Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0E020607.349ON56439619960.0
TDEL0C019907.349ON60637111811e-155
ZYRO0F11682g7.349ON59737111451e-150
NCAS0A141507.349ON57037311121e-145
Kwal_56.246387.349ON52737010741e-140
SAKL0F11352g7.349ON58336610751e-140
YDL167C (NRP1)7.349ON71938210821e-139
Smik_4.717.349ON75938210781e-138
Suva_4.797.349ON70838310731e-138
KLTH0H01276g7.349ON55741510521e-136
KLLA0D12364g7.349ON63139810571e-136
Skud_4.907.349ON70738310641e-136
KNAG0C037807.349ON53837310281e-133
ACL149W7.349ON62836210221e-131
KAFR0B008707.349ON54239210111e-130
TPHA0F029607.349ON6543939971e-127
Kpol_530.327.349ON6844099211e-115
NDAI0A019007.349ON5653607938e-98
CAGL0I03344g7.349ON6034016292e-73
KLLA0B08976g3.379ON30546830.14
SAKL0H17952g8.229ON58950800.37
Kpol_1039.503.379ON29645770.65
NCAS0C059204.7ON287124770.70
TDEL0A009402.52ON68231761.4
TBLA0B006002.52ON73431742.0
Kwal_23.45972.52ON66431742.1
KLTH0B07546g2.52ON63931742.4
Kwal_56.234868.229ON58739732.7
CAGL0G05401g2.52ON67131723.3
CAGL0G05511g2.52ON67436723.4
KLTH0F09922g2.349ON1613134733.5
NDAI0C023403.74ON38726723.6
NDAI0H038502.52ON74231714.5
ABL158C2.52ON72931714.8
Skud_12.234.7ON256152705.1
CAGL0D05236g7.188ON44339705.4
Ecym_64412.52ON68931715.5
TPHA0I004208.822ON465107706.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0E02060
         (564 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0E02060 Chr5 (502492..504186) [1695 bp, 564 aa] {ON} Anc_7.3...   773   0.0  
TDEL0C01990 Chr3 complement(345897..347717) [1821 bp, 606 aa] {O...   459   e-155
ZYRO0F11682g Chr6 (956534..958327) [1794 bp, 597 aa] {ON} some s...   445   e-150
NCAS0A14150 Chr1 (2780086..2781798) [1713 bp, 570 aa] {ON} Anc_7...   432   e-145
Kwal_56.24638 s56 (1083888..1085471) [1584 bp, 527 aa] {ON} YDL1...   418   e-140
SAKL0F11352g Chr6 (883590..885341) [1752 bp, 583 aa] {ON} some s...   418   e-140
YDL167C Chr4 complement(160995..163154) [2160 bp, 719 aa] {ON}  ...   421   e-139
Smik_4.71 Chr4 complement(137635..139914) [2280 bp, 759 aa] {ON}...   419   e-138
Suva_4.79 Chr4 complement(148569..150695) [2127 bp, 708 aa] {ON}...   417   e-138
KLTH0H01276g Chr8 complement(122337..124010) [1674 bp, 557 aa] {...   409   e-136
KLLA0D12364g Chr4 complement(1051765..1053660) [1896 bp, 631 aa]...   411   e-136
Skud_4.90 Chr4 complement(156704..158827) [2124 bp, 707 aa] {ON}...   414   e-136
KNAG0C03780 Chr3 (743477..745093) [1617 bp, 538 aa] {ON} Anc_7.3...   400   e-133
ACL149W Chr3 (88715..90601) [1887 bp, 628 aa] {ON} Syntenic homo...   398   e-131
KAFR0B00870 Chr2 (162698..164326) [1629 bp, 542 aa] {ON} Anc_7.3...   394   e-130
TPHA0F02960 Chr6 (651108..653072) [1965 bp, 654 aa] {ON} Anc_7.3...   388   e-127
Kpol_530.32 s530 complement(78552..80606) [2055 bp, 684 aa] {ON}...   359   e-115
NDAI0A01900 Chr1 complement(426743..428440) [1698 bp, 565 aa] {O...   310   8e-98
CAGL0I03344g Chr9 complement(285637..287448) [1812 bp, 603 aa] {...   246   2e-73
KLLA0B08976g Chr2 complement(786122..787039) [918 bp, 305 aa] {O...    37   0.14 
SAKL0H17952g Chr8 complement(1599134..1600903) [1770 bp, 589 aa]...    35   0.37 
Kpol_1039.50 s1039 complement(146455..147322,147425..147447) [89...    34   0.65 
NCAS0C05920 Chr3 (1218910..1219773) [864 bp, 287 aa] {ON} Anc_4....    34   0.70 
TDEL0A00940 Chr1 complement(156781..158829) [2049 bp, 682 aa] {O...    34   1.4  
TBLA0B00600 Chr2 complement(123569..125773) [2205 bp, 734 aa] {O...    33   2.0  
Kwal_23.4597 s23 complement(781763..783757) [1995 bp, 664 aa] {O...    33   2.1  
KLTH0B07546g Chr2 (609954..611873) [1920 bp, 639 aa] {ON} some s...    33   2.4  
Kwal_56.23486 s56 complement(561558..563321) [1764 bp, 587 aa] {...    33   2.7  
CAGL0G05401g Chr7 complement(508557..510572) [2016 bp, 671 aa] {...    32   3.3  
CAGL0G05511g Chr7 complement(522026..524050) [2025 bp, 674 aa] {...    32   3.4  
KLTH0F09922g Chr6 (858143..862984) [4842 bp, 1613 aa] {ON} simil...    33   3.5  
NDAI0C02340 Chr3 (533251..534414) [1164 bp, 387 aa] {ON} Anc_3.7...    32   3.6  
NDAI0H03850 Chr8 (943316..945544) [2229 bp, 742 aa] {ON} Anc_2.5...    32   4.5  
ABL158C Chr2 complement(102437..104626) [2190 bp, 729 aa] {ON} S...    32   4.8  
Skud_12.23 Chr12 complement(37510..38280) [771 bp, 256 aa] {ON} ...    32   5.1  
CAGL0D05236g Chr4 (499006..500337) [1332 bp, 443 aa] {ON} weakly...    32   5.4  
Ecym_6441 Chr6 (856251..858320) [2070 bp, 689 aa] {ON} similar t...    32   5.5  
TPHA0I00420 Chr9 (82903..84300) [1398 bp, 465 aa] {ON} Anc_8.822...    32   6.7  

>TBLA0E02060 Chr5 (502492..504186) [1695 bp, 564 aa] {ON} Anc_7.349
           YDL167C
          Length = 564

 Score =  773 bits (1996), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 377/396 (95%), Positives = 377/396 (95%)

Query: 1   MYYTLIELQTAHDAEAPKDHTKIINISYQFINQSTLQASFPDDKIPNIDCTTLPLSESIA 60
           MYYTLIELQTAHDAEAPKDHTKIINISYQFINQSTLQASFPDDKIPNIDCTTLPLSESIA
Sbjct: 1   MYYTLIELQTAHDAEAPKDHTKIINISYQFINQSTLQASFPDDKIPNIDCTTLPLSESIA 60

Query: 61  LLQKDLELNLPNGEDFVLCSLNSTWDLRVTISRQAKDEQYTLPTFFKYPRIFDLWKEFDR 120
           LLQKDLELNLPNGEDFVLCSLNSTWDLRVTISRQAKDEQYTLPTFFKYPRIFDLWKEFDR
Sbjct: 61  LLQKDLELNLPNGEDFVLCSLNSTWDLRVTISRQAKDEQYTLPTFFKYPRIFDLWKEFDR 120

Query: 121 WCVNHKELVQTRDPRKLKDLKQLATLLHIPSVETLSSISLASKVLVQLHEKCTTEDDQEK 180
           WCVNHKELVQTRDPRKLKDLKQLATLLHIPSVETLSSISLASKVLVQLHEKCTTEDDQEK
Sbjct: 121 WCVNHKELVQTRDPRKLKDLKQLATLLHIPSVETLSSISLASKVLVQLHEKCTTEDDQEK 180

Query: 181 VLTSPYDSKLDWDIFIETSSTVLYMNNLPPDTTQSELETWFTQFGVRPIGFWTVKNILED 240
           VLTSPYDSKLDWDIFIETSSTVLYMNNLPPDTTQSELETWFTQFGVRPIGFWTVKNILED
Sbjct: 181 VLTSPYDSKLDWDIFIETSSTVLYMNNLPPDTTQSELETWFTQFGVRPIGFWTVKNILED 240

Query: 241 TSIINNNWCVNNSPYVEEIDSISGFIVFSTHKEAIDVLTLNGHSILSNIANTKQPRVVEH 300
           TSIINNNWCVNNSPYVEEIDSISGFIVFSTHKEAIDVLTLNGHSILSNIANTKQPRVVEH
Sbjct: 241 TSIINNNWCVNNSPYVEEIDSISGFIVFSTHKEAIDVLTLNGHSILSNIANTKQPRVVEH 300

Query: 301 VVEIQPSSPKVMERIQSILTPFPQSKNKPRPGDWNCPSCGFSNFQRRTACFRCSFPQQQA 360
           VVEIQPSSPKVMERIQSILTPFPQSKNKPRPGDWNCPSCGFSNFQRRTACFRCSFPQQQA
Sbjct: 301 VVEIQPSSPKVMERIQSILTPFPQSKNKPRPGDWNCPSCGFSNFQRRTACFRCSFPQQQA 360

Query: 361 VGXXXXXXXXXXXXXXXXXXXYFEDLQRHLYLNSFQ 396
           VG                   YFEDLQRHLYLNSFQ
Sbjct: 361 VGSSQKNDNNTPNNKNKSNNNYFEDLQRHLYLNSFQ 396

 Score =  121 bits (304), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 58/80 (72%), Positives = 58/80 (72%)

Query: 469 MAASNGSNVPFRAGDWKCLTCGYHNFAKNIVCLRCSGPKSGXXXXXXXXXXXXXXXXXXX 528
           MAASNGSNVPFRAGDWKCLTCGYHNFAKNIVCLRCSGPKSG                   
Sbjct: 469 MAASNGSNVPFRAGDWKCLTCGYHNFAKNIVCLRCSGPKSGYQSNSYSNNYNSSNYNRYV 528

Query: 529 XXXRQSNKTKQVDTQIATPL 548
              RQSNKTKQVDTQIATPL
Sbjct: 529 QQNRQSNKTKQVDTQIATPL 548

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 18/28 (64%)

Query: 480 RAGDWKCLTCGYHNFAKNIVCLRCSGPK 507
           R GDW C +CG+ NF +   C RCS P+
Sbjct: 330 RPGDWNCPSCGFSNFQRRTACFRCSFPQ 357

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 18/28 (64%)

Query: 330 RPGDWNCPSCGFSNFQRRTACFRCSFPQ 357
           R GDW C +CG+ NF +   C RCS P+
Sbjct: 480 RAGDWKCLTCGYHNFAKNIVCLRCSGPK 507

>TDEL0C01990 Chr3 complement(345897..347717) [1821 bp, 606 aa] {ON}
           Anc_7.349 YDL167C
          Length = 606

 Score =  459 bits (1181), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 215/371 (57%), Positives = 280/371 (75%), Gaps = 11/371 (2%)

