Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0E020905.699ON74974929030.0
YIL146C (ATG32)5.699ON5291493566e-35
Smik_9.235.699ON5271503532e-34
Suva_9.435.699ON5131503478e-34
ZYRO0G06666g5.699ON5031533469e-34
Skud_9.225.699ON5371463461e-33
TDEL0B022205.699ON4891493052e-28
CAGL0H06545g5.699ON4921412615e-23
SAKL0E14850g5.699ON4701582393e-20
KLTH0E01122g5.699ON4721602134e-17
Kwal_55.197165.699ON4671582125e-17
KAFR0D022505.699ON5561422064e-16
Ecym_40215.699ON4591501841e-13
AFR283W5.699ON4521581805e-13
NCAS0G002605.699ON5101611762e-12
KNAG0L021005.699ON4441511644e-11
KLLA0A00660g5.699ON5241621467e-09
CAGL0L09713g2.655ON17691688.7
NOTE: 2 genes in the same pillar as TBLA0E02090 were not hit in these BLAST results
LIST: Kpol_2001.73 TPHA0D04580

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0E02090
         (749 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0E02090 Chr5 (508537..510786) [2250 bp, 749 aa] {ON} Anc_5.6...  1122   0.0  
YIL146C Chr9 complement(74184..75773) [1590 bp, 529 aa] {ON}  AT...   141   6e-35
Smik_9.23 Chr9 complement(51874..53457) [1584 bp, 527 aa] {ON} Y...   140   2e-34
Suva_9.43 Chr9 complement(68866..68940,68994..69068,69093..69122...   138   8e-34
ZYRO0G06666g Chr7 complement(532862..534373) [1512 bp, 503 aa] {...   137   9e-34
Skud_9.22 Chr9 complement(51263..52876) [1614 bp, 537 aa] {ON} Y...   137   1e-33
TDEL0B02220 Chr2 complement(400065..401534) [1470 bp, 489 aa] {O...   122   2e-28
CAGL0H06545g Chr8 (643447..644925) [1479 bp, 492 aa] {ON} simila...   105   5e-23
SAKL0E14850g Chr5 (1229975..1231387) [1413 bp, 470 aa] {ON} simi...    97   3e-20
KLTH0E01122g Chr5 complement(110889..112307) [1419 bp, 472 aa] {...    87   4e-17
Kwal_55.19716 s55 complement(93412..94815) [1404 bp, 467 aa] {ON...    86   5e-17
KAFR0D02250 Chr4 complement(455223..456893) [1671 bp, 556 aa] {O...    84   4e-16
Ecym_4021 Chr4 complement(53316..54695) [1380 bp, 459 aa] {ON} s...    75   1e-13
AFR283W Chr6 (945526..946884) [1359 bp, 452 aa] {ON} Syntenic ho...    74   5e-13
NCAS0G00260 Chr7 complement(44445..45977) [1533 bp, 510 aa] {ON}...    72   2e-12
KNAG0L02100 Chr12 (374542..375876) [1335 bp, 444 aa] {ON} Anc_5....    68   4e-11
KLLA0A00660g Chr1 complement(64397..65971) [1575 bp, 524 aa] {ON...    61   7e-09
CAGL0L09713g Chr12 (1045608..1046138) [531 bp, 176 aa] {ON} high...    31   8.7  

>TBLA0E02090 Chr5 (508537..510786) [2250 bp, 749 aa] {ON} Anc_5.699
           YIL146C
          Length = 749

 Score = 1122 bits (2903), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 580/749 (77%), Positives = 580/749 (77%)

Query: 1   MTEQLDANATGKSNSSSGSMDYDKRGFLDPHFSLIELLENAKYSLQENSNEATVTNVLQP 60
           MTEQLDANATGKSNSSSGSMDYDKRGFLDPHFSLIELLENAKYSLQENSNEATVTNVLQP
Sbjct: 1   MTEQLDANATGKSNSSSGSMDYDKRGFLDPHFSLIELLENAKYSLQENSNEATVTNVLQP 60

Query: 61  DNPTSPLNEIRLELSGMNVDDIXXXXXXXXXXXXXXXXXWQRIQTPDYSPLDVKDXXXXX 120
           DNPTSPLNEIRLELSGMNVDDI                 WQRIQTPDYSPLDVKD     
Sbjct: 61  DNPTSPLNEIRLELSGMNVDDINSENQESSELSQSLSNSWQRIQTPDYSPLDVKDSNSIN 120

Query: 121 XXXXXTVGILSSTDSSEEEQDNISLNTYLRVNSAVKEDXXXXXXXXXXXXXXXXXANGXX 180
                TVGILSSTDSSEEEQDNISLNTYLRVNSAVKED                 ANG  
Sbjct: 121 NINNNTVGILSSTDSSEEEQDNISLNTYLRVNSAVKEDSSFINPNNNIISLSPTPANGTK 180

Query: 181 XXXXXXXXXXXXXXXXXXXXXXXTPKAKNLFNMKTSKYYPKYRTFTPNDTRLSHMQHXXX 240
                                  TPKAKNLFNMKTSKYYPKYRTFTPNDTRLSHMQH   
Sbjct: 181 KNGTTDYNDDDDDDDEINSKNKDTPKAKNLFNMKTSKYYPKYRTFTPNDTRLSHMQHSNS 240

Query: 241 XXXXXXXXXXXXXXXXXXMTSSKDTLTTSFLEIFKDXXXXXXXXXXXXXXXDIDLKIKHX 300
                             MTSSKDTLTTSFLEIFKD               DIDLKIKH 
Sbjct: 241 NLHISMNNSINNNNFDSSMTSSKDTLTTSFLEIFKDNSNSNSKNLNNEFNNDIDLKIKHL 300

