Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0E020707.353ON25225213280.0
KAFR0L015007.353ON2792875293e-66
NCAS0E028507.353ON2812934746e-58
ZYRO0F11770g7.353ON2722834623e-56
TDEL0C019507.353ON2732854451e-53
Kpol_530.287.353ON2742864391e-52
Skud_12.2637.353ON2742854311e-51
Suva_10.2947.353ON2752864312e-51
Smik_12.2587.353ON2742854302e-51
YLR199C (PBA1)7.353ON2762874251e-50
KNAG0B026007.353ON2792874261e-50
CAGL0A03993g7.353ON2722814162e-49
KLTH0H01188g7.353ON2672774093e-48
SAKL0F11440g7.353ON2722813876e-45
TPHA0F030007.353ON2822953861e-44
NDAI0E044507.353ON2212243462e-39
Kwal_56.246507.353ON2522503256e-36
KLLA0D12276g7.353ON2582722577e-26
Ecym_47207.353ON2612832096e-19
ACL145W7.353ON2341731514e-11
YNR021W6.320ON404117711.5
Kpol_1010.545.113ON183386702.6
KLTH0E14696g3.326ON384171683.2
ZYRO0E03014g1.467ON114871658.5
KAFR0D040701.55ON65159659.4
Smik_14.3516.320ON404112649.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0E02070
         (252 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0E02070 Chr5 (504410..504415,504472..505224) [759 bp, 252 aa...   516   0.0  
KAFR0L01500 Chr12 (275836..275841,275908..276741) [840 bp, 279 a...   208   3e-66
NCAS0E02850 Chr5 complement(560339..561178,561273..561278) [846 ...   187   6e-58
ZYRO0F11770g Chr6 (961232..961237,961318..962130) [819 bp, 272 a...   182   3e-56
TDEL0C01950 Chr3 complement(342242..343057,343116..343121) [822 ...   176   1e-53
Kpol_530.28 s530 complement(73093..73911,74024..74029) [825 bp, ...   173   1e-52
Skud_12.263 Chr12 complement(494506..495168,495169..495330) [825...   170   1e-51
Suva_10.294 Chr10 complement(520639..521304,521305..521466) [828...   170   2e-51
Smik_12.258 Chr12 complement(494861..495523,495524..495685) [825...   170   2e-51
YLR199C Chr12 complement(547853..548677,548764..548769) [831 bp,...   168   1e-50
KNAG0B02600 Chr2 complement(505952..506785,506899..506904) [840 ...   168   1e-50
CAGL0A03993g Chr1 (400841..400846,400992..401804) [819 bp, 272 a...   164   2e-49
KLTH0H01188g Chr8 complement(118222..119019,119088..119093) [804...   162   3e-48
SAKL0F11440g Chr6 (888319..888324,888382..889194) [819 bp, 272 a...   153   6e-45
TPHA0F03000 Chr6 (657195..657200,657311..658153) [849 bp, 282 aa...   153   1e-44
NDAI0E04450 Chr5 complement(1004080..1004745) [666 bp, 221 aa] {...   137   2e-39
Kwal_56.24650 s56 (1089568..1090326) [759 bp, 252 aa] {ON} YLR19...   129   6e-36
KLLA0D12276g Chr4 complement(1046970..1047737,1047816..1047824) ...   103   7e-26
Ecym_4720 Chr4 complement(1412286..1413065,1413130..1413135) [78...    85   6e-19
ACL145W Chr3 (93920..94624) [705 bp, 234 aa] {ON} Syntenic homol...    63   4e-11
YNR021W Chr14 (668377..669591) [1215 bp, 404 aa] {ON} Putative p...    32   1.5  
Kpol_1010.54 s1010 (122414..124918,125403..125411,126015..129002...    32   2.6  
KLTH0E14696g Chr5 (1307028..1308182) [1155 bp, 384 aa] {ON} high...    31   3.2  
ZYRO0E03014g Chr5 (230333..233779) [3447 bp, 1148 aa] {ON} simil...    30   8.5  
KAFR0D04070 Chr4 complement(802424..804379) [1956 bp, 651 aa] {O...    30   9.4  
Smik_14.351 Chr14 (626357..627571) [1215 bp, 404 aa] {ON} YNR021...    29   9.7  

>TBLA0E02070 Chr5 (504410..504415,504472..505224) [759 bp, 252 aa]
           {ON} Anc_7.353 YLR199C
          Length = 252

 Score =  516 bits (1328), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 252/252 (100%), Positives = 252/252 (100%)

Query: 1   MLFKQWDEWAEPRHHVDSLAAIPPNHRNADSLQEAPLPLVKVPDTLQDITIYEQIIVATR 60
           MLFKQWDEWAEPRHHVDSLAAIPPNHRNADSLQEAPLPLVKVPDTLQDITIYEQIIVATR
Sbjct: 1   MLFKQWDEWAEPRHHVDSLAAIPPNHRNADSLQEAPLPLVKVPDTLQDITIYEQIIVATR 60

Query: 61  VLMPLFPKEILNFTSLGNIEVKLNVSEATAHLVKTPIYKCNERTLIIIVDENVMQVCPIF 120
           VLMPLFPKEILNFTSLGNIEVKLNVSEATAHLVKTPIYKCNERTLIIIVDENVMQVCPIF
Sbjct: 61  VLMPLFPKEILNFTSLGNIEVKLNVSEATAHLVKTPIYKCNERTLIIIVDENVMQVCPIF 120

Query: 121 LNVISKTICTMFGNQLKFLIFGTSDRISKIKTINHLNCTLIPPEFITGFIGSIISDLSLT 180
           LNVISKTICTMFGNQLKFLIFGTSDRISKIKTINHLNCTLIPPEFITGFIGSIISDLSLT
Sbjct: 121 LNVISKTICTMFGNQLKFLIFGTSDRISKIKTINHLNCTLIPPEFITGFIGSIISDLSLT 180

Query: 181 ANSKFNGFLVPSEGPLGFEKLTLETMEFLIKEGGRIVKTIDSNLNLELYEKECYRNWRLT 240
           ANSKFNGFLVPSEGPLGFEKLTLETMEFLIKEGGRIVKTIDSNLNLELYEKECYRNWRLT
Sbjct: 181 ANSKFNGFLVPSEGPLGFEKLTLETMEFLIKEGGRIVKTIDSNLNLELYEKECYRNWRLT 240

Query: 241 GTTIGTQSGLYI 252
           GTTIGTQSGLYI
Sbjct: 241 GTTIGTQSGLYI 252

>KAFR0L01500 Chr12 (275836..275841,275908..276741) [840 bp, 279 aa]
           {ON} Anc_7.353 YLR199C
          Length = 279

 Score =  208 bits (529), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 121/287 (42%), Positives = 171/287 (59%), Gaps = 43/287 (14%)