Query: 1   MYYTLIELQTAHDAEAPKDHTKIINISYQFINQSTLQASFPDDKIPNIDC---TTLPLSE 57
           M+Y ++E++  H  EAPKDH ++  +SYQFI+  +++A + DD+IP I      ++   E
Sbjct: 1   MHYVVLEVEATHRIEAPKDHGRVNKLSYQFIDAESMKAYYADDQIPLISLDQQGSISFQE 60

Query: 58  SIALLQKDLELNLPNGEDFVLCSLNSTWDLRVTISRQAKDEQYTLPTFFKYPRIFDLWKE 117
           SIA   +D+ +++   ++FVLCSL STW +RVTI RQA+DE + LP++ ++PR+FDLWKE
Sbjct: 61  SIAKFDRDV-MSIVGEDEFVLCSLYSTWHIRVTIPRQARDEGFLLPSYLQHPRVFDLWKE 119

Query: 118 FDRWCVNHKELVQTRDP-----RKLKDLKQLATLLHIPSVETLSSISLASKV--LVQLHE 170
           +DRWC NH E++  R       +++KD  ++  +L + + E      L   V  L+QL E
Sbjct: 120 YDRWCANHPEVLTLRKSCRTGIKRVKDQTEILKVLEMSTEEITEKPVLGYTVDILLQLCE 179

Query: 171 KCTTEDDQEKVLTSPYDSKLDWDIFIETSSTVLYMNNLPPDTTQSELETWFTQFGVRPIG 230
           +CTT++D   VL+ PYDS LD   F++  S VLY+NNLPPDTTQSELE+WFTQFG RP+G
Sbjct: 180 RCTTKEDISDVLSRPYDSHLDIRNFLQEQSKVLYLNNLPPDTTQSELESWFTQFGARPVG 239

Query: 231 FWTVKNILEDTSIINNNWCVNNSPYVEEIDSISGFIVFSTHKEAIDVLTLNGHSILSNIA 290
           FWTVKNI+E+T+ INN W +NNSPYVEE DSISGF+VF TH+EA +VL LNG SILSN+A
Sbjct: 240 FWTVKNIVEETANINNKWSMNNSPYVEEQDSISGFVVFQTHEEATEVLVLNGRSILSNMA 299

Query: 291 NTKQPRVVEHVVEIQPSSPKVMERIQSILTPFPQSKNKPRPGDWNCPSCGFSNFQRRTAC 350
           NTKQPRVVEH+VEIQPSS +V++R Q IL+PFPQSKNKPRPGDWNCPSCGFSNFQRRTAC
Sbjct: 300 NTKQPRVVEHIVEIQPSSTRVLDRAQEILSPFPQSKNKPRPGDWNCPSCGFSNFQRRTAC 359

Query: 351 FRCSFPQQQAV 361
           FRCSFP   AV
Sbjct: 360 FRCSFPAASAV 370

 Score = 62.8 bits (151), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 24/30 (80%), Positives = 25/30 (83%)

Query: 478 PFRAGDWKCLTCGYHNFAKNIVCLRCSGPK 507
           PFRAGDWKC TC YHNFAKN+VCLRC   K
Sbjct: 476 PFRAGDWKCPTCTYHNFAKNLVCLRCGAAK 505

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 18/29 (62%)

Query: 480 RAGDWKCLTCGYHNFAKNIVCLRCSGPKS 508
           R GDW C +CG+ NF +   C RCS P +
Sbjct: 339 RPGDWNCPSCGFSNFQRRTACFRCSFPAA 367

 Score = 39.3 bits (90), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 12/25 (48%), Positives = 15/25 (60%)

Query: 330 RPGDWNCPSCGFSNFQRRTACFRCS 354
           R GDW CP+C + NF +   C RC 
Sbjct: 478 RAGDWKCPTCTYHNFAKNLVCLRCG 502

>ZYRO0F11682g Chr6 (956534..958327) [1794 bp, 597 aa] {ON} some
           similarities with uniprot|P32770 Saccharomyces
           cerevisiae YDL167C NRP1
          Length = 597

 Score =  445 bits (1145), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 222/371 (59%), Positives = 286/371 (77%), Gaps = 13/371 (3%)

Query: 1   MYYTLIELQTAHDAEAPKDHTKIINISYQFINQSTLQASFPDDKIP-----NIDCTTLPL 55
           MYY ++E++TAH  E PKD  +I  ISYQF+N  TLQ  + +++ P       D T L  
Sbjct: 1   MYYVVLEVETAHLIEIPKDQCRIAKISYQFVNAETLQVHYQENQAPLHIISENDSTNL-- 58

Query: 56  SESIALLQKDLELNLPNGEDFVLCSLNSTWDLRVTISRQAKDEQYTLPTFFKYPRIFDLW 115
            E++A L +++   +   E FVLCSLNSTW LRVT+SRQA+D+ + LP++ ++P+IFDLW
Sbjct: 59  HEAVANLNEEIN-RIAGDEPFVLCSLNSTWHLRVTLSRQARDQNFALPSYLQHPKIFDLW 117

Query: 116 KEFDRWCVNHKELVQTR--DPRKLKDLKQLATLLHIPSVETLSS---ISLASKVLVQLHE 170
           KE++RWCVNH E++  R    R++KD+ +LA +L I  +    S   +S + ++L++LH+
Sbjct: 118 KEYERWCVNHPEVMPLRKNGGRRMKDVAELARVLDINGLNFNDSSFDLSRSVEILLRLHQ 177

Query: 171 KCTTEDDQEKVLTSPYDSKLDWDIFIETSSTVLYMNNLPPDTTQSELETWFTQFGVRPIG 230
           +C+T +D   VLT PYDS +D   F++  S VLY+NNLPPDTTQSELE+WFTQFG RP+G
Sbjct: 178 RCSTPEDMAMVLTHPYDSHMDVRNFLQECSKVLYLNNLPPDTTQSELESWFTQFGARPVG 237

Query: 231 FWTVKNILEDTSIINNNWCVNNSPYVEEIDSISGFIVFSTHKEAIDVLTLNGHSILSNIA 290
           FWTVKNI+E+TS +NNNW +NNSPYVEE DSISGF+VF TH+EA +VLTLNG SILSN+A
Sbjct: 238 FWTVKNIVEETSNVNNNWSMNNSPYVEEQDSISGFVVFQTHEEATEVLTLNGRSILSNMA 297

Query: 291 NTKQPRVVEHVVEIQPSSPKVMERIQSILTPFPQSKNKPRPGDWNCPSCGFSNFQRRTAC 350
           NTKQPRVVEH+VEIQPSS +V++R Q IL+PFPQSKNKPRPGDWNCPSCGFSNFQRRTAC
Sbjct: 298 NTKQPRVVEHIVEIQPSSTRVLDRAQEILSPFPQSKNKPRPGDWNCPSCGFSNFQRRTAC 357

Query: 351 FRCSFPQQQAV 361
           FRCSFP   AV
Sbjct: 358 FRCSFPATTAV 368

 Score = 75.1 bits (183), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 29/37 (78%), Positives = 32/37 (86%)

Query: 471 ASNGSNVPFRAGDWKCLTCGYHNFAKNIVCLRCSGPK 507
            + GSNVPFRAGDWKC +C YHNFAKN+VCLRC GPK
Sbjct: 479 GNGGSNVPFRAGDWKCPSCIYHNFAKNVVCLRCGGPK 515

 Score = 44.3 bits (103), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 16/32 (50%), Positives = 19/32 (59%)

Query: 330 RPGDWNCPSCGFSNFQRRTACFRCSFPQQQAV 361
           R GDW CPSC + NF +   C RC  P+  AV
Sbjct: 488 RAGDWKCPSCIYHNFAKNVVCLRCGGPKITAV 519

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 18/29 (62%)

Query: 480 RAGDWKCLTCGYHNFAKNIVCLRCSGPKS 508
           R GDW C +CG+ NF +   C RCS P +
Sbjct: 337 RPGDWNCPSCGFSNFQRRTACFRCSFPAT 365

>NCAS0A14150 Chr1 (2780086..2781798) [1713 bp, 570 aa] {ON}
           Anc_7.349 YDL167C
          Length = 570

 Score =  432 bits (1112), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 205/373 (54%), Positives = 267/373 (71%), Gaps = 17/373 (4%)

Query: 1   MYYTLIELQTAHDAEAPKDHTKIINISYQFINQSTLQASFPDDKIPNIDCTTLPLSESIA 60
           M+Y ++EL+T+H  E PKDH++I   SYQFIN  TLQA+F + K  +I        ++I+
Sbjct: 1   MFYVVLELETSHQVETPKDHSRITKCSYQFINSETLQATFEEPKSIDIPDMANAFKDTIS 60

Query: 61  LLQKDLELNLPNGEDFVLCSLNSTWDLRVTISRQAKDEQYTLPTFFKYPRIFDLWKEFDR 120
            L+ D++  + +  DFVLCSL S WD+RVT+ RQA D  + LP++ K+PR+F+LWKEFD+
Sbjct: 61  QLEADIKAEIVDFSDFVLCSLFSVWDIRVTLPRQAHDLGFILPSYLKHPRVFNLWKEFDK 120

Query: 121 WCVNHKELVQTR-------DPRKLKDLKQLATLLHIPSV----------ETLSSISLASK 163
           WC NH E++  R        P+   D+  +  +L I +           +TL SI  ++ 
Sbjct: 121 WCGNHPEVIPMRKSNLRVKSPKTAGDISDIVNILEIDTSLQVPLSTSNPQTLLSIQDSTN 180

Query: 164 VLVQLHEKCTTEDDQEKVLTSPYDSKLDWDIFIETSSTVLYMNNLPPDTTQSELETWFTQ 223
           +L +L +KCTT DD + VLT PYDS  D   F++  S VLYMNNLP DTTQSELE+WFTQ
Sbjct: 181 ILTKLRKKCTTLDDVQLVLTRPYDSYADIKTFLQERSRVLYMNNLPSDTTQSELESWFTQ 240

Query: 224 FGVRPIGFWTVKNILEDTSIINNNWCVNNSPYVEEIDSISGFIVFSTHKEAIDVLTLNGH 283
           FG RPIGFWT KN +E+TS IN+NW +N +P V+E D ++GF+VF +H+EA + L LNG 
Sbjct: 241 FGARPIGFWTAKNTIEETSSINSNWSLNGNPLVDEQDCVAGFVVFQSHEEATEALVLNGR 300

Query: 284 SILSNIANTKQPRVVEHVVEIQPSSPKVMERIQSILTPFPQSKNKPRPGDWNCPSCGFSN 343
           SILSNIANTKQPRVVEH+VEIQPSS +V++  Q IL+ FPQSKNKPRPGDW+CPSCGFSN
Sbjct: 301 SILSNIANTKQPRVVEHIVEIQPSSTRVLDAGQDILSAFPQSKNKPRPGDWSCPSCGFSN 360

Query: 344 FQRRTACFRCSFP 356
           FQRRTACFRCSFP
Sbjct: 361 FQRRTACFRCSFP 373

 Score = 71.2 bits (173), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 28/38 (73%), Positives = 31/38 (81%)