Query: 301 XXXXXXXXXXXXXXTITNSYNNLNLTKSMTSSSNSFIMPKLSWTNTFRKFRILILGSNQN 360
                         TITNSYNNLNLTKSMTSSSNSFIMPKLSWTNTFRKFRILILGSNQN
Sbjct: 301 VLSNSLDNDDQSNSTITNSYNNLNLTKSMTSSSNSFIMPKLSWTNTFRKFRILILGSNQN 360

Query: 361 LTFYQNIPTSYKYLFELPPNNFDYNFKHYAGIAIVIHDLTDFKSILNKIDKYSMNKKPII 420
           LTFYQNIPTSYKYLFELPPNNFDYNFKHYAGIAIVIHDLTDFKSILNKIDKYSMNKKPII
Sbjct: 361 LTFYQNIPTSYKYLFELPPNNFDYNFKHYAGIAIVIHDLTDFKSILNKIDKYSMNKKPII 420

Query: 421 PICEKGQINEVKNILKPYIKTKDLSLLYPPIVGTNRDGMNTLYLHLNDLSKNVELEITRD 480
           PICEKGQINEVKNILKPYIKTKDLSLLYPPIVGTNRDGMNTLYLHLNDLSKNVELEITRD
Sbjct: 421 PICEKGQINEVKNILKPYIKTKDLSLLYPPIVGTNRDGMNTLYLHLNDLSKNVELEITRD 480

Query: 481 KXXXXXXXXXXXXXGDGRHLHHNDYESNSGDDEADNFDILQSPNFSAXXXXXXXXXXXXX 540
           K             GDGRHLHHNDYESNSGDDEADNFDILQSPNFSA             
Sbjct: 481 KSNNNINNNNNSINGDGRHLHHNDYESNSGDDEADNFDILQSPNFSANLKRRVKKSKLST 540

Query: 541 XXXXXXXXDSRVTTKNMRISSSTNRKEDVSSAKKKKRKTIEQLKCYATVEDFPKNSWXXX 600
                   DSRVTTKNMRISSSTNRKEDVSSAKKKKRKTIEQLKCYATVEDFPKNSW   
Sbjct: 541 SSSNSVLKDSRVTTKNMRISSSTNRKEDVSSAKKKKRKTIEQLKCYATVEDFPKNSWKTN 600

Query: 601 XXXXXXXXXXXXIIYWTVSLSVGVGLGFCLSYYASTIFSNISESISKGINTLISESVTPT 660
                       IIYWTVSLSVGVGLGFCLSYYASTIFSNISESISKGINTLISESVTPT
Sbjct: 601 NNQNTYTKKLKKIIYWTVSLSVGVGLGFCLSYYASTIFSNISESISKGINTLISESVTPT 660

Query: 661 VSDTPIPSPTTYSMEENLSTTCHYVGEKVKETFSNSLFLLKTTLRNLNWTTKQIWNSPQG 720
           VSDTPIPSPTTYSMEENLSTTCHYVGEKVKETFSNSLFLLKTTLRNLNWTTKQIWNSPQG
Sbjct: 661 VSDTPIPSPTTYSMEENLSTTCHYVGEKVKETFSNSLFLLKTTLRNLNWTTKQIWNSPQG 720

Query: 721 LNGVDQILPSKYNFYEDPAMILALGFVLL 749
           LNGVDQILPSKYNFYEDPAMILALGFVLL
Sbjct: 721 LNGVDQILPSKYNFYEDPAMILALGFVLL 749

>YIL146C Chr9 complement(74184..75773) [1590 bp, 529 aa] {ON}
           ATG32Mitochondrial outer membrane protein required to
           initiate mitophagy; recruits the autophagy adaptor
           protein Atg11p and the ubiquitin-like protein Atg8p to
           the mitochondrial surface to initiate mitophagy, the
           selective vacuolar degradation of mitochondria in
           response to starvation; can promote pexophagy when
           placed ectopically in the peroxisomal membrane
          Length = 529

 Score =  141 bits (356), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 69/149 (46%), Positives = 102/149 (68%), Gaps = 2/149 (1%)

Query: 322 NLNLTKSMTSSSNSFIMPKLSWTNTFRKFRILILGSNQNLTFYQNIPTSYKYLFELPPNN 381
           ++ +TKS+TSS+NSF+MPKLS T     FR+LILG   + +FYQ+IP  Y+ LFELP  +
Sbjct: 189 SVTITKSLTSSTNSFVMPKLSLTQKNPVFRLLILGRTGS-SFYQSIPKEYQSLFELPKYH 247

Query: 382 FDYNFKHYAGIAIVIHDLTDFKSILNKIDKYSMNKKPIIPICEKGQINEVKNILKPYIKT 441
               F  Y GI I+  +L +  S+LN+I +YS  K P+IPIC+ GQ+ +VKN+LK +++ 
Sbjct: 248 DSATFPQYTGIVIIFQELREMVSLLNRIVQYSQGK-PVIPICQPGQVIQVKNVLKSFLRN 306

Query: 442 KDLSLLYPPIVGTNRDGMNTLYLHLNDLS 470
           K + LL+PP+V TN+  +  ++  L DLS
Sbjct: 307 KLVKLLFPPVVVTNKRDLKKMFQRLQDLS 335

>Smik_9.23 Chr9 complement(51874..53457) [1584 bp, 527 aa] {ON}
           YIL146C (REAL)
          Length = 527

 Score =  140 bits (353), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 70/150 (46%), Positives = 101/150 (67%), Gaps = 2/150 (1%)

Query: 321 NNLNLTKSMTSSSNSFIMPKLSWTNTFRKFRILILGSNQNLTFYQNIPTSYKYLFELPPN 380
           +++ +TKS+TSS+NSF+MPKLS +     FR+LILG   +  FYQ+IP  Y+ LFELP  
Sbjct: 188 DSVTITKSLTSSTNSFVMPKLSLSQKNPVFRLLILGRTGS-NFYQSIPKEYQSLFELPKY 246