Query: 1   MLFKQWDEWAEPRHHVDSLAAIPPNHRNADSLQEAPLPLVKVPDTLQDITIYEQIIVATR 60
           MLFKQW+E  EPRH +DS   +    +N +SLQE+PLP V++P T+ + + Y++II+ T+
Sbjct: 1   MLFKQWNELVEPRHQLDSPVIL----KNEESLQESPLPQVEIPSTV-NFSDYKKIILTTK 55

Query: 61  VLMPLFPKEILNFTSLGNIEVKLNVSE-----------------------------ATAH 91
           V+ PLFPK +L    LGNIE  L ++E                             AT +
Sbjct: 56  VMNPLFPKNLLKMEDLGNIETTLLLTESKMTDDEQNHYSWDFNENFPNEFNPSMESATGN 115

Query: 92  ---LVKTPIYKCNE-RTLIIIVDENVMQVCPIFLNVISKTICTMFGN-QLKFLIFGTSDR 146
                K PIY+ +   TL+I +DEN ++V PIFLN+ISK + +   N +   L+ G SD+
Sbjct: 116 NNFSFKFPIYRISSTDTLLISIDENFLKVSPIFLNLISKKLTSSINNDKSSILLLGASDK 175

Query: 147 ISK-IKTINHLNCTLIPPEFITGFIGSIISDLSLTANSKFNGFLVPSEGPLGFEKLTLET 205
           IS  IKT+ + NC++ PPEFITGFIGS++ +L       F   +VPSEGP+GFEKL+L T
Sbjct: 176 ISNNIKTVTNKNCSINPPEFITGFIGSLLYELLEIGTDNFECIIVPSEGPIGFEKLSLST 235

Query: 206 MEFLIKEGGRIVKTIDSNLNLELYEKECYRNWRLTGTTIGTQSGLYI 252
           ME LI    +    + S ++ + Y  EC+RNW+L G+   TQSGLYI
Sbjct: 236 MEELI---NQFFHELGSQMDFKTYYDECHRNWKLEGSATSTQSGLYI 279

>NCAS0E02850 Chr5 complement(560339..561178,561273..561278) [846 bp,
           281 aa] {ON} Anc_7.353 YLR199C
          Length = 281

 Score =  187 bits (474), Expect = 6e-58,   Method: Compositional matrix adjust.
 Identities = 109/293 (37%), Positives = 166/293 (56%), Gaps = 53/293 (18%)

Query: 1   MLFKQWDEWAEPRHHVDSLAAIPPNHRNADSLQEAPLPLVKVPD-TLQDITIYEQIIVAT 59
           MLFKQW+E+ EPRH +D     P   +N +SLQ +P+P V  P    Q+   YE+II+ T
Sbjct: 1   MLFKQWNEFIEPRHQLD----FPILSKNDESLQASPIPKVLFPSIAFQN---YEKIIITT 53

Query: 60  RVLMPLFPKEILNFTSLGNIEVKLNVSE-------------------------------- 87
           +++ PLFP++++   +LG IE +L ++E                                
Sbjct: 54  QLMNPLFPEKLIESKNLGKIETQLTLTEDQNAVNEDGHSWNFNENFPNEFDPDNEDRENQ 113

Query: 88  ATAHLVKTPIYKCNERTLIIIVDENVMQVCPIFLNVISKTICTMFGNQLKFLIFGTSDRI 147
             A   + P++    + +II + +N +++ PIF N+ISK +       +K LI G+SDRI
Sbjct: 114 QQAFNFEFPVFAVG-KVVIISIQDNFLKISPIFSNIISKKLIEQLPRTIKPLILGSSDRI 172

Query: 148 SKIKTINHLNCTLIPPEFITGFIGSIISDLSLTANS--------KFNGFLVPSEGPLGFE 199
           + +K IN   CTL+PPEFITGFI S++++L++   +        +F+  LVPSEGPLGFE
Sbjct: 173 ASVKEINDHTCTLVPPEFITGFIASLLTELTIHNETLQNGENKFQFDAILVPSEGPLGFE 232

Query: 200 KLTLETMEFLIKEGGRIVKTIDSNLNLELYEKECYRNWRLTGTTIGTQSGLYI 252
           KL L  ++ LI     + K    NL+ ++Y +E YRNW+L G+ +G QSGLYI
Sbjct: 233 KLNLTVIQDLID----LFKEEWPNLDPKVYAEESYRNWKLAGSVLGAQSGLYI 281

>ZYRO0F11770g Chr6 (961232..961237,961318..962130) [819 bp, 272 aa]
           {ON} weakly similar to uniprot|Q05778 Saccharomyces
           cerevisiae YLR199C Hypothetical ORF
          Length = 272

 Score =  182 bits (462), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 106/283 (37%), Positives = 157/283 (55%), Gaps = 42/283 (14%)

Query: 1   MLFKQWDEWAEPRHHVDSLAAIPPNHRNADSLQEAPLPLVKVPDTLQDITIYEQIIVATR 60
           MLFKQW+E AEPRHH+DS  A+  +    +SLQ+  LPLV++P+   +   + +I + T 
Sbjct: 1   MLFKQWNEIAEPRHHLDSPLAVGIDD---ESLQKGSLPLVELPNI--NWNKFHKIFLTTG 55

Query: 61  VLMPLFPKEILNFTSLGNIEVKLNVSEATAHLVKTPIYKCNER----------------- 103
           ++ PLFPKE+L    LG+I   L +     H      +   E                  
Sbjct: 56  IMDPLFPKELLGVMKLGDIRTTLTIDRNQQHENGEYSWNFEENFPNEVNLNGGQDNDDGQ 115

Query: 104 -------------TLIIIVDENVMQVCPIFLNVISKTICTMF-GNQLKFLIFGTSDRISK 149
                         L++ V EN ++V PI  N I++ + ++F G   +  + GTSDRI++
Sbjct: 116 SLTFVTTVEAFGDCLLVGVKENFLKVSPIIYNRIAQVLLSVFDGTHHELKVLGTSDRITE 175

Query: 150 IKTINHLNCTLIPPEFITGFIGSIISDLSLTANSKFNGFLVPSEGPLGFEKLTLETMEFL 209
           +K+I+HL   L PPEF+TGFIGSI++ L++  N  F GF+ PSEG +GFEK+++ TM  L
Sbjct: 176 LKSISHLRSDLQPPEFVTGFIGSILTQLTV-KNIPFEGFIAPSEGAIGFEKMSMNTMPEL 234

Query: 210 IKEGGRIVKTIDSNLNLELYEKECYRNWRLTGTTIGTQSGLYI 252
           I   G+ +     N N E Y  ECYR+WRL    +G+ SGLY+
Sbjct: 235 IDICGQWI-----NGNSEKYRSECYRHWRLDSGAVGSLSGLYV 272

>TDEL0C01950 Chr3 complement(342242..343057,343116..343121) [822 bp,
           273 aa] {ON} Anc_7.353 YLR199C
          Length = 273

 Score =  176 bits (445), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 108/285 (37%), Positives = 160/285 (56%), Gaps = 45/285 (15%)