Query: 470 AASNGSNVPFRAGDWKCLTCGYHNFAKNIVCLRCSGPK 507
             + GSNVPFRAGDWKC +C YHNFAKN+VCLRC  PK
Sbjct: 466 GITTGSNVPFRAGDWKCPSCTYHNFAKNVVCLRCRIPK 503

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 17/28 (60%)

Query: 330 RPGDWNCPSCGFSNFQRRTACFRCSFPQ 357
           R GDW CPSC + NF +   C RC  P+
Sbjct: 476 RAGDWKCPSCTYHNFAKNVVCLRCRIPK 503

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 17/27 (62%)

Query: 480 RAGDWKCLTCGYHNFAKNIVCLRCSGP 506
           R GDW C +CG+ NF +   C RCS P
Sbjct: 347 RPGDWSCPSCGFSNFQRRTACFRCSFP 373

>Kwal_56.24638 s56 (1083888..1085471) [1584 bp, 527 aa] {ON} YDL167C
           (NRP1) - Asparagine-rich protein [contig 161] FULL
          Length = 527

 Score =  418 bits (1074), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 210/370 (56%), Positives = 273/370 (73%), Gaps = 19/370 (5%)

Query: 1   MYYTLIELQTAHDAEAPKDHTKIINISYQFINQSTLQASFPDDK--IPNIDCTTLPLSES 58
           M+Y ++E+  AH  ++PKD ++I    YQF++   L++ F ++K  +    C+   L E+
Sbjct: 1   MHYVVLEVDLAHREDSPKDWSQIAAFHYQFLDTEELKSVFQENKHIVLENGCS---LQEA 57

Query: 59  IALLQKDLELNLPNGEDFVLCSLNSTWDLRVTISRQAKDEQYTLPTFFKYPRIFDLWKEF 118
           ++ L+KD+  +L   +DFVLCSLNSTW  RVTI RQA+DE + LP   ++PR+FDLWKE+
Sbjct: 58  VSQLEKDIGEHLK--DDFVLCSLNSTWHFRVTIPRQARDEVFILPPHLQHPRVFDLWKEY 115

Query: 119 DRWCVNHKELVQTRDP----RKLKDLKQLATLLHIPSVETLSSISLAS--------KVLV 166
           DRWCVNH E +  R      +K+KD+ +L ++L + S    S+   A          ++ 
Sbjct: 116 DRWCVNHPETLALRRSNSMGKKVKDVAELRSVLELDSATQDSTPGAAEPDALEQTIAIIR 175

Query: 167 QLHEKCTTEDDQEKVLTSPYDSKLDWDIFIETSSTVLYMNNLPPDTTQSELETWFTQFGV 226
           QLH+KC T +D+  VLT PYDS LD   F++  S VLYMNNLPPDTTQSELE+WFTQFG 
Sbjct: 176 QLHKKCVTAEDKSLVLTHPYDSYLDVRNFLQERSKVLYMNNLPPDTTQSELESWFTQFGA 235

Query: 227 RPIGFWTVKNILEDTSIINNNWCVNNSPYVEEIDSISGFIVFSTHKEAIDVLTLNGHSIL 286
           RP+GFWTVKNI+E+TS +NNNW  NNS YVE  DSISGF+VF +H+EA + L+LNG SIL
Sbjct: 236 RPVGFWTVKNIVEETSNVNNNWSSNNSTYVEAQDSISGFVVFQSHEEATEALSLNGRSIL 295

Query: 287 SNIANTKQPRVVEHVVEIQPSSPKVMERIQSILTPFPQSKNKPRPGDWNCPSCGFSNFQR 346
           SNIANTKQPRV+EH+VE+QPSS +V++R Q IL+PFPQSKNKPRPGDWNCPSCGFSNFQR
Sbjct: 296 SNIANTKQPRVIEHIVEVQPSSARVLDRAQEILSPFPQSKNKPRPGDWNCPSCGFSNFQR 355

Query: 347 RTACFRCSFP 356
           RT+CFRCSFP
Sbjct: 356 RTSCFRCSFP 365

 Score = 79.0 bits (193), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 31/36 (86%), Positives = 32/36 (88%)

Query: 473 NGSNVPFRAGDWKCLTCGYHNFAKNIVCLRCSGPKS 508
            GSNVPFRAGDWKC TC YHNFAKN+VCLRC GPKS
Sbjct: 448 GGSNVPFRAGDWKCATCTYHNFAKNVVCLRCGGPKS 483

 Score = 44.3 bits (103), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 19/30 (63%)

Query: 480 RAGDWKCLTCGYHNFAKNIVCLRCSGPKSG 509
           R GDW C +CG+ NF +   C RCS P +G
Sbjct: 339 RPGDWNCPSCGFSNFQRRTSCFRCSFPSTG 368

 Score = 38.9 bits (89), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 12/28 (42%), Positives = 16/28 (57%)

Query: 330 RPGDWNCPSCGFSNFQRRTACFRCSFPQ 357
           R GDW C +C + NF +   C RC  P+
Sbjct: 455 RAGDWKCATCTYHNFAKNVVCLRCGGPK 482

>SAKL0F11352g Chr6 (883590..885341) [1752 bp, 583 aa] {ON} some
           similarities with uniprot|P32770 Saccharomyces
           cerevisiae YDL167C NRP1
          Length = 583

 Score =  418 bits (1075), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 212/366 (57%), Positives = 268/366 (73%), Gaps = 9/366 (2%)

Query: 1   MYYTLIELQTAHDAEAPKDHTKIINISYQFINQSTLQASFPDDKIPNIDCTTLPLSESIA 60
           MYY ++E +T H  E PKDHT++  I YQFI+  TLQ+ F    I  ++     L E +A
Sbjct: 1   MYYVVLEAETVHGEEKPKDHTRVSRICYQFIHSDTLQSVFEQPII--VEVGPGQLREQVA 58

Query: 61  LLQKDLELNL-PNGEDFVLCSLNSTWDLRVTISRQAKDEQYTLPTFFKYPRIFDLWKEFD 119
            L + +   +  +  +F L SL+STW +RVTI RQA+DE + LP + ++P++FDLWKE+D
Sbjct: 59  QLDQLVTSKITSDNHEFALVSLSSTWHIRVTIPRQARDEGFILPPYLQHPKVFDLWKEYD 118

Query: 120 RWCVNHKELVQTRD----PRKLKDLKQLATLLHIPSVETLSSISLASKVLVQLHEKCTTE 175
           RWCVNH E +  R      +K +DL +L+ +L  P ++T   +     +L QLH+KC   
Sbjct: 119 RWCVNHPETLPLRKNSNLGKKSRDLPELSRVLEAP-LQTFP-LDQTIGILSQLHKKCLLP 176

Query: 176 DDQEKVLTSPYDSKLDWDIFIETSSTVLYMNNLPPDTTQSELETWFTQFGVRPIGFWTVK 235
           +DQ  VLT PYDS LD   F++  S VLYMNNLPPDTTQSELE+WFTQFG RP+GFWTVK
Sbjct: 177 EDQSMVLTHPYDSYLDVRTFLQERSKVLYMNNLPPDTTQSELESWFTQFGARPVGFWTVK 236

Query: 236 NILEDTSIINNNWCVNNSPYVEEIDSISGFIVFSTHKEAIDVLTLNGHSILSNIANTKQP 295
           N++E+TS +NNNW  NNS YVEE DSISGF+VF TH+EA + L+LNG SILSN+ANTKQP
Sbjct: 237 NVVEETSNVNNNWSCNNSSYVEEQDSISGFVVFQTHEEATEALSLNGRSILSNMANTKQP 296

Query: 296 RVVEHVVEIQPSSPKVMERIQSILTPFPQSKNKPRPGDWNCPSCGFSNFQRRTACFRCSF 355
           RVVEHVVE+QPSS +V++R   +L+PFPQSKNKPRPGDWNCPSCGFSNFQRRTACFRCSF
Sbjct: 297 RVVEHVVELQPSSTRVLDRAHELLSPFPQSKNKPRPGDWNCPSCGFSNFQRRTACFRCSF 356

Query: 356 PQQQAV 361
           P   AV
Sbjct: 357 PATSAV 362

 Score = 77.4 bits (189), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 29/37 (78%), Positives = 33/37 (89%)

Query: 472 SNGSNVPFRAGDWKCLTCGYHNFAKNIVCLRCSGPKS 508
             GSNVPFRAGDWKC++C YHNFAKN+VCLRC GPK+
Sbjct: 492 GGGSNVPFRAGDWKCVSCTYHNFAKNVVCLRCGGPKT 528

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 18/29 (62%)

Query: 480 RAGDWKCLTCGYHNFAKNIVCLRCSGPKS 508
           R GDW C +CG+ NF +   C RCS P +
Sbjct: 331 RPGDWNCPSCGFSNFQRRTACFRCSFPAT 359

 Score = 39.7 bits (91), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 16/28 (57%)

Query: 330 RPGDWNCPSCGFSNFQRRTACFRCSFPQ 357
           R GDW C SC + NF +   C RC  P+
Sbjct: 500 RAGDWKCVSCTYHNFAKNVVCLRCGGPK 527

>YDL167C Chr4 complement(160995..163154) [2160 bp, 719 aa] {ON}
           NRP1Putative RNA binding protein of unknown function;
           localizes to stress granules induced by glucose
           deprivation; predicted to be involved in ribosome
           biogenesis
          Length = 719

 Score =  421 bits (1082), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 212/382 (55%), Positives = 276/382 (72%), Gaps = 27/382 (7%)

Query: 1   MYYTLIELQTAHDAEAPKDHTKIINISYQFINQSTLQASFPDDKIPNIDC--TTLPLSES 58
           M+Y ++ELQ AH  + PKD  +I NI++Q +N  TL   +  + +P+I+   TT  L  +
Sbjct: 1   MHYVVLELQVAHLPDTPKDQCRIANIAFQIVNAETLVCHYGTNSLPSIEVNGTTKSLESA 60

Query: 59  IALLQKDLELNLPNGEDFVLCSLNSTWDLRVTISRQAKDEQYTLPTFFKYPRIFDLWKEF 118
           +  L KD+   + N +DFVL SL STW +RVT+ RQA+D+ + L ++ ++P++FDLWKEF
Sbjct: 61  MVQLDKDIHDVIGN-DDFVLVSLYSTWHIRVTLPRQARDDGFILTSYLQHPKVFDLWKEF 119

Query: 119 DRWCVNHKELVQTRDP----------------RKLKDLKQLATLLH--IPSVET------ 154
           DRWCVNH E++  +                  +  KDL ++  +L   IP+ E       
Sbjct: 120 DRWCVNHPEILGQKKAISNNNCNTKSISINAAKNTKDLDEIVRILEVSIPTEEAGSVPEI 179

Query: 155 LSSISLASKVLVQLHEKCTTEDDQEKVLTSPYDSKLDWDIFIETSSTVLYMNNLPPDTTQ 214
            S +   + +L+QLH+KCT+ +D E VLT PYDS  D   F++  S +LYMNNLPPDTTQ
Sbjct: 180 YSLLKRTTDILIQLHKKCTSPEDMESVLTKPYDSHTDIRAFLQEKSKILYMNNLPPDTTQ 239