Query: 381 NFDYNFKHYAGIAIVIHDLTDFKSILNKIDKYSMNKKPIIPICEKGQINEVKNILKPYIK 440
           +    F  Y GI I+  +L +  S+LN+I +YS  K PIIPIC+ GQ  +VKN+LK +++
Sbjct: 247 HDSATFPQYTGIIIIFQELREMVSLLNRIVQYSQGK-PIIPICQPGQTIQVKNVLKSFLR 305

Query: 441 TKDLSLLYPPIVGTNRDGMNTLYLHLNDLS 470
            K + LL+PP+V TNR  +  ++  L DLS
Sbjct: 306 NKLIKLLFPPVVVTNRKDLKKMFQRLQDLS 335

 Score = 36.2 bits (82), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 38/130 (29%), Positives = 54/130 (41%), Gaps = 37/130 (28%)

Query: 15  SSSGSMDYDKRGFLDPHFSLIELLENAKYSLQENSNEATVTNVLQPDNPTSPLNEIRLEL 74
           S S +   + RG LDPH S++ELL    +S      ++ VT++               ++
Sbjct: 29  SRSDAQAEEDRGLLDPHLSVLELLGKTGHS-PSPMGQSLVTSI---------------DI 72

Query: 75  SG-MNVDDIXXXXXXXXXXXXXXXXXWQRIQTPDYSPLDVKDXXXXXXXXXXTV--GILS 131
           SG  NV+D                  WQ IQ     PLD+            T    ILS
Sbjct: 73  SGHQNVND-------------SISGSWQAIQ-----PLDLGASFIPERCSSQTTNGSILS 114

Query: 132 STDSSEEEQD 141
           S+D+SEEEQ+
Sbjct: 115 SSDTSEEEQE 124

>Suva_9.43 Chr9
           complement(68866..68940,68994..69068,69093..69122,
           69126..70484) [1539 bp, 513 aa] {ON} YIL146C (REAL)
          Length = 513

 Score =  138 bits (347), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 70/150 (46%), Positives = 99/150 (66%), Gaps = 2/150 (1%)

Query: 321 NNLNLTKSMTSSSNSFIMPKLSWTNTFRKFRILILGSNQNLTFYQNIPTSYKYLFELPPN 380
           +++ +TKS+TSS+NSF+MPKLS +     FR+LILG      FYQ+ P  Y+ LFELP +
Sbjct: 193 DSVTITKSLTSSTNSFVMPKLSLSRKNPVFRLLILGRT-GTNFYQSTPKEYQSLFELPKS 251

Query: 381 NFDYNFKHYAGIAIVIHDLTDFKSILNKIDKYSMNKKPIIPICEKGQINEVKNILKPYIK 440
           +    F  Y GI IV  +L +  S+LN+I +Y+  K PIIPIC+ GQ  +VKN+LK ++K
Sbjct: 252 HDSTIFPQYTGIVIVFQELREMVSLLNRIVEYAQGK-PIIPICQPGQTIQVKNVLKSFLK 310

Query: 441 TKDLSLLYPPIVGTNRDGMNTLYLHLNDLS 470
              + LLYPP+V TNR  +  ++  L DLS
Sbjct: 311 NSLIKLLYPPVVATNRKDLKKMFQRLQDLS 340

>ZYRO0G06666g Chr7 complement(532862..534373) [1512 bp, 503 aa] {ON}
           similar to uniprot|P40458 Saccharomyces cerevisiae
           YIL146C ECM37 Non-essential protein of unknown function
          Length = 503

 Score =  137 bits (346), Expect = 9e-34,   Method: Compositional matrix adjust.
 Identities = 67/153 (43%), Positives = 104/153 (67%), Gaps = 2/153 (1%)

Query: 321 NNLNLTKSMTSSSNSFIMPKLSWTNTFRKFRILILGSNQNLTFYQNIPTSYKYLFELPPN 380
           +N  +TKS+ SSSNSFIMPKLS +   +KFRIL+LG    L FY +IP  Y+++FELP +
Sbjct: 176 DNDTITKSLNSSSNSFIMPKLSLSQKTQKFRILVLG-RPGLKFYHSIPKKYQHMFELPRS 234

Query: 381 NFDYNFKHYAGIAIVIHDLTDFKSILNKIDKYSMNKKPIIPICEKGQINEVKNILKPYIK 440
           +    FK Y GI +V  +L +  S+LN++ + + N+ P+IP+C+ GQ  +V+N+L+  +K
Sbjct: 235 HDPAEFKQYTGILVVFQELKEMVSLLNRVCQCNPNR-PVIPVCQSGQRQQVRNLLESLLK 293

Query: 441 TKDLSLLYPPIVGTNRDGMNTLYLHLNDLSKNV 473
            + +SLLYPP+V  N+  +  ++  L +LSK V
Sbjct: 294 NRLVSLLYPPVVVNNQPDLLGMFRFLQELSKTV 326

 Score = 44.7 bits (104), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 38/151 (25%), Positives = 66/151 (43%), Gaps = 42/151 (27%)

Query: 614 IYWTVSLSVGVGLGFCLSYYASTIFSNIS---------ESISKGINTLISESVTPTVSDT 664
           + W VSL++GVG+G+C+S+  S+ + +++         ES+SK +     + +     D 
Sbjct: 380 VLWGVSLTLGVGVGYCISHLVSSTWISLTTNPLGPVDPESVSKDLFVFDRQELKLGEMDM 439

Query: 665 PIPSPTTYSMEENLSTTCHYVGEKVKETFSNSLFLLKTTLRNLNWTTKQIWNSPQGLNGV 724
               P                       F ++LFL K  L+  N   KQ     + L+ +
Sbjct: 440 DSDHP-----------------------FGHALFLFKQALKQWNLAVKQFLG--RHLSCM 474

Query: 725 DQILPSKYNFYEDPA------MILALGFVLL 749
           ++I P+  N  E P        +LALG+V+L
Sbjct: 475 ERIGPA--NCLEWPTSDEHTNRVLALGYVML 503