Query: 1   MLFKQWDEWAEPRHHVDSLAAIPPNHRNADSLQEAPLPLVKVPDTLQDITIYEQIIVATR 60
           MLFKQW+E AEPRH +DS   I     N  +LQ + LP V +P    D+  + ++I+ + 
Sbjct: 1   MLFKQWNEIAEPRHQLDSPVII----ANEGTLQTSVLPQVTLPPI--DLQNFSRVILTSA 54

Query: 61  VLMPLFPKEILNFTSLGNIEVKLNVSE---ATAHLVKT------------PIYKCNE--- 102
           ++ PLFP+++L  T LG+++V L++S    A  H + +            P Y   E   
Sbjct: 55  IMNPLFPEKLLKSTILGDLKVILDLSSGKMALDHPMHSWNFDENFPNEVDPAYVVEERSK 114

Query: 103 ------------RTLIIIVDENVMQVCPIFLNVISKTICTMFGN---QLKFLIFGTSDRI 147
                       RTL+I V EN ++  PIFLN I+K++         + + ++ GTSD+I
Sbjct: 115 TFELCAPIVSFGRTLLISVKENFLKTSPIFLNQIAKSVVCKLAQGAFEGEVVVLGTSDQI 174

Query: 148 SKIKTINHLNCTLIPPEFITGFIGSIISDLSLTANSKFNGFLVPSEGPLGFEKLTLETME 207
           +++K ++    TL PPEF+T F+G++I+ L +  +  F G + PSEGP+GFEKL L TME
Sbjct: 175 TELKPVSDKETTLNPPEFVTSFVGAVITQL-IEKSLPFQGLIAPSEGPVGFEKLNLVTME 233

Query: 208 FLIKEGGRIVKTIDSNLNLELYEKECYRNWRLTGTTIGTQSGLYI 252
            LI    + V +     N E+Y  ECYR WRL G  +G QSGLYI
Sbjct: 234 ELITLCHQWVDS-----NKEIYRNECYRRWRLDGAALGAQSGLYI 273

>Kpol_530.28 s530 complement(73093..73911,74024..74029) [825 bp, 274
           aa] {ON} complement(73093..73911,74024..74029) [825 nt,
           275 aa]
          Length = 274

 Score =  173 bits (439), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 106/286 (37%), Positives = 158/286 (55%), Gaps = 46/286 (16%)

Query: 1   MLFKQWDEWAEPRHHVDSLAAIPPNHRNADSLQEAPLPLVKVPDTLQDITIYEQIIVATR 60
           MLFKQW+E+  PRH +DS    P   RN DSLQ   LP V +P+T  D++ Y+ +++ T+
Sbjct: 1   MLFKQWNEFVAPRHELDS----PIIARNDDSLQLLSLPEVHMPET--DLSKYKNVVLTTK 54

Query: 61  VLMPLFPKEILNFTSLGNIEVKL------NVSEATAHL---------------------- 92
           ++ PLFP ++L+   + +I   L      +V E+  H                       
Sbjct: 55  IMDPLFPSKLLSAEKIADITTTLKIDESQDVGESENHSWDYEENFPNEVGFKRDSNNRRL 114

Query: 93  --VKTPIYKCNERTLIIIVDENVMQVCPIFLNVISKTICTMF---GN-QLKFLIFGTSDR 146
               +PI+   + T+II+++EN +++  IF NVI++ +       GN  L F+  GTSDR
Sbjct: 115 LSFSSPIFAFKD-TIIIMIEENFIKMSAIFSNVIAEQVINHLLINGNPDLNFIAIGTSDR 173

Query: 147 ISKIKTINHLNCTLIPPEFITGFIGSIISDLSLTANSKFNGFLVPSEGPLGFEKLTLETM 206
           I  IK +   +C+L PPEF+TGFIGSI++ L     + F G L PSEGP+GFEK+TL+ +
Sbjct: 174 ILNIKKLTQDHCSLEPPEFVTGFIGSILTQLISKEVNVFTGILAPSEGPIGFEKMTLDVI 233

Query: 207 EFLIKEGGRIVKTIDSNLNLELYEKECYRNWRLTGTTIGTQSGLYI 252
           + LI     ++     ++    Y  +C R WRL G  IG QSGLYI
Sbjct: 234 KELIDICQELL-----DIKSTEYSVDCQRMWRLDGAAIGAQSGLYI 274

>Skud_12.263 Chr12 complement(494506..495168,495169..495330) [825
           bp, 274 aa] {ON} YLR199C (REAL)
          Length = 274

 Score =  170 bits (431), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 102/285 (35%), Positives = 150/285 (52%), Gaps = 46/285 (16%)

Query: 3   FKQWDEWAEPRHHVDSLAAIPPNHRNADSLQEAPLPLVKVPDTLQDITIYEQIIVATRVL 62
           FKQW++  EPRH +D     P   +N  SL+  P+P V++P  L +++ Y  +I+ T+++
Sbjct: 1   FKQWNDLPEPRHQLD----FPEISKNLQSLEFCPIPRVELPQDL-NVSQYSTVIITTKIM 55

Query: 63  MPLFPKEILNFTSLGNIEVKLNV--------------------------------SEATA 90
            PLFPK +L  TS+G ++  L V                                S+ T 
Sbjct: 56  NPLFPKNLLQLTSIGEVKSSLTVKNSSPTQSTDAYSWNYDENFPNEVDPISESETSKETQ 115

Query: 91  HLVKTPIYKCNERTLIIIVDENVMQVCPIFLNVISKTICT-MFGNQLKFLIFGTSDRISK 149
           +    PIY   E TL+  ++EN + + PIF N+IS++I + +       ++ G+SDRIS 
Sbjct: 116 YNFSFPIYSFGE-TLLFSIEENFINISPIFGNMISRSIVSQLIKTSPDIIVIGSSDRISN 174

Query: 150 IKTINHLNCTLIPPEFITGFIGSIISDLSLTANS--KFNGFLVPSEGPLGFEKLTLETME 207
           +K +    CTL PPEFITGFIGS+++ L +  N    F   +VPSEGP GFEK++L  M 
Sbjct: 175 MKKMTKSECTLQPPEFITGFIGSVLTQLIIGENKGMNFKCLIVPSEGPNGFEKISLSDMG 234

Query: 208 FLIKEGGRIVKTIDSNLNLELYEKECYRNWRLTGTTIGTQSGLYI 252
            LI    + +       +   Y +ECYR WR     IG QSGLYI
Sbjct: 235 SLIDVCSQWL-----GFDHSKYSQECYRLWRCDSAAIGAQSGLYI 274

>Suva_10.294 Chr10 complement(520639..521304,521305..521466) [828
           bp, 275 aa] {ON} YLR199C (REAL)
          Length = 275

 Score =  170 bits (431), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 104/286 (36%), Positives = 150/286 (52%), Gaps = 47/286 (16%)

Query: 3   FKQWDEWAEPRHHVDSLAAIPPNHRNADSLQEAPLPLVKVPDTLQDITIYEQIIVATRVL 62
           FKQW++  EPRH +D     P   +N  SL+  P+P V++P  L D++ Y ++++ T+++
Sbjct: 1   FKQWNDLPEPRHQLD----FPEISKNLQSLEVCPVPKVELPQDL-DVSQYSRVVITTKIM 55