Query: 215 SELETWFTQFGVRPIGFWTVKNILEDTSIINNNWCVNNSPYVEEIDSISGFIVFSTHKEA 274
           SELE+WFTQ+GVRP+GFWTVKNI+EDTS +NNNW +NNSPYVE+ DSISGF+VF TH+EA
Sbjct: 240 SELESWFTQYGVRPVGFWTVKNIVEDTSNVNNNWSLNNSPYVEDQDSISGFVVFQTHEEA 299

Query: 275 IDVLTLNGHSILSNIANTKQPRVVEHVVEIQPSSPKVMERIQSILTPFPQSKNKPRPGDW 334
            +VL LNG SILSN+ANTKQPRVVEHV+E+QPSS  V+++ Q IL+PFPQSKNKPRPGDW
Sbjct: 300 TEVLALNGRSILSNLANTKQPRVVEHVLELQPSSTGVLDKAQEILSPFPQSKNKPRPGDW 359

Query: 335 NCPSCGFSNFQRRTACFRCSFP 356
           NCPSCGFSNFQRRTACFRCSFP
Sbjct: 360 NCPSCGFSNFQRRTACFRCSFP 381

 Score = 76.6 bits (187), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 30/35 (85%), Positives = 32/35 (91%)

Query: 474 GSNVPFRAGDWKCLTCGYHNFAKNIVCLRCSGPKS 508
           GSN+PFRAGDWKC TC YHNFAKN+VCLRC GPKS
Sbjct: 575 GSNMPFRAGDWKCSTCTYHNFAKNVVCLRCGGPKS 609

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 17/27 (62%)

Query: 480 RAGDWKCLTCGYHNFAKNIVCLRCSGP 506
           R GDW C +CG+ NF +   C RCS P
Sbjct: 355 RPGDWNCPSCGFSNFQRRTACFRCSFP 381

 Score = 39.3 bits (90), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 12/28 (42%), Positives = 16/28 (57%)

Query: 330 RPGDWNCPSCGFSNFQRRTACFRCSFPQ 357
           R GDW C +C + NF +   C RC  P+
Sbjct: 581 RAGDWKCSTCTYHNFAKNVVCLRCGGPK 608

>Smik_4.71 Chr4 complement(137635..139914) [2280 bp, 759 aa] {ON}
           YDL167C (REAL)
          Length = 759

 Score =  419 bits (1078), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 209/382 (54%), Positives = 273/382 (71%), Gaps = 26/382 (6%)

Query: 1   MYYTLIELQTAHDAEAPKDHTKIINISYQFINQSTLQASFPDDKIPNIDCTTLPLSESIA 60
           M+Y ++ELQ AH   +PKD  +I+NI+YQF++  TL   + ++ +PNI+      S   A
Sbjct: 1   MHYVVLELQVAHLPNSPKDQCRIVNIAYQFVDAETLACHYENNSLPNIEVDRETRSLETA 60

Query: 61  LLQKDLEL-NLPNGEDFVLCSLNSTWDLRVTISRQAKDEQYTLPTFFKYPRIFDLWKEFD 119
           ++Q D  + ++   ++FVL SL STW +RVT+ RQA+D+ + L ++ ++P++FDLWKEFD
Sbjct: 61  MIQLDKAIQDILGNDEFVLVSLYSTWHIRVTLPRQARDDGFILTSYLQHPKLFDLWKEFD 120

Query: 120 RWCVNHKELVQTRD-----------------PRKLKDLKQLATLLHIPSV--------ET 154
           RWCVNH E+++                     +  KDL ++  +L I S         E 
Sbjct: 121 RWCVNHPEILEQMKTASNNNNSGTKGNSGGLAKNAKDLDEMIRILEISSSTEEAVSVPEE 180

Query: 155 LSSISLASKVLVQLHEKCTTEDDQEKVLTSPYDSKLDWDIFIETSSTVLYMNNLPPDTTQ 214
            S +   + +L+ LH KC + +D + VLT PYDS  D   F++  S VLYMNNLPPDTTQ
Sbjct: 181 YSLLRRTTDILIHLHRKCCSSEDMKFVLTQPYDSHTDIRTFLQERSKVLYMNNLPPDTTQ 240

Query: 215 SELETWFTQFGVRPIGFWTVKNILEDTSIINNNWCVNNSPYVEEIDSISGFIVFSTHKEA 274
           SELE+WFTQ+GVRP+GFWTVKNI+EDTS INNNW +NNSPYVE+ DSISGF+VF TH+EA
Sbjct: 241 SELESWFTQYGVRPVGFWTVKNIVEDTSNINNNWSLNNSPYVEDQDSISGFVVFQTHEEA 300

Query: 275 IDVLTLNGHSILSNIANTKQPRVVEHVVEIQPSSPKVMERIQSILTPFPQSKNKPRPGDW 334
            +VL LNG SILSN+ANTKQPRVVEHV+E+QPSS  V+++ Q IL+PFPQSKNKPRPGDW
Sbjct: 301 TEVLALNGRSILSNLANTKQPRVVEHVLELQPSSTGVLDKAQEILSPFPQSKNKPRPGDW 360

Query: 335 NCPSCGFSNFQRRTACFRCSFP 356
           NCPSCGFSNFQRRTACFRCSFP
Sbjct: 361 NCPSCGFSNFQRRTACFRCSFP 382

 Score = 78.2 bits (191), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 30/38 (78%), Positives = 33/38 (86%)

Query: 471 ASNGSNVPFRAGDWKCLTCGYHNFAKNIVCLRCSGPKS 508
             +GSN+PFRAGDWKC TC YHNFAKN+VCLRC GPKS
Sbjct: 612 GGSGSNIPFRAGDWKCSTCTYHNFAKNVVCLRCGGPKS 649

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 17/27 (62%)

Query: 480 RAGDWKCLTCGYHNFAKNIVCLRCSGP 506
           R GDW C +CG+ NF +   C RCS P
Sbjct: 356 RPGDWNCPSCGFSNFQRRTACFRCSFP 382

 Score = 39.7 bits (91), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 12/28 (42%), Positives = 16/28 (57%)

Query: 330 RPGDWNCPSCGFSNFQRRTACFRCSFPQ 357
           R GDW C +C + NF +   C RC  P+
Sbjct: 621 RAGDWKCSTCTYHNFAKNVVCLRCGGPK 648

>Suva_4.79 Chr4 complement(148569..150695) [2127 bp, 708 aa] {ON}
           YDL167C (REAL)
          Length = 708

 Score =  417 bits (1073), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 212/383 (55%), Positives = 279/383 (72%), Gaps = 28/383 (7%)

Query: 1   MYYTLIELQTAHDAEAPKDHTKIINISYQFINQSTLQASFPDDKIPNIDC--TTLPLSES 58
           M+Y ++ELQ AH  ++PKD  +I+N++YQ ++  TL + + +   P+ID       L  +
Sbjct: 1   MHYVVLELQVAHLPDSPKDQCRIVNMAYQIVDAETLASHYENGSSPSIDVDGEKKSLESA 60

Query: 59  IALLQKDLELNLPNGEDFVLCSLNSTWDLRVTISRQAKDEQYTLPTFFKYPRIFDLWKEF 118
           +  L KD++  + N +DFVL SL STW +RVT+ RQA+D+ + L ++ ++PR+FDLWKEF
Sbjct: 61  MGQLDKDIQHIIGN-DDFVLVSLCSTWHIRVTLPRQARDDGFILTSYLQHPRLFDLWKEF 119

Query: 119 DRWCVNHKELVQTRDP-----------------RKLKDLKQLATLLHIP-SVE----TLS 156
           +RWC+NH E++  R                   +  KDL ++  +L IP +VE     L 
Sbjct: 120 ERWCINHPEIMGLRKNILNNNSNTKSSSIGTLIKNTKDLNEMMRILEIPNTVEEDDFALD 179

Query: 157 SISLASK---VLVQLHEKCTTEDDQEKVLTSPYDSKLDWDIFIETSSTVLYMNNLPPDTT 213
           + SL  +   VL+QLH+KC++ +D + VLT PYDS  D   F++  S VLYMNNLPPDTT
Sbjct: 180 NHSLLQRTIDVLLQLHKKCSSAEDMKSVLTQPYDSHTDIRSFLQERSKVLYMNNLPPDTT 239

Query: 214 QSELETWFTQFGVRPIGFWTVKNILEDTSIINNNWCVNNSPYVEEIDSISGFIVFSTHKE 273
           QSELE+WFTQ+G RP+GFWTVKNI+EDTS +NNNW +NNSPYVE+ DSISGF+VF TH+E
Sbjct: 240 QSELESWFTQYGARPVGFWTVKNIVEDTSNVNNNWSLNNSPYVEDQDSISGFVVFQTHEE 299

Query: 274 AIDVLTLNGHSILSNIANTKQPRVVEHVVEIQPSSPKVMERIQSILTPFPQSKNKPRPGD 333
           A +VL LNG SILSN+ANTKQPRVVEHV+E+QPSS  V+++ Q IL+PFPQSKNKPRPGD
Sbjct: 300 ATEVLALNGRSILSNLANTKQPRVVEHVLELQPSSTGVLDKAQEILSPFPQSKNKPRPGD 359

Query: 334 WNCPSCGFSNFQRRTACFRCSFP 356
           WNCPSCGFSNFQRRTACFRCSFP
Sbjct: 360 WNCPSCGFSNFQRRTACFRCSFP 382

 Score = 78.2 bits (191), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 30/38 (78%), Positives = 33/38 (86%)

Query: 471 ASNGSNVPFRAGDWKCLTCGYHNFAKNIVCLRCSGPKS 508
             +GSN+PFRAGDWKC TC YHNFAKN+VCLRC GPKS
Sbjct: 554 GGSGSNIPFRAGDWKCSTCTYHNFAKNVVCLRCGGPKS 591

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 17/27 (62%)

Query: 480 RAGDWKCLTCGYHNFAKNIVCLRCSGP 506
           R GDW C +CG+ NF +   C RCS P
Sbjct: 356 RPGDWNCPSCGFSNFQRRTACFRCSFP 382

 Score = 39.7 bits (91), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 12/28 (42%), Positives = 16/28 (57%)

Query: 330 RPGDWNCPSCGFSNFQRRTACFRCSFPQ 357
           R GDW C +C + NF +   C RC  P+
Sbjct: 563 RAGDWKCSTCTYHNFAKNVVCLRCGGPK 590

>KLTH0H01276g Chr8 complement(122337..124010) [1674 bp, 557 aa] {ON}
           some similarities with uniprot|P32770 Saccharomyces
           cerevisiae YDL167C NRP1
          Length = 557

 Score =  409 bits (1052), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 215/415 (51%), Positives = 277/415 (66%), Gaps = 58/415 (13%)

Query: 1   MYYTLIELQTAHDAEAPKDHTKIINISYQFINQSTLQASFPDDKIPNID--CTTLPLSES 58
           M+Y ++E++ AH  ++PKD ++I   +YQF++  TL+  F ++K   +   CT   L ++
Sbjct: 1   MHYVVLEVELAHREDSPKDWSQIAKFNYQFLDTETLEPVFEENKHVELGNGCT---LQDA 57

Query: 59  IALLQKDLELNLPNGEDFVLCSLNSTWDLRVTISRQAKDEQYTLPTFFKYPRIFDLWKEF 118
           +A L+KD+  +    +DFVLCSLNSTW  RVTI RQA+DE + LP   ++P++FDLWKE+
Sbjct: 58  VAQLEKDISEHAK--DDFVLCSLNSTWHFRVTIPRQARDEVFILPPHLQHPKVFDLWKEY 115

