of stationary
            phase originally identified as a regulator of IME2
          Length = 1524

 Score = 32.3 bits (72), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 38/72 (52%), Gaps = 6/72 (8%)

Query: 1064 KYDIIFMDIQMPKMDGLESTTKIR--QELKYEGKIVALTAFADESNIKECRDAGMDGFIE 1121
            K+D+IF  +++PK+  ++    +R    +     I+A+TA+  E+  + C     D  +E
Sbjct: 1433 KFDLIFTALKLPKLGAIDIVKLLRNTNSVNSTTSIIAVTAYFQEAQ-QAC---AFDEVLE 1488

Query: 1122 KPIKRVALHTLL 1133
            +P+    L +LL
Sbjct: 1489 RPVSVQQLRSLL 1500

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.133    0.375 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 98,860,787
Number of extensions: 3747915
Number of successful extensions: 15006
Number of sequences better than 10.0: 111
Number of HSP's gapped: 15288
Number of HSP's successfully gapped: 170
Length of query: 1140
Length of database: 53,481,399
Length adjustment: 121
Effective length of query: 1019
Effective length of database: 39,606,813
Effective search space: 40359342447
Effective search space used: 40359342447
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 71 (32.0 bits)