Query: 63  MPLFPKEILNFTSLGNIEVKLNV---------------------------------SEAT 89
            PLFPK +L   S+G I+  L V                                 +E T
Sbjct: 56  NPLFPKNLLKLISIGEIKTSLMVKELNPIQPTDAHSWNYDENFPNEINPNSRTATSNEET 115

Query: 90  AHLVKTPIYKCNERTLIIIVDENVMQVCPIFLNVISKTICT-MFGNQLKFLIFGTSDRIS 148
            +    PIY    +TL+  ++EN + + PIF N+IS++I + +       +I GTSDRIS
Sbjct: 116 LYNFSFPIYSFG-KTLLFSIEENFINISPIFGNMISRSIASQLVKTSPDVIIIGTSDRIS 174

Query: 149 KIKTINHLNCTLIPPEFITGFIGSIISDLSLTANS--KFNGFLVPSEGPLGFEKLTLETM 206
            +K +    CTL PPEF+TGFIGS+++ L   AN   KF   +VPSEGP GFEK +L  M
Sbjct: 175 NMKIMTEDECTLQPPEFVTGFIGSVLTQLITGANKGMKFKCLVVPSEGPNGFEKFSLSDM 234

Query: 207 EFLIKEGGRIVKTIDSNLNLELYEKECYRNWRLTGTTIGTQSGLYI 252
             LI    +        L+   Y +EC+R WR     IG QSGLYI
Sbjct: 235 GSLIDVCSQWF-----GLDHSKYSEECHRLWRCDSAAIGAQSGLYI 275

>Smik_12.258 Chr12 complement(494861..495523,495524..495685) [825
           bp, 274 aa] {ON} YLR199C (REAL)
          Length = 274

 Score =  170 bits (430), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 102/285 (35%), Positives = 152/285 (53%), Gaps = 46/285 (16%)

Query: 3   FKQWDEWAEPRHHVDSLAAIPPNHRNADSLQEAPLPLVKVPDTLQDITIYEQIIVATRVL 62
           FKQW+E  EPRH +D     P   +N  SL+  P+P V++P  L D++ Y  +++ T+++
Sbjct: 1   FKQWNEIPEPRHLLD----FPEISKNLHSLEACPVPKVELPQDL-DVSQYSTVVITTKIM 55

Query: 63  MPLFPKEILNFTSLGNIEVKLNV--------------------------------SEATA 90
            PLFPK +L   ++G IE  L V                                S+ T 
Sbjct: 56  NPLFPKNLLQLIAVGKIETTLTVVNSGSVQSTGDHSWNFDENFPNEVDPVPRGAMSDETK 115

Query: 91  HLVKTPIYKCNERTLIIIVDENVMQVCPIFLNVISKTICT-MFGNQLKFLIFGTSDRISK 149
           +    PIY    +TL+  ++EN + + PIF N+IS+ I + +  +  + ++ GTSD+I+ 
Sbjct: 116 YDFSFPIYSFG-KTLLFSIEENFLSISPIFGNMISRCIVSRLVESSPEIIVIGTSDKIAN 174

Query: 150 IKTINHLNCTLIPPEFITGFIGSIISDLSLTANS--KFNGFLVPSEGPLGFEKLTLETME 207
           +K +    C+L PPEFITGFIGS+++ L    N   KF   +VPSEGP G+EKL+L  M 
Sbjct: 175 MKVMTKDECSLKPPEFITGFIGSVLTQLVGGVNKGMKFKCLVVPSEGPNGYEKLSLSDMG 234

Query: 208 FLIKEGGRIVKTIDSNLNLELYEKECYRNWRLTGTTIGTQSGLYI 252
            L+   G+ +    S+     Y +ECYR WR     IG QSGLYI
Sbjct: 235 SLVSLCGQWLGFDHSS-----YHEECYRLWRCDSAAIGAQSGLYI 274

>YLR199C Chr12 complement(547853..548677,548764..548769) [831 bp,
           276 aa] {ON}  PBA1Protein involved in 20S proteasome
           assembly; forms a heterodimer with Add66p that binds to
           proteasome precursors; similar to human PAC1 constituent
           of the PAC1-PAC2 complex involved in proteasome assembly
          Length = 276

 Score =  168 bits (425), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 101/287 (35%), Positives = 149/287 (51%), Gaps = 46/287 (16%)

Query: 1   MLFKQWDEWAEPRHHVDSLAAIPPNHRNADSLQEAPLPLVKVPDTLQDITIYEQIIVATR 60
           MLFKQW++  EP+H +D    +P   +N  SL+  P+P V+ P  L D+  Y   ++ T+
Sbjct: 1   MLFKQWNDLPEPKHLLD----LPEISKNLQSLEVCPVPKVEFPQDL-DVPQYSTAVITTK 55

Query: 61  VLMPLFPKEILNFTSLGNIEVKLNV--------------------------------SEA 88
           ++ PLFPK +L  TS+G I+  L V                                ++ 
Sbjct: 56  IMNPLFPKNLLQLTSIGEIKTTLTVKSPSLPQSSGKHSWNYDENFPNEVDPDQKNDTADE 115

Query: 89  TAHLVKTPIYKCNERTLIIIVDENVMQVCPIFLNVISKTICTMFGN-QLKFLIFGTSDRI 147
           T +    PIY    +TL+  ++EN + + PIF N+IS++I +         ++ GTSD+I
Sbjct: 116 TVYGFSFPIYSFG-KTLLFSMEENFISISPIFGNMISRSIISQLAQFSPDIIVIGTSDKI 174

Query: 148 SKIKTINHLNCTLIPPEFITGFIGSIISDLSLTANS--KFNGFLVPSEGPLGFEKLTLET 205
           + +K +    CTL PPEFITGFIGS+++ L +  +   KF   + PSEGP GFEKL+L  
Sbjct: 175 ASMKVMTENECTLQPPEFITGFIGSVLTQLIVGPSKGLKFKCLVAPSEGPNGFEKLSLSD 234

Query: 206 MEFLIKEGGRIVKTIDSNLNLELYEKECYRNWRLTGTTIGTQSGLYI 252
           M  L+   G+ +           Y +ECYR WR     IG QSGLYI
Sbjct: 235 MGSLVDLCGQWL-----GFEPSRYSEECYRLWRCDSAAIGAQSGLYI 276

>KNAG0B02600 Chr2 complement(505952..506785,506899..506904) [840 bp,
           279 aa] {ON} Anc_7.353 YLR199C
          Length = 279

 Score =  168 bits (426), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 106/287 (36%), Positives = 153/287 (53%), Gaps = 43/287 (14%)

Query: 1   MLFKQWDEWAEPRHHVDSLAAIPPNHRNADSLQEAPLPLVKVPDTLQDITIYEQIIVATR 60
           MLFK W+E+ EPRHH+D+   +P    N +SLQ  PLP V VP    D           +
Sbjct: 1   MLFKHWNEFVEPRHHLDAPVMVP----NQESLQALPLPTVTVPAGF-DWGKVRDCDPDHK 55