Query: 119 DRWCVNHKELVQTRD---PRKLKDLKQLATLLHI-------------------------- 149
           DRWC+NH E    R     ++ KDL ++ ++L +                          
Sbjct: 116 DRWCMNHPETSAMRQNPLGKRTKDLAEMRSVLGLDGTEEGAHPDANQNGGEQSKAEQSGA 175

Query: 150 ------------PSVETLSS----------ISLASKVLVQLHEKCTTEDDQEKVLTSPYD 187
                       PS E  SS          I+ A  ++ QLH+KC T DD+  VLT PYD
Sbjct: 176 EQLVAGQPDTKQPSTELSSSEQSPAEQPDTITQAVVIITQLHKKCVTADDKSLVLTHPYD 235

Query: 188 SKLDWDIFIETSSTVLYMNNLPPDTTQSELETWFTQFGVRPIGFWTVKNILEDTSIINNN 247
           S LD   F++  S VLYMNNLPPDTTQSELE+WFTQFG RP+GFWTVKNI+E+TS +NNN
Sbjct: 236 SYLDVRNFLQERSKVLYMNNLPPDTTQSELESWFTQFGARPVGFWTVKNIVEETSNVNNN 295

Query: 248 WCVNNSPYVEEIDSISGFIVFSTHKEAIDVLTLNGHSILSNIANTKQPRVVEHVVEIQPS 307
           W  NNS YVE  DSISGF+VF +H+EA + L+LNG SILSNIANTKQPRV+EH+VEIQPS
Sbjct: 296 WSSNNSTYVEAQDSISGFVVFQSHEEATEALSLNGRSILSNIANTKQPRVIEHIVEIQPS 355

Query: 308 SPKVMERIQSILTPFPQSKNKPRPGDWNCPSCGFSNFQRRTACFRCSFPQQQAVG 362
           S +V++R Q IL+PFPQSKNKPRPGDWNCPSCGFSNFQRRT+CFRCSFP     G
Sbjct: 356 SARVLDRAQEILSPFPQSKNKPRPGDWNCPSCGFSNFQRRTSCFRCSFPAASGAG 410

 Score = 76.3 bits (186), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 30/34 (88%), Positives = 31/34 (91%)

Query: 475 SNVPFRAGDWKCLTCGYHNFAKNIVCLRCSGPKS 508
           SNVPFRAGDWKC TC YHNFAKN+VCLRC GPKS
Sbjct: 486 SNVPFRAGDWKCATCTYHNFAKNVVCLRCGGPKS 519

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 18/29 (62%)

Query: 480 RAGDWKCLTCGYHNFAKNIVCLRCSGPKS 508
           R GDW C +CG+ NF +   C RCS P +
Sbjct: 378 RPGDWNCPSCGFSNFQRRTSCFRCSFPAA 406

 Score = 39.3 bits (90), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 20/38 (52%), Gaps = 5/38 (13%)

Query: 330 RPGDWNCPSCGFSNFQRRTACFRCSFP-----QQQAVG 362
           R GDW C +C + NF +   C RC  P     QQ+ +G
Sbjct: 491 RAGDWKCATCTYHNFAKNVVCLRCGGPKSTEHQQKELG 528

>KLLA0D12364g Chr4 complement(1051765..1053660) [1896 bp, 631 aa]
           {ON} some similarities with uniprot|P32770 Saccharomyces
           cerevisiae YDL167C NRP1
          Length = 631

 Score =  411 bits (1057), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 219/398 (55%), Positives = 271/398 (68%), Gaps = 39/398 (9%)

Query: 1   MYYTLIELQTAHDAEAPKDHTKIINISYQFINQSTLQASFPDDKIPNIDCTTLPLSESIA 60
           M+Y L E +T +  EAPKDHT I +I+YQ I+  TL+  + + +  +ID T   L  +I 
Sbjct: 1   MFYVLFECETVYSEEAPKDHTMISSIAYQIISVETLKPIWEEARRHSIDATH-SLKNTIQ 59

Query: 61  LLQKDLELNLPNGEDFVLCSLNSTWDLRVTISRQAKDEQYTLPTFFKYPRIFDLWKEFDR 120
            ++  +  N+  GE+FVLCSLNSTWDLRVT+SRQA+DE + LP+F ++P++FDLW+E DR
Sbjct: 60  SMENAVMENVA-GEEFVLCSLNSTWDLRVTLSRQARDESWLLPSFLQHPKVFDLWREVDR 118

Query: 121 WCVNHKELVQT-----------------RDPRKL-KDLKQLATLLHIP------------ 150
           W  NH E  +                  R+  KL K +  L   L+I             
Sbjct: 119 WYRNHPEQYEKGTDRGGGNVANTNTTTQRNKHKLVKSIDALLVFLNIDLDNKSTTDQRME 178

Query: 151 -------SVETLSSISLASKVLVQLHEKCTTEDDQEKVLTSPYDSKLDWDIFIETSSTVL 203
                  S ETL SI    KVL +LH  CT+++DQ  VLT P+DS LD   F+   STVL
Sbjct: 179 QVNIDKNSFETLPSIQQCEKVLFKLHRNCTSDNDQTLVLTHPFDSYLDIKNFLLEKSTVL 238

Query: 204 YMNNLPPDTTQSELETWFTQFGVRPIGFWTVKNILEDTSIINNNWCVNNSPYVEEIDSIS 263
           YMNNLPPDTTQSELE+WF QFG RP+GFWTVKN++EDTS +NNNW  NN+ YV+E DSIS
Sbjct: 239 YMNNLPPDTTQSELESWFAQFGSRPVGFWTVKNVVEDTSNVNNNWSTNNNLYVDEQDSIS 298

Query: 264 GFIVFSTHKEAIDVLTLNGHSILSNIANTKQPRVVEHVVEIQPSSPKVMERIQSILTPFP 323
           GF+V+  H+EA+D LTLNG SILSN++NTKQPRVVEHVVEIQPSS  V++R Q ILT FP
Sbjct: 299 GFVVYQAHEEALDSLTLNGRSILSNMSNTKQPRVVEHVVEIQPSSNSVLDRAQEILTAFP 358

Query: 324 QSKNKPRPGDWNCPSCGFSNFQRRTACFRCSFPQQQAV 361
           QSKNKPRPGDW CPSC FSNFQRRTACFRCSFP   A+
Sbjct: 359 QSKNKPRPGDWTCPSCSFSNFQRRTACFRCSFPMSSAL 396

 Score = 80.1 bits (196), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 31/38 (81%), Positives = 33/38 (86%)

Query: 472 SNGSNVPFRAGDWKCLTCGYHNFAKNIVCLRCSGPKSG 509
           SNGSNVPFRAGDWKC  C YHNFAKN+VCLRC GPK+ 
Sbjct: 500 SNGSNVPFRAGDWKCANCTYHNFAKNVVCLRCGGPKTA 537

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 20/42 (47%), Gaps = 1/42 (2%)

Query: 321 PFPQSKNKP-RPGDWNCPSCGFSNFQRRTACFRCSFPQQQAV 361
           P     N P R GDW C +C + NF +   C RC  P+   V
Sbjct: 498 PMSNGSNVPFRAGDWKCANCTYHNFAKNVVCLRCGGPKTANV 539

 Score = 40.0 bits (92), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 17/29 (58%)

Query: 480 RAGDWKCLTCGYHNFAKNIVCLRCSGPKS 508
           R GDW C +C + NF +   C RCS P S
Sbjct: 365 RPGDWTCPSCSFSNFQRRTACFRCSFPMS 393

>Skud_4.90 Chr4 complement(156704..158827) [2124 bp, 707 aa] {ON}
           YDL167C (REAL)
          Length = 707

 Score =  414 bits (1064), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 212/383 (55%), Positives = 275/383 (71%), Gaps = 27/383 (7%)

Query: 1   MYYTLIELQTAHDAEAPKDHTKIINISYQFINQSTLQASFPDDKIPNIDCTTLPLSESIA 60
           M+Y ++ELQ A+  ++PKD  +I +I+YQ ++  TL   +  D +P I+      S   A
Sbjct: 1   MHYVVLELQVAYLPDSPKDQCRIGSIAYQIVDAETLICHYDIDSLPKIEVDGEAKSLESA 60

Query: 61  LLQKDLELNLPNGED-FVLCSLNSTWDLRVTISRQAKDEQYTLPTFFKYPRIFDLWKEFD 119
           ++Q D +++   G D FVL SL STW +RVT+SRQA+D+ + L ++ ++PR+FDLWKEFD
Sbjct: 61  MIQLDKDIHDVIGNDEFVLVSLCSTWHIRVTLSRQARDDGFILTSYLQHPRLFDLWKEFD 120

Query: 120 RWCVNHKELVQTRDP------------------RKLKDLKQLATLLHI--PSV------E 153
           RWCVNH EL++ R                    +  KD  ++  +L +  PS       E
Sbjct: 121 RWCVNHPELLEQRKATSNNNSNTKAGGSNGALAKNTKDFNEMIRILEVSTPSEGADFIPE 180

Query: 154 TLSSISLASKVLVQLHEKCTTEDDQEKVLTSPYDSKLDWDIFIETSSTVLYMNNLPPDTT 213
             S +   + +L+QLH+KC++ +D + VLT PYDS  D   F++  S VLYMNNLPPDTT
Sbjct: 181 EQSLLRRTTDILLQLHKKCSSPEDMKSVLTQPYDSYTDIRTFLQERSKVLYMNNLPPDTT 240

Query: 214 QSELETWFTQFGVRPIGFWTVKNILEDTSIINNNWCVNNSPYVEEIDSISGFIVFSTHKE 273
           QSELE+WFTQ+GVRP+GFWTVKNI+EDTS +NNNW +NNSPYVEE DSISGF+VF TH+E
Sbjct: 241 QSELESWFTQYGVRPVGFWTVKNIVEDTSNVNNNWSLNNSPYVEEQDSISGFVVFQTHEE 300

Query: 274 AIDVLTLNGHSILSNIANTKQPRVVEHVVEIQPSSPKVMERIQSILTPFPQSKNKPRPGD 333
           A +VL LNG SILSN+ANTKQPRVVEHV+E+QPSS  V+++ Q IL+PFPQSKNKPRPGD
Sbjct: 301 ATEVLALNGRSILSNLANTKQPRVVEHVLELQPSSTGVLDKAQEILSPFPQSKNKPRPGD 360

Query: 334 WNCPSCGFSNFQRRTACFRCSFP 356
           WNCPSCGFSNFQRRTACFRCSFP
Sbjct: 361 WNCPSCGFSNFQRRTACFRCSFP 383

 Score = 71.6 bits (174), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 27/32 (84%), Positives = 29/32 (90%)

Query: 477 VPFRAGDWKCLTCGYHNFAKNIVCLRCSGPKS 508
           +PFRAGDWKC TC YHNFAKN+VCLRC GPKS
Sbjct: 580 IPFRAGDWKCSTCTYHNFAKNVVCLRCGGPKS 611

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 17/27 (62%)

Query: 480 RAGDWKCLTCGYHNFAKNIVCLRCSGP 506
           R GDW C +CG+ NF +   C RCS P
Sbjct: 357 RPGDWNCPSCGFSNFQRRTACFRCSFP 383