 Score = 32.0 bits (71), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 33/123 (26%), Positives = 47/123 (38%), Gaps = 27/123 (21%)

Query: 21  DYDKRGFLDPHFSLIELLENAKYSLQENSNEATVTNVLQPDNPTSPLNEIRLELSGMNVD 80
           D ++R  LDPH S++ELL                    +P + T P   ++ E+S    D
Sbjct: 20  DIERRSILDPHLSVLELLR-------------------RPSD-TRPHEALKGEVS----D 55

Query: 81  DIXXXXXXXXXXXXXXXXXWQRIQTPDYSPLDVKDXXXXXXXXXXTVGILSSTDSSEEEQ 140
            +                 WQ I   D S L V              GILSS+D+SE+E 
Sbjct: 56  IVGNCAGTTGTGNGSISQSWQTIHRND-SCLSV--VPERCPSQATAAGILSSSDTSEDEP 112

Query: 141 DNI 143
           D +
Sbjct: 113 DAV 115

>Skud_9.22 Chr9 complement(51263..52876) [1614 bp, 537 aa] {ON}
           YIL146C (REAL)
          Length = 537

 Score =  137 bits (346), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 70/146 (47%), Positives = 98/146 (67%), Gaps = 2/146 (1%)

Query: 325 LTKSMTSSSNSFIMPKLSWTNTFRKFRILILGSNQNLTFYQNIPTSYKYLFELPPNNFDY 384
           +TKS+TSS+NSF+MPKLS +     FR+LILG   +  FYQ+IP  ++ LFELP  +   
Sbjct: 198 ITKSLTSSTNSFVMPKLSLSQKNPVFRLLILGRTGS-NFYQSIPKEHQSLFELPKYHDST 256

Query: 385 NFKHYAGIAIVIHDLTDFKSILNKIDKYSMNKKPIIPICEKGQINEVKNILKPYIKTKDL 444
            F  Y GI I+  +L +  S+LN+I +YS  K PIIPIC+ GQ  +VKN+LK +++ K +
Sbjct: 257 AFPQYTGIIIIFQELREMVSLLNRIVQYSQGK-PIIPICQPGQTIQVKNVLKSFLRNKLI 315

Query: 445 SLLYPPIVGTNRDGMNTLYLHLNDLS 470
            LLYPP+V TNR  +  ++  L DLS
Sbjct: 316 KLLYPPVVVTNRRDLKKMFQRLQDLS 341

 Score = 31.6 bits (70), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 8/23 (34%), Positives = 17/23 (73%)

Query: 616 WTVSLSVGVGLGFCLSYYASTIF 638
           W VS+++G+  G C++Y+A+  +
Sbjct: 401 WGVSITIGISFGCCVTYFATAAY 423

>TDEL0B02220 Chr2 complement(400065..401534) [1470 bp, 489 aa] {ON}
           Anc_5.699 YIL146C
          Length = 489

 Score =  122 bits (305), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 66/149 (44%), Positives = 99/149 (66%), Gaps = 2/149 (1%)

Query: 325 LTKSMTSSSNSFIMPKLSWTNTFRKFRILILGSNQNLTFYQNIPTSYKYLFELPPNNFDY 384
           LTKS+++SSNSF+MPKLS +    K RILILG    L FYQ+IP  Y++ FEL       
Sbjct: 167 LTKSLSNSSNSFVMPKLSLSQKSHKLRILILG-RPGLKFYQSIPKRYQHFFELSRLQDPS 225

Query: 385 NFKHYAGIAIVIHDLTDFKSILNKIDKYSMNKKPIIPICEKGQINEVKNILKPYIKTKDL 444
            F+ + GI IV  +L +  S+LN++ + +  + P+IP+C+ GQ  +V+N+L+  +K+K +
Sbjct: 226 EFRQFTGILIVFQELKEMVSLLNRVCQCAPTR-PVIPVCQTGQHQQVRNVLESLLKSKLI 284

Query: 445 SLLYPPIVGTNRDGMNTLYLHLNDLSKNV 473
           SLLYPP+V +N   +N +Y  L DLSK +
Sbjct: 285 SLLYPPVVISNHSDLNNMYRFLLDLSKTI 313

 Score = 55.5 bits (132), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 38/140 (27%), Positives = 67/140 (47%), Gaps = 21/140 (15%)

Query: 614 IYWTVSLSVGVGLGFCLSYYASTIFSNISESISKGINTLISESVTPTVSDTPIPSPTTYS 673
           I W +SL+VGVG+G+C+SY+AS+   ++S      IN            D      ++  
Sbjct: 367 IVWGISLTVGVGVGYCMSYFASSGLISMSAKSIASINGCRPNDNVVVFDD------SSLG 420

Query: 674 MEENLSTTCHYVGEKVKETFSNSLFLLKTTLRNLNWTTKQI----WNSPQGLNGVDQILP 729
           M E            ++  F+++L+LLK TL+  NW  KQ      + P+  +  +    
Sbjct: 421 MGE--------YDHDLENPFAHALYLLKQTLKQWNWAMKQFLMKHLHLPESSSSTNY--- 469

Query: 730 SKYNFYEDPAMILALGFVLL 749
            ++   ++   +LALG++LL
Sbjct: 470 KEWGAEDNSNRVLALGYILL 489

>CAGL0H06545g Chr8 (643447..644925) [1479 bp, 492 aa] {ON} similar
           to uniprot|P40458 Saccharomyces cerevisiae YIL146c ECM37
          Length = 492

 Score =  105 bits (261), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 54/141 (38%), Positives = 84/141 (59%), Gaps = 1/141 (0%)

Query: 336 FIMPKLSWTNTFRKFRILILGSNQNLTFYQNIPTSYKYLFELPPNNFDYNFKHYAGIAIV 395
           F+MPKLS T    + + L++    +  F+Q+IP  Y+  F +  ++    F++Y GI IV
Sbjct: 195 FVMPKLSLTYKPSQAKKLLVVGRLSKRFHQDIPREYRQYFHISQSSDPSEFQNYIGIVIV 254