Query: 61  VLMPLFPKEILNFTSLGNI--EVKLN---VSEATAHL----------------------- 92
           ++ PLF     +  + G +   ++LN   VS+A   L                       
Sbjct: 56  IMNPLFNTSHTHAMTRGELVTSLQLNESVVSQAATELSQHWDYRENFPNEFDPASDTRED 115

Query: 93  -----VKTPIYKCNE-RTLIIIVDENVMQVCPIFLNVISKTICTMFGNQLKFLIFGTSDR 146
                ++ PI + N   TL+I VDEN ++V PIF NV+++ + T+   Q K L+ G+SD+
Sbjct: 116 TKSIVLRLPIVELNGMNTLLISVDENFLKVSPIFTNVVARKLRTLLNTQTKILLVGSSDK 175

Query: 147 ISKIKTINHLNCTLIPPEFITGFIGSIISDLSLTANSKFNGFLVPSEGPLGFEKLTLETM 206
           I   K ++   CTL PPEFITGF+G +I +L     S F GF+V SEGP GFEKL+LE+M
Sbjct: 176 IYSTKMVSLNECTLQPPEFITGFLGGMIDELVKNRFSNFKGFIVQSEGPTGFEKLSLESM 235

Query: 207 EFLIKEGGRIVKTIDS-NLNLELYEKECYRNWRLTGTTIGTQSGLYI 252
           + LI     I+    S N+N + + + C++ W+L G  +  QSGLYI
Sbjct: 236 DELID---FIIDEWSSYNINADAFRENCHKLWKLDGAAMSAQSGLYI 279

>CAGL0A03993g Chr1 (400841..400846,400992..401804) [819 bp, 272 aa]
           {ON} similar to uniprot|Q05778 Saccharomyces cerevisiae
           YLR199c
          Length = 272

 Score =  164 bits (416), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 99/281 (35%), Positives = 147/281 (52%), Gaps = 38/281 (13%)

Query: 1   MLFKQWDEWAEPRHHVDSLAAIPPNHRNADSLQEAPLPLVKVPDTLQDITIYEQIIVATR 60
           MLFKQW+E +EPR+H+D+    P    N +SLQ  PLP V +PD L +    +++I+ T+
Sbjct: 1   MLFKQWNELSEPRNHLDA----PNLVNNTESLQLLPLPDVHIPDELFEGGNVKRVILTTK 56

Query: 61  VLMPLF-------PKEILNFTSLGNIEVKLNVSEAT----------------------AH 91
            +   F        K++ + T    I   L   EAT                        
Sbjct: 57  TMDTFFLLDKTMKVKKLADITCSLEIPKNLQTHEATHTWDFGENFPNEVEPLQDEEQRTF 116

Query: 92  LVKTPIYKCNERTLIIIVDENVMQVCPIFLNVISKTICTMFGNQLKFLIFGTSDRISKIK 151
            ++ PIY   ++TL + +DEN + V PIF   IS  I        + +I G SDRI   K
Sbjct: 117 SLRFPIYLLEDQTLYVSIDENFLTVSPIFTAQISDVISKKLNRGHEIVILGCSDRIEDTK 176

Query: 152 TINHLNCTLIPPEFITGFIGSIISDLSLTANSKFNGFLVPSEGPLGFEKLTLETMEFLIK 211
              + NC+L+PPEF+TGF+GS++SDL+ T +  F   + PSEGP GFEKL+  T++ +I 
Sbjct: 177 ICTNNNCSLVPPEFVTGFLGSLMSDLTKTNDQLFTAAIFPSEGPQGFEKLSSTTVDSIID 236

Query: 212 EGGRIVKTIDSNLNLELYEKECYRNWRLTGTTIGTQSGLYI 252
              ++V T  S      Y +ECY+ W+   ++ G QSGLY+
Sbjct: 237 FCSQLVSTDKSR-----YTEECYKRWKRNASSNGAQSGLYL 272

>KLTH0H01188g Chr8 complement(118222..119019,119088..119093) [804
           bp, 267 aa] {ON} similar to uniprot|Q05778 Saccharomyces
           cerevisiae YLR199C Hypothetical ORF
          Length = 267

 Score =  162 bits (409), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 98/277 (35%), Positives = 149/277 (53%), Gaps = 35/277 (12%)

Query: 1   MLFKQWDEWAEPRHHVDSLAAIPPNHRNADSLQEAPLPLVKVPDTLQDITIYEQIIVATR 60
           MLFKQW+E++EPRHH+D  A +  N  + DSLQ APLP V +   + D   +++  + T 
Sbjct: 1   MLFKQWNEYSEPRHHLD--APLEEN-TDLDSLQPAPLPEVMLEKPI-DTAGFKRAFIVTN 56

Query: 61  VLMPLFPKEILNFTSLGNIEVKLNVSEATAHLVKT-------------------PIYKCN 101
           +   LF   +     + +  V         HL +                    P++K +
Sbjct: 57  IFRSLFEDRLARAEQISSFVVVWQTKGREQHLYREDYQTQEDSRSTDETKRLEFPVHKLD 116

Query: 102 ERTLIIIVDENVMQVCPIFLNVISKTICTMFGNQLKFLIFGTSDRISKIKTINHLNCT-- 159
           + TL I V E+ + V PI +N++S+ I  + G  L+ L+FG+SDR+ ++K +        
Sbjct: 117 DGTLFICVREDFLHVPPISINLLSREIAKLCGG-LEVLLFGSSDRVERVKYVGFPGNVGK 175

Query: 160 ----LIPPEFITGFIGSIISDLSLTANSKFNGFLVPSEGPLGFEKLTLETMEFLIKEGGR 215
               L PPE IT F  SI++ L L+   +F+G++ PSEGP G+EKL++ETM+ LI     
Sbjct: 176 GLPLLTPPELITNFTASIMTQL-LSNKVRFDGYVAPSEGPSGYEKLSMETMDLLIDLCWS 234

Query: 216 IVKTIDSNLNLELYEKECYRNWRLTGTTIGTQSGLYI 252
            V+      N E Y K C+RNWRL GT +G Q+GLY+
Sbjct: 235 EVRFG----NREDYVKSCHRNWRLNGTVMGAQTGLYL 267

>SAKL0F11440g Chr6 (888319..888324,888382..889194) [819 bp, 272 aa]
           {ON} similar to uniprot|Q05778 Saccharomyces cerevisiae
           YLR199c
          Length = 272

 Score =  153 bits (387), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 103/281 (36%), Positives = 154/281 (54%), Gaps = 38/281 (13%)

Query: 1   MLFKQWDEWAEPRHHVDSLAAIPPNHRNADSLQEAPLPLVKVPDTLQDITIYEQIIVATR 60
           MLFK W+E AEPRH +D+  A  PN  N +SLQ+ PLP V + + + DI+ + QI++ T+
Sbjct: 1   MLFKHWNEQAEPRHQLDTPYA--PN-VNYESLQKTPLPTVILTEPI-DISQFNQIVLCTK 56