 Score = 39.3 bits (90), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 12/28 (42%), Positives = 16/28 (57%)

Query: 330 RPGDWNCPSCGFSNFQRRTACFRCSFPQ 357
           R GDW C +C + NF +   C RC  P+
Sbjct: 583 RAGDWKCSTCTYHNFAKNVVCLRCGGPK 610

>KNAG0C03780 Chr3 (743477..745093) [1617 bp, 538 aa] {ON} Anc_7.349
           YDL167C
          Length = 538

 Score =  400 bits (1028), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 203/373 (54%), Positives = 263/373 (70%), Gaps = 13/373 (3%)

Query: 1   MYYTLIELQTAHDAEAPKDHTKIINISYQFINQSTLQA-SFPDDKIPNIDCTTLPLSESI 59
           M+Y LIELQ+    ++ KD TK+  + YQ I+  +L+      ++I  +      L +++
Sbjct: 1   MFYVLIELQSEQPRDSLKDQTKLKRLDYQIIDADSLEKRKINGNEIRQLAVEGSNLQDTV 60

Query: 60  ALLQKDLELNLPNGEDFVLCSLNSTWDLRVTISRQAKDEQYTLPTFFKYPRIFDLWKEFD 119
            L +K++  ++ NGE+FVLCS+ STW+LRV + R+A DEQ  LPT  KYP + DLWKEFD
Sbjct: 61  LLFEKEIN-SVINGEEFVLCSMFSTWELRVVLPREANDEQVELPTILKYPIVLDLWKEFD 119

Query: 120 RWCVNHKELVQTRDP--RKLKDLKQLATLLHI---------PSVETLSSISLASKVLVQL 168
           RWC NH + +Q+     RK K+L  +  +L +          +  T   + + S +L+QL
Sbjct: 120 RWCTNHPDALQSVKGYNRKCKNLPMVHQVLGVEQRLNESVNANGYTRKEVGITSDILLQL 179

Query: 169 HEKCTTEDDQEKVLTSPYDSKLDWDIFIETSSTVLYMNNLPPDTTQSELETWFTQFGVRP 228
           H+KC+++DD   VLT PY+SKLD++ F E  STVLY+NNLPPDTTQ ELETWF QFG RP
Sbjct: 180 HKKCSSDDDTNTVLTQPYNSKLDYETFTEEQSTVLYLNNLPPDTTQGELETWFGQFGSRP 239

Query: 229 IGFWTVKNILEDTSIINNNWCVNNSPYVEEIDSISGFIVFSTHKEAIDVLTLNGHSILSN 288
           + FWT KNI+EDTS INNNW +NNS YVEE DS+SGF  F T +EA + L L+G SILSN
Sbjct: 240 VSFWTFKNIVEDTSNINNNWNLNNSYYVEEQDSVSGFATFQTFEEAFNALKLSGRSILSN 299

Query: 289 IANTKQPRVVEHVVEIQPSSPKVMERIQSILTPFPQSKNKPRPGDWNCPSCGFSNFQRRT 348
           +ANTKQPR+VEHVVEI PSS +++   + IL+ FPQSKNKPRPGDWNCPSCGFSNFQRRT
Sbjct: 300 VANTKQPRIVEHVVEIHPSSARILHSSEEILSAFPQSKNKPRPGDWNCPSCGFSNFQRRT 359

Query: 349 ACFRCSFPQQQAV 361
           ACFRCSFP   AV
Sbjct: 360 ACFRCSFPVPSAV 372

 Score = 72.0 bits (175), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 29/32 (90%)

Query: 477 VPFRAGDWKCLTCGYHNFAKNIVCLRCSGPKS 508
           +PFRAGDWKC  C YHNFAKNI+CLRCSGPK+
Sbjct: 442 IPFRAGDWKCAACAYHNFAKNIICLRCSGPKT 473

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 17/27 (62%)

Query: 480 RAGDWKCLTCGYHNFAKNIVCLRCSGP 506
           R GDW C +CG+ NF +   C RCS P
Sbjct: 341 RPGDWNCPSCGFSNFQRRTACFRCSFP 367

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 17/28 (60%)

Query: 330 RPGDWNCPSCGFSNFQRRTACFRCSFPQ 357
           R GDW C +C + NF +   C RCS P+
Sbjct: 445 RAGDWKCAACAYHNFAKNIICLRCSGPK 472

>ACL149W Chr3 (88715..90601) [1887 bp, 628 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YDL167C (NRP1)
          Length = 628

 Score =  398 bits (1022), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 206/362 (56%), Positives = 251/362 (69%), Gaps = 5/362 (1%)

Query: 1   MYYTLIELQTAHDAEAPKDHTKIINISYQFINQSTLQASFPDDKIPNIDCTTLPLSESIA 60
           MYY L E   AH  + PKDH ++  I YQ I++  L   + D +   I+     +  +  
Sbjct: 1   MYYVLFECDVAHKEDTPKDHARVSKIYYQLIHEPELLPLYADAR--EIEVGGGGVQMATG 58

Query: 61  LLQKDLELNLPNGEDFVLCSLNSTWDLRVTISRQAKDEQYTLPTFFKYPRIFDLWKEFDR 120
            L+  L+      E FVLCSL+STW LRVT+ RQA DE   LP F  + ++FDLWKE DR
Sbjct: 59  QLEAALQ-EATASEPFVLCSLHSTWHLRVTLPRQAHDEGSMLPMFLAHAKVFDLWKECDR 117

Query: 121 WCVNHKELVQTRDPRKLKDLKQLATLLHI-PSVETLSSISLASKVLVQLHEKCTTEDDQE 179
           WC NH          K  D+ +L  +L +   + + + I  A++VL+QLH KCTT +DQ 
Sbjct: 118 WCANHVSERACNAGAK-GDVAELFRVLDLDEQLVSHAYIQQATRVLLQLHNKCTTAEDQS 176

Query: 180 KVLTSPYDSKLDWDIFIETSSTVLYMNNLPPDTTQSELETWFTQFGVRPIGFWTVKNILE 239
            VLT PYDS  D   FI+  S VLYMNNLPPDTTQSELE+WFTQFG RP+GFWTVKN++E
Sbjct: 177 LVLTHPYDSYADMTSFIQERSEVLYMNNLPPDTTQSELESWFTQFGARPVGFWTVKNVVE 236

Query: 240 DTSIINNNWCVNNSPYVEEIDSISGFIVFSTHKEAIDVLTLNGHSILSNIANTKQPRVVE 299
           DTS +NNNW  NNS YVEE DSISGF+VF +H+ A + L LNG SILSN+ANTKQPRVVE
Sbjct: 237 DTSNVNNNWSSNNSRYVEEHDSISGFVVFQSHEAASEALNLNGRSILSNMANTKQPRVVE 296

Query: 300 HVVEIQPSSPKVMERIQSILTPFPQSKNKPRPGDWNCPSCGFSNFQRRTACFRCSFPQQQ 359
           HVVE++PSS +V++  Q IL+PFPQSKNKPRPGDWNCPSCGFSNFQRR ACFRCSFP   
Sbjct: 297 HVVELKPSSSRVLDCAQEILSPFPQSKNKPRPGDWNCPSCGFSNFQRRIACFRCSFPATS 356

Query: 360 AV 361
           AV
Sbjct: 357 AV 358

 Score = 73.2 bits (178), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 29/35 (82%), Positives = 30/35 (85%)

Query: 475 SNVPFRAGDWKCLTCGYHNFAKNIVCLRCSGPKSG 509
           SNVPFRAGDWKCL C YHNFAKNIVCLRC  PK+ 
Sbjct: 499 SNVPFRAGDWKCLNCSYHNFAKNIVCLRCGNPKTA 533

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 15/29 (51%), Positives = 19/29 (65%)

Query: 480 RAGDWKCLTCGYHNFAKNIVCLRCSGPKS 508
           R GDW C +CG+ NF + I C RCS P +
Sbjct: 327 RPGDWNCPSCGFSNFQRRIACFRCSFPAT 355

 Score = 38.5 bits (88), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 19/34 (55%), Gaps = 1/34 (2%)

Query: 325 SKNKP-RPGDWNCPSCGFSNFQRRTACFRCSFPQ 357
           S N P R GDW C +C + NF +   C RC  P+
Sbjct: 498 SSNVPFRAGDWKCLNCSYHNFAKNIVCLRCGNPK 531

>KAFR0B00870 Chr2 (162698..164326) [1629 bp, 542 aa] {ON} Anc_7.349
           YDL167C
          Length = 542

 Score =  394 bits (1011), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 197/392 (50%), Positives = 255/392 (65%), Gaps = 47/392 (11%)

Query: 1   MYYTLIELQTAHDAEAPKDHTKIINISYQFINQSTLQASFP--------DDKIPNIDCTT 52
           M+Y ++EL T H  E PKDHT+I  +++Q +N + L    P        D++  +     
Sbjct: 1   MFYVILELDTLHQVETPKDHTRITKVTFQLVNANAL-GEVPTKVDQIVIDEQAESFKAAF 59

Query: 53  LPLSESIALLQKDLELNLPNGEDFVLCSLNSTWDLRVTISRQAKDEQYTLPTFFKYPRIF 112
             L+ESI  + +D          F+LCSL STWD+RVT++RQA+D   ++P F +YP+IF
Sbjct: 60  EKLNESITSITRD--------SSFILCSLFSTWDIRVTLNRQARDLGVSMPYFLQYPKIF 111

Query: 113 DLWKEFDRWCVNHKELVQTR----------------------------DPRKLKDLKQLA 144
           DL KE+ RWC+NH E++  +                            D    K+    A
Sbjct: 112 DLMKEYQRWCLNHPEVMSWKPKLESDKTINMDKKKLGLLELLTVLGLEDMYNFKEENDGA 171

Query: 145 TLLHIPSVETLSSISLASKVLVQLHEKCTTEDDQEKVLTSPYDSKLDWDIFIETSSTVLY 204
             +     +    +++++ VL+QL  +CTT DD + VLT PYDS  D   F++  S VLY
Sbjct: 172 --IDDKMFKNERDMTISTSVLLQLLIRCTTSDDTKNVLTCPYDSDTDVRSFLQERSRVLY 229

Query: 205 MNNLPPDTTQSELETWFTQFGVRPIGFWTVKNILEDTSIINNNWCVNNSPYVEEIDSISG 264
           MNNLP DTTQSELE+WFTQFG RP+GFWT KN++ DTS + N W  NNSPYVEE+DSI G
Sbjct: 230 MNNLPSDTTQSELESWFTQFGTRPVGFWTFKNVVGDTSSLANTWNSNNSPYVEELDSIPG 289

Query: 265 FIVFSTHKEAIDVLTLNGHSILSNIANTKQPRVVEHVVEIQPSSPKVMERIQSILTPFPQ 324
           F+VF TH+EAI+VL LNG +ILSN+ANTKQPRVVEHVVEIQPSS  V+++   IL+ FPQ
Sbjct: 290 FVVFQTHEEAIEVLALNGRAILSNVANTKQPRVVEHVVEIQPSSTSVLDKAHEILSSFPQ 349