Query: 396 IHDLTDFKSILNKIDKYSMNKKPIIPICEKGQINEVKNILKPYIKTKDLSLLYPPIVGTN 455
             +L +F ++LN+I +Y+ +KKPIIPIC+ GQ   VKNILK ++K   ++L YPP+   N
Sbjct: 255 FQELKEFVAMLNRIVQYT-DKKPIIPICQPGQRIRVKNILKSFLKNDAITLWYPPVTIAN 313

Query: 456 RDGMNTLYLHLNDLSKNVELE 476
              M  L+ H   L   +E E
Sbjct: 314 EKSMEKLFKHTVKLVNKLENE 334

>SAKL0E14850g Chr5 (1229975..1231387) [1413 bp, 470 aa] {ON} similar
           to uniprot|Q753M9 Ashbya gossypii AFR283W AFR283Wp and
           weakly similar to YIL146C uniprot|P40458 Saccharomyces
           cerevisiae YIL146C ECM37 Non-essential protein of
           unknown function
          Length = 470

 Score = 96.7 bits (239), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 48/158 (30%), Positives = 92/158 (58%), Gaps = 8/158 (5%)

Query: 321 NNLNLTKSMTSSSNSFIMPKLSWTNTFRKFRILILGSNQNLTFYQNIPTSYKYLFELPPN 380
           +N  +T S+ +SSNSF+MP+LS +    +F IL++G      F+ N+P  Y+ +F++   
Sbjct: 171 DNETVTVSLAASSNSFVMPQLSLSQRSHRFEILVVGKPAR-KFWNNVPKMYQKMFDI--G 227

Query: 381 NFDY----NFKHYAGIAIVIHDLTDFKSILNKIDKYSMNKKPIIPICEKGQINEVKNILK 436
           +F+        HY  + I+  D  +   IL+ +    ++ K IIPIC++GQ  ++ ++L+
Sbjct: 228 DFESISAPKVSHYTAVMIIFQDTKEVSFILDSL-VTKLDGKAIIPICQRGQKQQLASLLE 286

Query: 437 PYIKTKDLSLLYPPIVGTNRDGMNTLYLHLNDLSKNVE 474
           P++K K + L++ P V +N   ++ L  +L+ LS  ++
Sbjct: 287 PFVKAKKIRLMFQPTVMSNHQEIHKLLRYLHRLSTEID 324

 Score = 58.2 bits (139), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 41/129 (31%), Positives = 60/129 (46%), Gaps = 18/129 (13%)

Query: 15  SSSGSMDYDKRGFLDPHFSLIELLENAKYSLQENSNEATVTNVLQPDNPTSPLNEIRLEL 74
           S+SGSM + KR  LDPHFS+++LLE      +E+ N+A+              ++I +EL
Sbjct: 19  SASGSMPFQKRSILDPHFSVLQLLERNGCEQEEDVNQAS--------------SQIPVEL 64

Query: 75  SGMNVDDIXXXXXXXXXXXXXXXXXWQRIQTPDYSPLDVKDXXXXXXXXXXTVGILSSTD 134
                  +                 WQ I+  DYS L+              VGILSS+D
Sbjct: 65  KSAFNRPLSPHKRYPEALNQSISDSWQSIKMVDYSILN----SLHDTSSSQAVGILSSSD 120

Query: 135 SSEEEQDNI 143
           +SEEE D++
Sbjct: 121 TSEEELDHL 129

 Score = 32.7 bits (73), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 10/19 (52%), Positives = 16/19 (84%)

Query: 614 IYWTVSLSVGVGLGFCLSY 632
           + W +SL+VGVG+G C+S+
Sbjct: 355 VIWGLSLTVGVGIGCCISF 373

>KLTH0E01122g Chr5 complement(110889..112307) [1419 bp, 472 aa] {ON}
           weakly similar to uniprot|P40458 Saccharomyces
           cerevisiae YIL146C ECM37 Non-essential protein of
           unknown function
          Length = 472

 Score = 86.7 bits (213), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 52/160 (32%), Positives = 89/160 (55%), Gaps = 14/160 (8%)

Query: 321 NNLNLTKSMTSSSNSFIMPKLSWTNTFRKFRILILGSNQNLTFYQNIPTSYKYLFE---- 376
           +N  +T S+ +SSNSF+MPKLS     +KF ILI+G      FY++IP +Y  +FE    
Sbjct: 174 DNETVTMSLMNSSNSFVMPKLSLIQQSQKFCILIVGKPAQ-RFYRDIPRAYHKMFEVRDV 232

Query: 377 --LPPNNFDYNFKHYAGIAIVIHDLTDFKSILNKIDKYSMNKKPIIPICEKGQINEVKNI 434
             L P   +     Y+ + ++  +  + K +L K+  ++ N   II +C++GQ  ++ NI
Sbjct: 233 GHLSPREMN----KYSAVMVIFGEPKEGKELLEKVAAHNSN---IIAVCQRGQQQQISNI 285

Query: 435 LKPYIKTKDLSLLYPPIVGTNRDGMNTLYLHLNDLSKNVE 474
           L  Y K+ ++ L+Y   V ++   ++ L  +LN LS  V+
Sbjct: 286 LNRYSKSNEIRLVYHLTVMSDHQDVHRLLRYLNTLSTEVD 325

 Score = 34.7 bits (78), Expect = 0.99,   Method: Compositional matrix adjust.
 Identities = 10/17 (58%), Positives = 16/17 (94%)

Query: 614 IYWTVSLSVGVGLGFCL 630
           + W++SL+VGVGLG+C+
Sbjct: 357 VIWSISLTVGVGLGYCI 373

>Kwal_55.19716 s55 complement(93412..94815) [1404 bp, 467 aa] {ON}
           YIL146C (ECM37) - (putative) involved in cell wall
           biogenesis [contig 159] FULL
          Length = 467