Query: 61  VLMPLFPKEILNFTSLGNIEVKLNVSEAT---AH----------------------LVKT 95
           VL PLFP  I   T++   +V +         AH                      +V  
Sbjct: 57  VLRPLFPSTICPMTTISEFQVTIPPQPTAIKKAHGSSYGDEDYEQESLPDKKPEEIIVSF 116

Query: 96  PIYKCNERTLIIIVDENVMQVCPIFLNVISKTICTMFG--NQLKFLIFGTSDRISKIKTI 153
            + K N+  L I ++EN + V PI  N++S+ I  +    N L+ ++ GTSDRI+ +K++
Sbjct: 117 QVEKFND-ILFICIEENFLHVSPIAWNLLSQQIIRLCKSKNTLQTIVLGTSDRITTLKSV 175

Query: 154 NHLNC--TLIPPEFITGFIGSIISDLSLTANSKFNGFLVPSEGPLGFEKLTLETMEFLIK 211
                   L PPEF+T    S+I+ L L  +  F   + PSEGP GFEKL+L +M+ L +
Sbjct: 176 GSTLGLPDLEPPEFVTNCTASLITTLIL-HDLPFKSLIAPSEGPSGFEKLSLVSMDQLAE 234

Query: 212 EGGRIVKTIDSNLNLELYEKECYRNWRLTGTTIGTQSGLYI 252
               +VK ++   N+  Y +EC+R WRL GT +G Q+GLYI
Sbjct: 235 SCFELVKPVE---NVSSYIEECHRAWRLQGTAMGAQTGLYI 272

>TPHA0F03000 Chr6 (657195..657200,657311..658153) [849 bp, 282 aa]
           {ON} Anc_7.353 YLR199C
          Length = 282

 Score =  153 bits (386), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 101/295 (34%), Positives = 153/295 (51%), Gaps = 56/295 (18%)

Query: 1   MLFKQWDEWAEPRHHVDSLAAIPPNHRNADSLQEAPLPLVKVPD-TLQDITIYEQIIVAT 59
           MLFKQW++ AEPRH + S    P    N +SLQ   +P V + +   +D   +E +IV T
Sbjct: 1   MLFKQWNDLAEPRHQLMS----PSLSTNIESLQLQNIPEVSMTNLKYED---FENVIVTT 53

Query: 60  RVLMPLFPKEILNFTSLGN--------------------------------------IEV 81
           + +  LFP + LN T +G                                       IE 
Sbjct: 54  KTMNALFPNKTLNLTKVGELSSSLVLNENEKVPTAEHYSWDYKENFPNEVDIYSQEAIES 113

Query: 82  KLNVSEATAHLVKTPIYKCNERTLIIIVDENVMQVCPIFLNV----ISKTICTMFGNQLK 137
           ++  +E+  +  + PI    ++TL+I ++EN +++ PIF N+    I K I T   + + 
Sbjct: 114 EIGSNESKKYNFQIPIM-AYDKTLLISIEENFIKMSPIFSNLTAEKILKVILTFCNSNIG 172

Query: 138 FLIFGTSDRISKIKTINHLNCTLIPPEFITGFIGSIISDLSLTANSKFNGFLVPSEGPLG 197
            L  GTSDR++ I+ +   N TL+ PEFITGF+GS IS L +     +   +VPSEGP+G
Sbjct: 173 ILTLGTSDRVAAIRKLTPENSTLVAPEFITGFVGSFISQLVILEVPNYKAVIVPSEGPIG 232

Query: 198 FEKLTLETMEFLIKEGGRIVKTIDSNLNLELYEKECYRNWRLTGTTIGTQSGLYI 252
           FEKL++ET+  LI     I K  + N+N   Y  E +R W++ G+ +G Q+GLYI
Sbjct: 233 FEKLSIETISELID----ICKE-NLNINDPKYSNESHRLWKVAGSAMGAQTGLYI 282

>NDAI0E04450 Chr5 complement(1004080..1004745) [666 bp, 221 aa] {ON}
           Anc_7.353 YLR199C
          Length = 221

 Score =  137 bits (346), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 85/224 (37%), Positives = 124/224 (55%), Gaps = 40/224 (17%)

Query: 64  PLFPKEILNFTSLGNIEVKLNV--------------------------------SEATAH 91
           PLFP+++L   S+ NI   L +                                S   ++
Sbjct: 3   PLFPEDLLPLVSVSNISTTLTLNPDQLMGNEGKHSWNYNENFPNEFDPSDKDMKSSEKSY 62

Query: 92  LVKTPIYKCNERTLIIIVDENVMQVCPIFLNVISKTICTMFGNQLKFLIFGTSDRISKIK 151
               PI+   +RTL+I + EN +++ PIF NVIS+T+        + LI GTSDR++ ++
Sbjct: 63  DFNFPIFAI-DRTLVISIQENFLKISPIFSNVISQTLVQALPLNKEILILGTSDRVAVMR 121

Query: 152 TINHLNCTLIPPEFITGFIGSIISDLSL-TANSKFNGFLVPSEGPLGFEKLTLETMEFLI 210
            I++   TL PPEF+TGFIGS+I++L+L  A   F+  +VPSEGP GFEKL L  M+ LI
Sbjct: 122 KISNEIDTLEPPEFVTGFIGSLITELNLHNAKYNFDAIIVPSEGPTGFEKLNLTIMQDLI 181

Query: 211 KEGGRIVKTIDSNLNLE--LYEKECYRNWRLTGTTIGTQSGLYI 252
                I K   + LN++  +Y ++CYR+W+L G  IG QSGLYI
Sbjct: 182 D----IFKNEWNYLNIDSKVYTEQCYRHWKLAGAAIGAQSGLYI 221

>Kwal_56.24650 s56 (1089568..1090326) [759 bp, 252 aa] {ON} YLR199C
           - Hypothetical ORF [contig 161] FULL
          Length = 252

 Score =  129 bits (325), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 84/250 (33%), Positives = 135/250 (54%), Gaps = 32/250 (12%)

Query: 28  NADSLQEAPLPLVKVPDTLQDITIYEQIIVATRVLMPLFPKEILNFTSLGNIEVKLNVSE 87
           +++SLQ APLP V++ + L+  + ++++ + T +   LF  ++ +   +   EVK     
Sbjct: 10  DSNSLQLAPLPEVRLTEPLKSNS-FKRVFIITEIFRSLFVGKLAHAEQISTFEVKWQTKG 68

Query: 88  ATAHLVKT-------------------PIYKCNERTLIIIVDENVMQVCPIFLNVISKTI 128
              HL +                    P+ K +E T ++ V E+ + V PI  N++S+ +
Sbjct: 69  REQHLYREDFQVQEDCTKENESCGLSIPVLKIDEDTFLLCVAEDFLHVPPIVGNLLSQEM 128