Query: 325 SKNKPRPGDWNCPSCGFSNFQRRTACFRCSFP 356
           SKNKPRPGDW+CPSCGFSNFQRRTACFRCSFP
Sbjct: 350 SKNKPRPGDWSCPSCGFSNFQRRTACFRCSFP 381

 Score = 67.0 bits (162), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 23/33 (69%), Positives = 28/33 (84%)

Query: 477 VPFRAGDWKCLTCGYHNFAKNIVCLRCSGPKSG 509
           +PFRAGDW C +C YHNFAKN++CLRC GPK+ 
Sbjct: 455 IPFRAGDWNCASCTYHNFAKNVLCLRCGGPKTS 487

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 18/32 (56%)

Query: 330 RPGDWNCPSCGFSNFQRRTACFRCSFPQQQAV 361
           R GDWNC SC + NF +   C RC  P+   +
Sbjct: 458 RAGDWNCASCTYHNFAKNVLCLRCGGPKTSTI 489

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 17/27 (62%)

Query: 480 RAGDWKCLTCGYHNFAKNIVCLRCSGP 506
           R GDW C +CG+ NF +   C RCS P
Sbjct: 355 RPGDWSCPSCGFSNFQRRTACFRCSFP 381

>TPHA0F02960 Chr6 (651108..653072) [1965 bp, 654 aa] {ON} Anc_7.349
           YDL167C
          Length = 654

 Score =  388 bits (997), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 205/393 (52%), Positives = 255/393 (64%), Gaps = 43/393 (10%)

Query: 1   MYYTLIELQTAHDAEAPKDHTKIINISYQFINQSTLQASFPDD---KIPNIDCTTLPLSE 57
           MYY  +E +T H  E PKDHT+I+++SYQ IN       + +D    +   D   L L +
Sbjct: 1   MYYIFVETETLHKIETPKDHTQIVSLSYQLIN-----VEYKEDLSYDVKKNDVVILSLGD 55

Query: 58  SIA------------LLQKDLELNLPNGEDFVLCSLNSTWDLRVTISRQAKDEQYTLPTF 105
           S+A               +++E  + N E+ VLCSLNSTWDLRVTI RQ+ DE   LP+F
Sbjct: 56  SMANGDIMTFKDIIEQFSRNVEKTIGN-EEKVLCSLNSTWDLRVTIPRQSNDEGIILPSF 114

Query: 106 FKYPRIFDLWKEFDRWCVNHKELVQTRDPRKLKDLKQLATLLHI-------PSVETLSS- 157
            K P IFDLWKE+ RWC  H   + T   +K KD  +L  +L I        + E L+  
Sbjct: 115 LKLPIIFDLWKEYQRWCNLHFSEINTMKTKKYKDSSELYKILEINQNSDAKTNNEKLNDR 174

Query: 158 --------------ISLASKVLVQLHEKCTTEDDQEKVLTSPYDSKLDWDIFIETSSTVL 203
                         +     V + + +KC+T +D E VLT PY+S +D+  FI+ +S ++
Sbjct: 175 SGNINMDRGYKKNDVRSTVDVFMAIVDKCSTPEDHESVLTHPYNSNVDFQTFIQETSKII 234

Query: 204 YMNNLPPDTTQSELETWFTQFGVRPIGFWTVKNILEDTSIINNNWCVNNSPYVEEIDSIS 263
           YMNNLPPDTTQSELE+WF QFG++P   WTV+NILE TS  N+N   NNSPYVEE DSIS
Sbjct: 235 YMNNLPPDTTQSELESWFAQFGIKPARLWTVRNILESTSYTNSNGNSNNSPYVEEHDSIS 294

Query: 264 GFIVFSTHKEAIDVLTLNGHSILSNIANTKQPRVVEHVVEIQPSSPKVMERIQSILTPFP 323
           GF VF THKEA D L LNG SILSN+ANTKQPRVVEH+VE+QPSS  ++ERIQ I + FP
Sbjct: 295 GFAVFQTHKEATDALLLNGRSILSNMANTKQPRVVEHIVELQPSSMVILERIQEISSQFP 354

Query: 324 QSKNKPRPGDWNCPSCGFSNFQRRTACFRCSFP 356
           QSKNKPRPGDWNC SCGFSNFQRRT+CFRCSFP
Sbjct: 355 QSKNKPRPGDWNCMSCGFSNFQRRTSCFRCSFP 387

 Score = 71.6 bits (174), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 27/32 (84%), Positives = 28/32 (87%)

Query: 477 VPFRAGDWKCLTCGYHNFAKNIVCLRCSGPKS 508
           VPFRAGDWKC  C YHNFAKNIVCLRC GPK+
Sbjct: 547 VPFRAGDWKCSACSYHNFAKNIVCLRCGGPKT 578

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 19/32 (59%)

Query: 330 RPGDWNCPSCGFSNFQRRTACFRCSFPQQQAV 361
           R GDW C +C + NF +   C RC  P+ QA+
Sbjct: 550 RAGDWKCSACSYHNFAKNIVCLRCGGPKTQAI 581

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 19/29 (65%)

Query: 480 RAGDWKCLTCGYHNFAKNIVCLRCSGPKS 508
           R GDW C++CG+ NF +   C RCS P +
Sbjct: 361 RPGDWNCMSCGFSNFQRRTSCFRCSFPAA 389

>Kpol_530.32 s530 complement(78552..80606) [2055 bp, 684 aa] {ON}
           complement(78552..80606) [2055 nt, 685 aa]
          Length = 684

 Score =  359 bits (921), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 199/409 (48%), Positives = 254/409 (62%), Gaps = 54/409 (13%)

Query: 1   MYYTLIELQTAHDAEAPKDHTKIINISYQFINQSTLQASFPDDKIPNI---DCTTLPLSE 57
           MYY +IE  T H  E PKDHT+I  +SYQF++  +L+  +  D++  I   D + +   +
Sbjct: 1   MYYIVIETDTLHSVETPKDHTRISKLSYQFVDAESLECYYGKDEVKVISIDDESAISFKD 60

Query: 58  SIALLQKDLELNLPNGEDFVLCSLNSTWDLRVTISRQAKDEQYTLPTFFKYPRI------ 111
            I  L +D++  + + E FV CSLNS WDLRVTI RQA+DE  TLP + +  ++      
Sbjct: 61  MIKQLDEDIKTVVGDDE-FVFCSLNSVWDLRVTIPRQARDEIVTLPDYLQEVKVFDLWKE 119

Query: 112 FDLWKE---------------------------FDRWCVNHKELVQTRDPRKLKDLKQLA 144
           F+ W +                            ++  V  KE+ +  D          A
Sbjct: 120 FNRWAKNHSDTVTVKKSKNLRDLEELLRVLELTAEKTTVETKEIEENSDKEDEVHANTGA 179

Query: 145 TLLHIPSV-----------------ETLSSISLASKVLVQLHEKCTTEDDQEKVLTSPYD 187
                 ++                 ET   I+  +++L  +H+KCTTE+D   VLT PYD
Sbjct: 180 EESGNATITTAADDDNNEDDSKEMKETPLEINRVTEILTTIHKKCTTEEDITLVLTKPYD 239

Query: 188 SKLDWDIFIETSSTVLYMNNLPPDTTQSELETWFTQFGVRPIGFWTVKNILEDTSIINNN 247
           S  D+  F E +S +LYMNNLPPDTTQSELE+WF QFG +P+ FWTVKNI+E+TS +NNN
Sbjct: 240 SNSDFKAFKEEASKLLYMNNLPPDTTQSELESWFAQFGSKPVSFWTVKNIVEETSNVNNN 299

Query: 248 WCVNNSPYVEEIDSISGFIVFSTHKEAIDVLTLNGHSILSNIANTKQPRVVEHVVEIQPS 307
           W +NNSPYVEE DSISGF+ F +HKEA D L LNG SILSN+ANTKQPRVVEH+VEIQPS
Sbjct: 300 WSMNNSPYVEEQDSISGFVSFQSHKEATDALLLNGRSILSNMANTKQPRVVEHIVEIQPS 359

Query: 308 SPKVMERIQSILTPFPQSKNKPRPGDWNCPSCGFSNFQRRTACFRCSFP 356
           S  V+ER+Q I  PFPQSKNKPRPGDWNC SCGFSNFQRRTACFRCS+P
Sbjct: 360 SVTVLERVQDISAPFPQSKNKPRPGDWNCMSCGFSNFQRRTACFRCSYP 408

 Score = 73.9 bits (180), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 27/32 (84%), Positives = 29/32 (90%)

Query: 477 VPFRAGDWKCLTCGYHNFAKNIVCLRCSGPKS 508
           VPFRAGDWKC+ C YHNFAKN+VCLRC GPKS
Sbjct: 540 VPFRAGDWKCIACSYHNFAKNVVCLRCGGPKS 571

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 19/29 (65%)

Query: 480 RAGDWKCLTCGYHNFAKNIVCLRCSGPKS 508
           R GDW C++CG+ NF +   C RCS P +
Sbjct: 382 RPGDWNCMSCGFSNFQRRTACFRCSYPAA 410

 Score = 40.4 bits (93), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 12/30 (40%), Positives = 16/30 (53%)

Query: 330 RPGDWNCPSCGFSNFQRRTACFRCSFPQQQ 359
           R GDW C +C + NF +   C RC  P+  
Sbjct: 543 RAGDWKCIACSYHNFAKNVVCLRCGGPKSH 572

>NDAI0A01900 Chr1 complement(426743..428440) [1698 bp, 565 aa] {ON}
           Anc_7.349 YDL167C
          Length = 565

 Score =  310 bits (793), Expect = 8e-98,   Method: Compositional matrix adjust.
 Identities = 165/360 (45%), Positives = 232/360 (64%), Gaps = 12/360 (3%)

Query: 1   MYYTLIELQTAHDAEAPKDHTKIINISYQFIN--QSTLQASFPDDKIPNIDCTTLPLSES 58
           M+Y ++E+++ H+    KD T+IIN+SYQ +N   STL A    + + +I  +    +  
Sbjct: 1   MHYVVLEVESFHEEGTLKDQTRIINLSYQIVNIDDSTLLAQ--TNPVASIAISNDSENFQ 58

Query: 59  IALLQKDLELNLPNGE-DFVLCSLNSTWDLRVTISRQAKDEQYTLPTFFKYPRIFDLWKE 117
            AL+Q D ++    G+ +FV+C+LNS  +LRVT+ RQA D    LP + +YP++FDLW E
Sbjct: 59  DALVQLDSDIKTTIGQNEFVICTLNSLTNLRVTLRRQALDIGVNLPQYLRYPKLFDLWVE 118

Query: 118 FDRWCVNHKELVQTRDPRKLKDLKQLATLLHIPSVETLS-SISLASKVLVQLHEKCTTED 176
           F ++C NH EL    +    KD+  L  +L + S  T + +I +++ VL+ L++KC++ +
Sbjct: 119 FKKFCANHPELDLNEEMVTSKDVAILTDILGLQSNNTENYTIDISTDVLLSLYKKCSSSE 178

Query: 177 DQEKVLTSPYDSKLDWDIFIETSSTVLYMNNLPPDTTQSELETWFTQFGVRPIGFWTVKN 236
           D + VLT PYD ++D   F E  + V++++NLPPD TQ+ELETWF     +PI +WT K 
Sbjct: 179 DIKFVLTQPYDLQMDIKTFYEEEARVIFISNLPPDITQNELETWFANHNSKPICYWTSKT 238