 Score = 86.3 bits (212), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 52/158 (32%), Positives = 89/158 (56%), Gaps = 6/158 (3%)

Query: 321 NNLNLTKSMTSSSNSFIMPKLSWTNTFRKFRILILGSNQNLTFYQNIPTSYKYLFELP-P 379
           +N  +T S+ +SSNSF+MPKLS     RKF ILI+G      FY++IP +Y+ +FE+   
Sbjct: 167 DNETVTLSLINSSNSFVMPKLSLAQPLRKFSILIVGKPAQ-RFYRDIPRAYQKMFEVCDA 225

Query: 380 NNFD-YNFKHYAGIAIVIHDLTDFKSILNKIDKYSMNKKPIIPICEKGQINEVKNILKPY 438
            +F   +   ++ I ++  D  + +S+L  +   S N   II +C++GQ  ++ N+L  +
Sbjct: 226 ESFKTRDVDQFSAIMVIFTDPKNGQSLLEMVTGRSSN---IIAVCQRGQQQQISNLLNRF 282

Query: 439 IKTKDLSLLYPPIVGTNRDGMNTLYLHLNDLSKNVELE 476
            KT  L L+Y   V ++   ++ L  +L  LS  ++ E
Sbjct: 283 SKTHHLRLIYHLTVMSDHQDVHRLLRYLYTLSNEIDSE 320

 Score = 36.2 bits (82), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 12/26 (46%), Positives = 20/26 (76%)

Query: 614 IYWTVSLSVGVGLGFCLSYYASTIFS 639
           + W++SL+VGVG+G+C+S   S+  S
Sbjct: 350 VIWSISLTVGVGIGYCISCLLSSTMS 375

 Score = 33.1 bits (74), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 36/135 (26%), Positives = 56/135 (41%), Gaps = 31/135 (22%)

Query: 23  DKRGFLDPHFSLIELLENAKYSLQENSNEATVTNVLQPDNPTSPLNEIRLELSGMNVDDI 82
           ++   LDPH S+++LLE  +  +     E   +++  P      L+    E  G ++ D 
Sbjct: 27  NRNSILDPHLSVLQLLE--RNEVHSEPQEFRHSDIPSPHL----LSRSSSEPMGRSISD- 79

Query: 83  XXXXXXXXXXXXXXXXXWQRIQTPDYSPLDVKDXXXXXXXXXXTVGILSSTDSSEEEQDN 142
                            WQ I+  DYS L++              GILSS+D+SE+E D+
Sbjct: 80  ----------------SWQSIRHTDYSILNL-----IGETSHQPAGILSSSDTSEDEPDH 118

Query: 143 I---SLNTYLRVNSA 154
               S N Y   N A
Sbjct: 119 FLSPSPNEYAFANGA 133

>KAFR0D02250 Chr4 complement(455223..456893) [1671 bp, 556 aa] {ON}
           Anc_5.699 YIL146C
          Length = 556

 Score = 84.0 bits (206), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 48/142 (33%), Positives = 83/142 (58%), Gaps = 9/142 (6%)

Query: 336 FIMPKLSWTNTFRK------FRILILGSNQNLTFYQNIPTSYKYLFELPPNNFDYN-FKH 388
           FIMP+LS T   R+      FRILI+G   +   ++ IP  ++ LF+L   ++D N ++ 
Sbjct: 224 FIMPRLSLTKKERQQLNANEFRILIVGRLSS-KLFKMIPHKFQNLFQLQ-KSYDINEYQK 281

Query: 389 YAGIAIVIHDLTDFKSILNKIDKYSMNKKPIIPICEKGQINEVKNILKPYIKTKDLSLLY 448
           +  I +VI +  +  S+LN+I +    K+P+I ICEK    + KN+LK Y++   ++LLY
Sbjct: 282 FTAILVVIQETRELISLLNRISRSEKVKRPLIAICEKDAFLQCKNVLKSYLRNDLITLLY 341

Query: 449 PPIVGTNRDGMNTLYLHLNDLS 470
            P V +N + ++ + + L + S
Sbjct: 342 QPFVISNTEELDRMLVFLKETS 363

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 40/144 (27%), Positives = 72/144 (50%), Gaps = 33/144 (22%)

Query: 614 IYWTVSLSVGVGLGFCLSYYASTIFSNISESISKGINTLISESVTPTVSDTPIP-SPTTY 672
           I W +SLS+GVG+G+C+SY+ S+ +S++ +  +       S+S++ TV   P+P S  ++
Sbjct: 438 IIWGISLSIGVGIGYCISYFGSSPWSSLVQYFNPE-----SDSISATV---PVPLSNESF 489

Query: 673 SM---EENLSTTCHYVGEKVKETFSNSLFLLKTTLRNLNWTTKQIWNSPQG----LNGVD 725
            +    +N S T  Y        F  S+  LK ++  +    K     P      LNG++
Sbjct: 490 VLLHDSDNDSETKKY--------FFKSINFLKYSINKVKVIIKDTIRKPLNAFSYLNGLN 541

Query: 726 QILPSKYNFYEDPAMILALGFVLL 749
                     +D + +LALG++L+
Sbjct: 542 T---------DDASSLLALGYILI 556

>Ecym_4021 Chr4 complement(53316..54695) [1380 bp, 459 aa] {ON}
           similar to Ashbya gossypii AFR283W
          Length = 459

 Score = 75.5 bits (184), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 47/150 (31%), Positives = 83/150 (55%), Gaps = 7/150 (4%)

Query: 325 LTKSMTSSSNSFIMPKLSWTNTFRKFRILILGSNQNLTFYQNIPTSYKYLFELPP----N 380
           +T S+ ++  S +MPKLS ++   + ++LI+G      F+ +IP SY+ +FE+       
Sbjct: 162 VTVSLPNTMTSLVMPKLSLSDRIIESKVLIVGQPAR-KFWFSIPKSYQKMFEICSLSVLR 220