Query: 129 CTMFGNQLKFLIFGTSDRISKIKTI----NHLNCT--LIPPEFITGFIGSIISDLSLTAN 182
             +  + L+ L+ GTSDRI ++K +    N  N    L PPE IT F  SI + L L   
Sbjct: 129 AKLCRD-LRVLVIGTSDRIEEVKYVGSAQNGRNGVPPLTPPELITSFTASITTQL-LLCK 186

Query: 183 SKFNGFLVPSEGPLGFEKLTLETMEFLIKEGGRIVKTIDSNLNLELYEKECYRNWRLTGT 242
             F+G++ PSEGP G+EKL++ETM+ LI     +  +  S  N + Y KE +RNWRL GT
Sbjct: 187 VPFDGYVAPSEGPSGYEKLSMETMDKLID----LCWSEISTGNRDEYVKETHRNWRLHGT 242

Query: 243 TIGTQSGLYI 252
           + GTQ+GLY+
Sbjct: 243 STGTQTGLYL 252

>KLLA0D12276g Chr4 complement(1046970..1047737,1047816..1047824)
           [777 bp, 258 aa] {ON} similar to uniprot|Q05778
           Saccharomyces cerevisiae YLR199C Hypothetical ORF
          Length = 258

 Score =  103 bits (257), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 83/272 (30%), Positives = 124/272 (45%), Gaps = 35/272 (12%)

Query: 1   MLFKQWDEWAEPRHHVDSLAAIPPNHRNADSLQEAPLPLVKVPDTLQDITIYEQIIVATR 60
           + FKQW     PRH +D +    P      SL     P V +     DI+ Y   IV   
Sbjct: 2   LTFKQWQNDQVPRHQIDPVVQSDPY-----SLVNKTTPTVTIEPESLDISPYNHCIVLPT 56

Query: 61  VLMPLFPKEILNFTSLGNIEVKL-NVSEATAHLVKTPIYKCNER---------------- 103
            L  L PK I+N   +G I   L N++E  +      +Y   E                 
Sbjct: 57  SLKWLLPKSIINLVHIGIISGTLSNMNEWESMKPVPGMYDTEEHMINSTEQFVIHYNLWR 116

Query: 104 ---TLIIIVDENVMQVCPIFLNVISKTICTMFGNQLKFLIFGTSDRISKIKTINHLNCTL 160
              TLI I+DEN ++   I  N +++ +  +  +     I   SD+I+++K +++L    
Sbjct: 117 LEDTLIAIIDENEVKYPAIVTNFMTRNLAQLLRDIKDITILVNSDKITELKQLSYL---- 172

Query: 161 IPPEFITGFIGSIISDLSLTANSKFNGFLVPSEGPLGFEKLTLETMEFLIKEGGRIVKTI 220
           +PPEFITG I + I  L      +    +VPSEGP+GFEK    T++ L+ E  +++ + 
Sbjct: 173 VPPEFITGSITNFILAL---PRKELKVIVVPSEGPIGFEKYNFPTVDALVDEMSKLLCSY 229

Query: 221 DSNLNLELYEKECYRNWRLTGTTIGTQSGLYI 252
            S    E Y  EC + W+L   T  TQ GLYI
Sbjct: 230 PS--QTEYYVSECLKLWKLDECT-TTQGGLYI 258

>Ecym_4720 Chr4 complement(1412286..1413065,1413130..1413135) [786
           bp, 261 aa] {ON} similar to Ashbya gossypii ACL145W
           1-intron
          Length = 261

 Score = 85.1 bits (209), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 73/283 (25%), Positives = 129/283 (45%), Gaps = 53/283 (18%)

Query: 1   MLFKQWDEWAEPRHHVDSLAAIPPNHRNADSLQEAPLPLVKVPDTLQDITIYEQIIVATR 60
           M+FKQW+    PRH V S+ +  P      SL  +P P++ + + +     YE+ I    
Sbjct: 1   MIFKQWEFDRIPRHQVQSINSADPT-----SLLLSPEPVITLDNDIN--KGYEKAIALPS 53

Query: 61  VLMPLFPKEILNFTSLG--------------------------NIEVKLNVSEATAHLVK 94
            L  L P ++++F  +                            ++VK +  E  A    
Sbjct: 54  SLTWLLPADLIHFKQISCLTAVLKQSSNPDPVEIEDVNTSGFYEVDVKPSTKEVRA---S 110

Query: 95  TPIYKCNERTLIIIVDENVMQVCPIFLNVISKTICTMFGNQL-KFLIFGTSDRISKIKTI 153
            PIY+ ++ TL++++ E+ +Q  PI  N ++  +  +    + K  +   SD+I   K++
Sbjct: 111 YPIYELDDHTLVVLIKEDELQHPPILHNFLAIALAKVLRTAIQKVYLLINSDKIIGFKSL 170

Query: 154 NHLNCTLIPPEFITGFIGSIISDLSLTANSK---FNGFLVPSEGPLGFEKLTLETMEFLI 210
           + L     PPEFI G + +I++ L+  ++SK       +V SEGP G+E   +  ++ L 
Sbjct: 171 SELQ----PPEFIAGALAAIVTALNSQSSSKEFQHEIMVVQSEGPRGYEIHNITVVDLL- 225

Query: 211 KEGGRIVKTIDSNLNL-ELYEKECYRNWRLTGTTIGTQSGLYI 252
                 V+ + S L   E Y    YR W+ + +    QSGLY+
Sbjct: 226 ------VEYMKSTLGYSEEYVTSAYRRWK-SNSASQFQSGLYL 261

>ACL145W Chr3 (93920..94624) [705 bp, 234 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YLR199C
          Length = 234

 Score = 62.8 bits (151), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 48/173 (27%), Positives = 89/173 (51%), Gaps = 19/173 (10%)

Query: 84  NVSEATAHL-VKTPIYKCNERTLIIIVDENVMQVCPIFLNVISKTICTMF---GNQLKFL 139
           +V +A  H+ V   +Y+     L+++V+EN ++  PI  N +++ +       G +   L
Sbjct: 77  DVPQAERHVRVAYQLYERGPGQLVVVVEENDLKYPPIVHNRLAQQLAEKLRAVGAETTVL 136

Query: 140 IFGTSDRISKIKTINHLNCTLIPPEFITGFIGSIISDLSLTANSKFNGFLVPSEGPLGFE 199
           +   SD+ + +K +  L    +PPEFITG + +++  L+ +   +    +V SEGP GFE
Sbjct: 137 V--NSDKSTGVKDLEEL----VPPEFITGALAALVCALAPSGAGRV--LVVQSEGPHGFE 188

Query: 200 KLTLETMEFLIKEGGRIVKTIDSNLNLELYEKECYRNWRLTGTTIGTQSGLYI 252
           K  L  ++ L++   R+ + +D       Y   C R+W+L   +   Q GLY+
Sbjct: 189 KHNLTVVDALVE---RVRQILDQPPE---YVAACTRHWKLQAGSQ-FQGGLYL 234