Query: 381 NFDYNFKHYAGIAIVIHDLTDFKSILNKIDKYSMNKKPIIPICEKGQINEVKNILKPYIK 440
           + D + K Y+ I ++ HD+     +L++I    +  + IIPIC+KGQ   + ++LK Y+ 
Sbjct: 221 DKDVDEK-YSTIMVIFHDMGLAPELLDRICNKVVRPR-IIPICQKGQKQHLSSLLKQYVS 278

Query: 441 TKDLSLLYPPIVGTNRDGMNTLYLHLNDLS 470
              + L   PIV +N    + L  HL+ LS
Sbjct: 279 GNRIKLFCNPIVMSNHHEKHRLLKHLHQLS 308

 Score = 40.4 bits (93), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 35/140 (25%), Positives = 57/140 (40%), Gaps = 28/140 (20%)

Query: 2   TEQLDANATGKSNSSSGSMDYDKRGFLDPHFSLIELLENAKYSLQENSNEATVTNVLQPD 61
            E++ +N   ++    G+    +R  LDPH S++E+LE  + +  E  +E +  +     
Sbjct: 5   VEKMQSNGHTQNGGLPGTT---QRSILDPHLSVLEILEGKELNKVEGPHELSGAS----- 56

Query: 62  NPTSPLNEIRLELSGMNVDDIXXXXXXXXXXXXXXXXXWQRIQTPDYSPLDVKDXXXXXX 121
                       +SG   +                   WQ I++ DY  L +        
Sbjct: 57  -----------RVSGKQFEG-------ERVLHHSISESWQSIKSTDY--LFLSRANDTSL 96

Query: 122 XXXXTVGILSSTDSSEEEQD 141
                VGILSS+D+SEEEQD
Sbjct: 97  QQQSAVGILSSSDTSEEEQD 116

 Score = 33.9 bits (76), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 10/26 (38%), Positives = 19/26 (73%)

Query: 614 IYWTVSLSVGVGLGFCLSYYASTIFS 639
           + WT S+++G+G+G C+S   ST ++
Sbjct: 345 VVWTASITIGIGIGCCVSLMVSTRYA 370

>AFR283W Chr6 (945526..946884) [1359 bp, 452 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL146C (ECM37)
          Length = 452

 Score = 73.9 bits (180), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 46/158 (29%), Positives = 79/158 (50%), Gaps = 13/158 (8%)

Query: 324 NLTKSMTSSSNSFIMPKLSWTNTFRKFRILILGSNQNLTFYQNIPTSYKYLFELP----P 379
            +T SM SSS S +MPKLS +    + ++L++G      F+  IP  Y+ LF++      
Sbjct: 154 TVTISMPSSSTSLVMPKLSLSQRLGEPQLLLVGQPAR-KFWLTIPKCYQKLFDVKNLGMV 212

Query: 380 NNFDYNFKHYAGIAIVIHDLTDFKSILNKIDKYSMNKKP---IIPICEKGQINEVKNILK 436
             +D   + Y  + +V HD+     +L+ +      K P   +IP+C+KGQ + +  +LK
Sbjct: 213 TRWDVG-QRYLAVMVVFHDIAQAPELLDGL----CEKAPCPTVIPVCQKGQKSTLAALLK 267

Query: 437 PYIKTKDLSLLYPPIVGTNRDGMNTLYLHLNDLSKNVE 474
            Y   K + +   PI+ +N    + L  HL++L    E
Sbjct: 268 RYTARKCIRVYCSPIIMSNHHEKHRLLKHLHNLCNESE 305

 Score = 35.0 bits (79), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 20/29 (68%)

Query: 616 WTVSLSVGVGLGFCLSYYASTIFSNISES 644
           WT S ++G+G+G C+S  A+T F+  S +
Sbjct: 339 WTASFTIGIGIGCCISLMATTRFTFFSSA 367

>NCAS0G00260 Chr7 complement(44445..45977) [1533 bp, 510 aa] {ON}
           Anc_5.699 YIL146C
          Length = 510

 Score = 72.4 bits (176), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 60/161 (37%), Positives = 91/161 (56%), Gaps = 13/161 (8%)

Query: 325 LTKSMTSSS---NSFIMP---KLSWTNTFRKFRILILGSNQNLTFYQNIPTSYKYLFELP 378
           +TKS+TSSS   NSF+MP     S  +  RKF+ILI G     +FY+ IP  Y+YLF +P
Sbjct: 154 ITKSLTSSSTISNSFVMPTLSLSSSQSQQRKFQILIFG-RLGPSFYRTIPKQYQYLFHVP 212

Query: 379 --PNNFDYN-FKHYAGIAIVIHDLTDFKSILNKIDKYSMNKK---PIIPICEKGQINEVK 432
              N    N   ++    I+  +L +  S+LN+I +    KK   PIIPIC+ GQ  +VK
Sbjct: 213 NQLNTLTRNEMDNFTAFLIIFEELKELVSLLNRISEELSFKKVPPPIIPICQPGQKIKVK 272

Query: 433 NILKPYIKTKDLSLLYPPIVGTNRDGMNTLYLHLNDLSKNV 473
           +ILK ++K   ++LL P I+  +   +  ++  +  +SK V
Sbjct: 273 SILKYFLKNNFVTLLSPIIIINDERALLKMFKTMQSISKTV 313

 Score = 33.9 bits (76), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 37/143 (25%), Positives = 62/143 (43%), Gaps = 22/143 (15%)

Query: 614 IYWTVSLSVGVGLGFCLSYYASTIFSNISESISKGINTLISESVTPTVSDTPIPSPTTYS 673
           + W++SL+VG G+G+ +SY    +F++           L  E +       P+ S     
Sbjct: 383 VVWSISLTVGAGMGYIISY---CVFNSSKR--------LPLEKIAHQTRPGPLSSLIHLK 431