>YNR021W Chr14 (668377..669591) [1215 bp, 404 aa] {ON} Putative
           protein of unknown function; green fluorescent protein
           (GFP)-fusion protein localizes to the endoplasmic
           reticulum; YNR021W is not an essential gene
          Length = 404

 Score = 32.0 bits (71), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 38/117 (32%), Positives = 53/117 (45%), Gaps = 12/117 (10%)

Query: 122 NVISKTICTMFGNQLKFLIFGTSDRISKIKTINHLNCTLIPPEFITG--FIGSIISDLSL 179
           N I +++ +   N LKF   G +   SKI T+ H N       F TG   I SI  +L L
Sbjct: 74  NQIFQSLHSFLANDLKFSRVGFNINDSKIFTVEHQNTWF--SSFATGRSAIKSINLNLHL 131

Query: 180 TANSKFNGFLVPSEGPLGF------EKLTLETMEFLIKEGGRIVKTIDSNLNLELYE 230
            A S  N F +  E  LGF       K   E ME +I+  G +V +  ++ N   +E
Sbjct: 132 VARS--NPFSMCLEYLLGFFFASLKSKQLEEFMEIVIRPNGILVTSESAHPNKNAHE 186

>Kpol_1010.54 s1010 (122414..124918,125403..125411,126015..129002)
            [5502 bp, 1833 aa] {ON}
            (122414..124918,125403..125411,126015..129002) [5502 nt,
            1834 aa]
          Length = 1833

 Score = 31.6 bits (70), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 39/86 (45%), Gaps = 12/86 (13%)

Query: 119  IFLNVISKTICTMFGNQLKFLIFGTSDRISKIKTINHLNCTLIPPEFITGFIGSIISDLS 178
            IF+N+ +  I T FGN     ++G S+   +IK  +  N T    +F    +G I     
Sbjct: 1616 IFMNIFASIIITHFGN-----VYGESNSSDRIKKRHIRNFTKAWKKFDFYGVGYI----- 1665

Query: 179  LTANSKFNGFLVPSEGPLGFEKLTLE 204
                 +   FL   EGPL F+K + E
Sbjct: 1666 --QFGEITPFLNSFEGPLSFKKWSSE 1689

>KLTH0E14696g Chr5 (1307028..1308182) [1155 bp, 384 aa] {ON} highly
           similar to uniprot|P38251 Saccharomyces cerevisiae
           YBR087W RFC5 Subunit of heteropentameric Replication
           factor C (RF-C) which is a DNA binding protein and
           ATPase that acts as a clamp loader of the proliferating
           cell nuclear antigen (PCNA) processivity factor for DNA
           polymerases delta and epsilon
          Length = 384

 Score = 30.8 bits (68), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 42/171 (24%), Positives = 71/171 (41%), Gaps = 7/171 (4%)

Query: 69  EILNFTSLGNIEVKLNVSEATAHLVKTPI-YKCNERTLIIIVDENVMQVCPIFLNVISKT 127
           ++  FT+  N +++LNV  +  HL  TP     N+R +I  + + V Q+  +     S  
Sbjct: 97  DVRQFTTPSNRKLELNVVSSPYHLEITPSDMGNNDRIVIQELLKEVAQMEQVDFQTASGA 156

Query: 128 ICTMFGNQLKFLIFGTSDRISKIKTINHLNCTLIPPEFITGFIGSIISDLSLTANSKFNG 187
                 ++ K +I   +D +++      L  T+        FI    S  S+ A  K   
Sbjct: 157 ETGGLAHRYKCVIINEADSLTR-DAQAALRRTMEKYSRNIRFIMLCESMSSMIAPIKSRC 215

Query: 188 FLVPSEGPLGFEKLTLETMEFLIKEGGRIVKTIDSNLNLELYEKECYRNWR 238
            LV +  P      T ET + L+K GG+   T++    L    + C  N R
Sbjct: 216 LLVRTPAP-----TTQETADALVKVGGQEKVTVEDEAILNTIAESCDGNLR 261

>ZYRO0E03014g Chr5 (230333..233779) [3447 bp, 1148 aa] {ON} similar
           to uniprot|P47108 Saccharomyces cerevisiae YJR041C URB2
           Nucleolar protein required for normal metabolism of the
           rRNA primary transcript proposed to be involved in
           ribosome biogenesis
          Length = 1148

 Score = 29.6 bits (65), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 34/71 (47%), Gaps = 5/71 (7%)

Query: 79  IEVKLNVSEATAHLVKTPIYKCNERTLIIIVDENVMQVCPIFLNVISKTICTMFGNQLKF 138
           I+  +N  E    L K   Y  ++R   I + ++     P+F + IS  I T+   QLKF
Sbjct: 352 IQCFINAREFVGFLEKIQTYCGDQRESAIFLLQD-----PLFADKISSNISTLSVVQLKF 406

Query: 139 LIFGTSDRISK 149
           LI    D+I K
Sbjct: 407 LITNLVDQILK 417

>KAFR0D04070 Chr4 complement(802424..804379) [1956 bp, 651 aa] {ON}
           Anc_1.55 YDR505C
          Length = 651

 Score = 29.6 bits (65), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 16/59 (27%), Positives = 32/59 (54%), Gaps = 6/59 (10%)

Query: 52  YEQIIVATRVLMPLFPKEILNFTSLGNIEVKLNVS----EATAHLVKTPIYKCNERTLI 106
           +  ++  T+ ++P  PK +L+F ++ +I +KL       E   H+V   + K N+RT +
Sbjct: 511 FYDVLNLTQFVLP--PKRVLSFANVKDITIKLRQKKLDEEVAQHVVNEKLEKVNQRTYL 567

>Smik_14.351 Chr14 (626357..627571) [1215 bp, 404 aa] {ON} YNR021W
           (REAL)
          Length = 404

 Score = 29.3 bits (64), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 37/112 (33%), Positives = 50/112 (44%), Gaps = 12/112 (10%)

Query: 122 NVISKTICTMFGNQLKFLIFGTSDRISKIKTINHLNCTLIPPEFITG--FIGSIISDLSL 179
           N I +++ +   N LKF   G +   SKI T+ H N       F TG   I SI  +L L
Sbjct: 74  NQIFQSLHSFLANDLKFSRVGFNINGSKIFTVEHQNTWF--SSFATGRSAIKSINLNLHL 131

Query: 180 TANSKFNGFLVPSEGPLGF------EKLTLETMEFLIKEGGRIVKTIDSNLN 225
            A S  N F +  E  LGF       K   E +E +IK  G  V +  ++ N
Sbjct: 132 VARS--NPFSMCLEYLLGFFFASLKSKQLEEFIEIVIKPNGVSVASESAHAN 181

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.322    0.139    0.414 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 26,491,171
Number of extensions: 1101170
Number of successful extensions: 2929
Number of sequences better than 10.0: 34
Number of HSP's gapped: 2926
Number of HSP's successfully gapped: 43
Length of query: 252
Length of database: 53,481,399
Length adjustment: 107
Effective length of query: 145
Effective length of database: 41,212,137
Effective search space: 5975759865
Effective search space used: 5975759865
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 64 (29.3 bits)