Query: 674 MEENLSTTCHYVGEKVKETFSNSLF-----LLKTTLRNLNWTTKQIWNSPQGL--NGVDQ 726
             +NL     Y+       +S S F       K T+  LN T K+I   P  +  N +  
Sbjct: 432 SNKNL----LYLERTTPNDYSWSYFQNTWEFCKETVNQLNSTFKKIIRKPFAMFENLITT 487

Query: 727 ILPSKYNFYEDPAMILALGFVLL 749
            + SK   +++   ILAL ++LL
Sbjct: 488 TINSKDWKFDEQDRILALCYLLL 510

>KNAG0L02100 Chr12 (374542..375876) [1335 bp, 444 aa] {ON} Anc_5.699
           YIL146C
          Length = 444

 Score = 67.8 bits (164), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 36/151 (23%), Positives = 79/151 (52%), Gaps = 13/151 (8%)

Query: 336 FIMPKL-----------SWTNTFRKFRILILGSNQNLTFYQNIPTSYKYLFELPPNNFDY 384
           FIMPKL           S     R F++ +LG        + +P  +++ FEL     D 
Sbjct: 137 FIMPKLYTTVAGAPSTVSTALQTRCFKVAVLGRGAVKFCQETVPEQFRHRFELTAGVHDL 196

Query: 385 -NFKHYAGIAIVIHDLTDFKSILNKIDKYSMNKKPIIPICEKGQINEVKNILKPYIKTKD 443
                  GI IV+ ++ +  S+LN++   +  + P++ + ++ +  +VKN+L+ + + + 
Sbjct: 197 AQCADRQGILIVVQEVRELISLLNRV-HCACPEVPVVAVYDRDRQVQVKNVLRNFTRQRL 255

Query: 444 LSLLYPPIVGTNRDGMNTLYLHLNDLSKNVE 474
           +SLL+PP+  +N + ++ ++  +++L++  E
Sbjct: 256 VSLLHPPVPLSNNEALDKMFHFVDNLARQQE 286

>KLLA0A00660g Chr1 complement(64397..65971) [1575 bp, 524 aa] {ON}
           weakly similar to uniprot|P40458 Saccharomyces
           cerevisiae YIL146C ECM37 Non-essential protein of
           unknown function
          Length = 524

 Score = 60.8 bits (146), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 46/162 (28%), Positives = 81/162 (50%), Gaps = 8/162 (4%)

Query: 323 LNLTKSMTSSSNSFIMPKLSWTNTFRKFRILIL--GSNQNLTFYQNIPTSYKYLFELPPN 380
           +NL  S   S   F+MPKLS + + ++F+ILIL  G + N +FY  +   ++ +F++   
Sbjct: 215 VNLGHSWAGSF--FVMPKLSLSESMKRFKILILSDGDSAN-SFYNRLSRYHRLMFDVGKL 271

Query: 381 NFDYNFK--HYAGIAIVIHDLTDFKSILNKIDKYSMNKKPIIPICEKGQINEVKNILKPY 438
           N     +   Y    I+  D     +ILN++ K       +IPIC+KGQ   V   +K +
Sbjct: 272 NEASKEEALKYTAFMIIFSDSKKVTTILNRMWK-KYGDFTLIPICQKGQKQSVTEKVKTF 330

Query: 439 IKTKDLSLLYPPIVGTNRDGMNTLYLHLNDLSKNVELEITRD 480
             +  + L+  P+V ++   ++ L  HL+ L   V+ +   D
Sbjct: 331 ANSNKIKLMSYPVVISDHYEIHGLLRHLHSLYVEVDSDYETD 372

 Score = 33.5 bits (75), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 25/100 (25%), Positives = 46/100 (46%), Gaps = 10/100 (10%)

Query: 615 YWTVSLSVGVGLGFCLSYYASTIFSNISESISKGINTLISESVTPTVSDTPIPSPTTYSM 674
           +W +S+++GVG+G C+++Y S  F   S + S G+     + +   V      SP+    
Sbjct: 397 FWPISIALGVGIGCCVTFYFSK-FETSSYNSSVGVIQTADKEIDAIVDAIEGNSPSILE- 454

Query: 675 EENLSTTCHYVGEKVKETFSNSLFLLKTTLRNLNWTTKQI 714
           E +  +   ++G+  K        L+K T   +N   KQ 
Sbjct: 455 ESSPQSISDFLGQVCK--------LVKDTAIQINELLKQF 486

>CAGL0L09713g Chr12 (1045608..1046138) [531 bp, 176 aa] {ON} highly
           similar to uniprot|P30902 Saccharomyces cerevisiae
           YKL016c ATP7
          Length = 176

 Score = 30.8 bits (68), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 19/91 (20%), Positives = 38/91 (41%), Gaps = 7/91 (7%)

Query: 329 MTSSSNSFIMPKLSWTNTFRKFRILILGSNQNLTFYQNIPTSYKYLFELPPNNFDYNFKH 388
           M+ S  +    KL W       ++    + Q  TF +    + + LFEL     + +F H
Sbjct: 1   MSLSRTAAAANKLDWAKVISSLKLTGKTATQLSTFKKRNDEARRQLFELEQQPVEVDFAH 60

Query: 389 YAGIAIVIHDLTDFKSILNKIDKYSMNKKPI 419
           Y  +        +   +++KI++Y  +  P+
Sbjct: 61  YRSV-------LNNSEVVDKIERYVKSYSPV 84

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.313    0.130    0.373 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 66,232,124
Number of extensions: 2645573
Number of successful extensions: 8175
Number of sequences better than 10.0: 28
Number of HSP's gapped: 8368
Number of HSP's successfully gapped: 50
Length of query: 749
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 632
Effective length of database: 40,065,477
Effective search space: 25321381464
Effective search space used: 25321381464
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 70 (31.6 bits)