Query: 237 ILEDTSIINNNWCVNNSPYVEEIDSISGFIVFSTHKEAIDVLTLNGHSILSNIANTKQPR 296
             E +   +NN       YV    SI GFI+F TH+EA   L LNG SI S+  + KQ  
Sbjct: 239 PDEYSRNFHNN------TYVMNQHSIIGFIIFQTHEEAKQSLLLNGKSISSSTLHMKQLY 292

Query: 297 VVEHVVEIQPSSPKVMERIQSILTPFPQSKNKPRPGDWNCPSCGFSNFQRRTACFRCSFP 356
            VEH++E+ PSS KV++  Q IL PFPQSKNKPR GDWNCPSCGFSNFQRRTACFRCSFP
Sbjct: 293 PVEHIIEVAPSSTKVLDHTQDILIPFPQSKNKPRLGDWNCPSCGFSNFQRRTACFRCSFP 352

 Score = 71.6 bits (174), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 28/37 (75%), Positives = 30/37 (81%)

Query: 471 ASNGSNVPFRAGDWKCLTCGYHNFAKNIVCLRCSGPK 507
             NGS+VPFRAGDWKC +C YHNFAKNI CLRC  PK
Sbjct: 440 TGNGSSVPFRAGDWKCPSCTYHNFAKNIACLRCGDPK 476

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 15/32 (46%), Positives = 19/32 (59%)

Query: 330 RPGDWNCPSCGFSNFQRRTACFRCSFPQQQAV 361
           R GDW CPSC + NF +  AC RC  P+   +
Sbjct: 449 RAGDWKCPSCTYHNFAKNIACLRCGDPKLSGI 480

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 17/27 (62%)

Query: 480 RAGDWKCLTCGYHNFAKNIVCLRCSGP 506
           R GDW C +CG+ NF +   C RCS P
Sbjct: 326 RLGDWNCPSCGFSNFQRRTACFRCSFP 352

>CAGL0I03344g Chr9 complement(285637..287448) [1812 bp, 603 aa] {ON}
           similar to uniprot|P32770 Saccharomyces cerevisiae
           YDL167c ARP1
          Length = 603

 Score =  246 bits (629), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 144/401 (35%), Positives = 215/401 (53%), Gaps = 59/401 (14%)

Query: 1   MYYTLIELQTAHDAEAPKDHTKIINISYQFINQSTLQASFPDDKIPNIDCTTLPLSESIA 60
           M+Y ++++Q    A  P     ++ + YQ I+  +L+A    ++   +D     + E IA
Sbjct: 1   MHYVVLDVQIDSSAVKPV----LLRLGYQVIDPVSLEAR---NEPYVVDVDGESIKEFIA 53

Query: 61  LLQKDLELNLP------------NGED----FVLCSLNSTWDLRVTISRQAKDEQYTLPT 104
            L +DL+ +              +G D    FV C+LN +W ++V +   A D    LP 
Sbjct: 54  KLDEDLKSHATVANHQESQDGSQSGSDVEKEFVFCTLNPSWSVKVGLVSSANDLGVELPE 113

Query: 105 FFKYPRIFDLWKEFDRWCVNH-----------------------KELVQTRD-PRKLKDL 140
           + +YP  FD+WKE+  W  NH                       +ELV+T D   +  +L
Sbjct: 114 YLRYPVFFDIWKEYSIWKKNHSDSSESPQTQANGESIDSFAGKIEELVRTLDVSTEYDEL 173

Query: 141 KQLATLLHIPSVETLSSISLASKVLVQLHEKCTTEDDQEKVLTSPYDSKLDWDIFIETSS 200
           KQ        + +    + LA+ VL  LH+KC T  D   VLT PYD  +D+  FIE  S
Sbjct: 174 KQ-------KNDDPTFDVRLATLVLTALHKKCVTPVDDTTVLTVPYDLGMDYKNFIEEQS 226

Query: 201 TVLYMNNLPPDTTQSELETWFTQFGVRPIGFWTVKNILEDTSIINNNWCVNNSPYVEEID 260
            +LY++N+P +  Q++LE WF Q GV  +GFWT+KNI +D ++ +     N+   +   D
Sbjct: 227 KILYISNIPSELNQTDLEGWFQQKGVASVGFWTLKNISDDATLASQR---NHGKMLSIPD 283

Query: 261 SISGFIVFSTHKEAIDVLTLNGHSILSNIANTKQPRVVEHVVEIQPSSPKVMERIQSILT 320
           S+ GF +F +H +A   L L  H  +  I   K  + +E +++IQPSS +++E++Q  L 
Sbjct: 284 SMFGFAIFQSHNDAEYALNL--HGTVMKIVAPKGNKHIEQLLDIQPSSMRLLEKVQDNLI 341

Query: 321 PFPQSKNKPRPGDWNCPSCGFSNFQRRTACFRCSFPQQQAV 361
             PQ+KNKPRPGDWNCPSCGFSNFQRRTACFRC+FP    V
Sbjct: 342 LLPQNKNKPRPGDWNCPSCGFSNFQRRTACFRCAFPVPNGV 382

 Score = 74.7 bits (182), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 30/35 (85%), Positives = 31/35 (88%)

Query: 474 GSNVPFRAGDWKCLTCGYHNFAKNIVCLRCSGPKS 508
           GSNVPFRAGDWKC  C YHNFAKNIVCLRC GPK+
Sbjct: 529 GSNVPFRAGDWKCPGCFYHNFAKNIVCLRCGGPKT 563

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 16/28 (57%)

Query: 330 RPGDWNCPSCGFSNFQRRTACFRCSFPQ 357
           R GDW CP C + NF +   C RC  P+
Sbjct: 535 RAGDWKCPGCFYHNFAKNIVCLRCGGPK 562

 Score = 40.8 bits (94), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 17/27 (62%)

Query: 480 RAGDWKCLTCGYHNFAKNIVCLRCSGP 506
           R GDW C +CG+ NF +   C RC+ P
Sbjct: 351 RPGDWNCPSCGFSNFQRRTACFRCAFP 377

>KLLA0B08976g Chr2 complement(786122..787039) [918 bp, 305 aa] {ON}
           similar to uniprot|P32605 Saccharomyces cerevisiae
           YBR119W MUD1 U1 snRNP A protein homolog of human U1-A
           involved in nuclear mRNA splicing
          Length = 305

 Score = 36.6 bits (83), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 24/46 (52%)

Query: 192 WDIFIETSSTVLYMNNLPPDTTQSELETWFTQFGVRPIGFWTVKNI 237
           +DI       VL + NLP D TQ ELE  F   G + +   +V+N+
Sbjct: 224 FDIVGNPPHHVLLVQNLPKDVTQQELEKLFVSDGFKEVRLVSVRNL 269

>SAKL0H17952g Chr8 complement(1599134..1600903) [1770 bp, 589 aa]
           {ON} highly similar to uniprot|P04147 Saccharomyces
           cerevisiae YER165W PAB1 Poly(A) binding protein part of
           the 3'-end RNA-processing complex mediates interactions
           between the 5' cap structure and the 3' mRNA poly(A)
           tail involved in control of poly(A) tail length
           interacts with translation factor eIF-4G
          Length = 589

 Score = 35.4 bits (80), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 29/50 (58%), Gaps = 3/50 (6%)

Query: 179 EKVLTSPYDSKLDWDIFIETSS---TVLYMNNLPPDTTQSELETWFTQFG 225
           ++V  +P+ SK D    +E +    T +Y+ N+  +TTQ E E  FTQFG
Sbjct: 196 QEVYVAPHVSKKDRQSKLEEAKSNFTNIYVKNIDLETTQEEFEALFTQFG 245

>Kpol_1039.50 s1039 complement(146455..147322,147425..147447) [891
           bp, 296 aa] {ON}
           complement(146455..147322,147425..147447) [891 nt, 297
           aa]
          Length = 296

 Score = 34.3 bits (77), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 13/45 (28%), Positives = 28/45 (62%)

Query: 193 DIFIETSSTVLYMNNLPPDTTQSELETWFTQFGVRPIGFWTVKNI 237
           D+ +  ++ +L + NLP  TT+ +L+  F Q G++ +   +V+N+
Sbjct: 217 DLSVNPANNILLVQNLPNGTTEVQLKELFAQTGLKEVRLVSVRNL 261

>NCAS0C05920 Chr3 (1218910..1219773) [864 bp, 287 aa] {ON} Anc_4.7
           YHL034C
          Length = 287

 Score = 34.3 bits (77), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 34/124 (27%), Positives = 55/124 (44%), Gaps = 8/124 (6%)

Query: 196 IETSSTVLYMNNLPPDTTQSELETWFTQFGVRPIGFWTVKNILED--TSIINNNWCVNNS 253
           +E S   LY+NNLP   T+ EL      FG +P      K  + D  T  +  +  +N  
Sbjct: 167 MERSKDTLYVNNLPYSATKEELAEL---FGTKPELVVLPKRRMRDETTKKVVFSETLNRG 223

Query: 254 PYVEEIDSISGFIVFSTHKEAIDVLTLNGHSILSNIANTKQPRVVEHVVEIQPSSPKVME 313
                 +++SG I  +  +E     TL    ++ ++A  K P+  EHV E  P + +  E
Sbjct: 224 IAFITFENLSGDI--ADKREEFQGKTLEERELVVDVAVVK-PKREEHVEEAHPDAEESHE 280

Query: 314 RIQS 317
             Q+
Sbjct: 281 EAQT 284

>TDEL0A00940 Chr1 complement(156781..158829) [2049 bp, 682 aa] {ON}
           Anc_2.52 YNL197C
          Length = 682

 Score = 33.9 bits (76), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 20/31 (64%), Gaps = 1/31 (3%)

Query: 202 VLYMNNLPPDTTQSELETWFT-QFGVRPIGF 231
            LY+ NLPPDTT+ EL   F+ Q G R + F
Sbjct: 554 TLYVGNLPPDTTEQELRHLFSGQQGFRRLSF 584

>TBLA0B00600 Chr2 complement(123569..125773) [2205 bp, 734 aa] {ON}
           Anc_2.52 YNL197C
          Length = 734

 Score = 33.1 bits (74), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 19/31 (61%), Gaps = 1/31 (3%)

Query: 202 VLYMNNLPPDTTQSELETWF-TQFGVRPIGF 231
            LY+ NLPPD T+ EL   F TQ G R + F
Sbjct: 609 TLYVGNLPPDATEQELRQLFSTQDGFRRLSF 639

>Kwal_23.4597 s23 complement(781763..783757) [1995 bp, 664 aa] {ON}
           YNL197C (WHI3) - Putative RNA binding protein [contig 5]
           FULL
          Length = 664

 Score = 33.1 bits (74), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 19/31 (61%), Gaps = 1/31 (3%)

Query: 202 VLYMNNLPPDTTQSELETWF-TQFGVRPIGF 231
            LY+ NLPPD T+ EL   F TQ G R + F
Sbjct: 546 TLYVGNLPPDATEHELRQLFSTQKGFRRLSF 576

>KLTH0B07546g Chr2 (609954..611873) [1920 bp, 639 aa] {ON} some
           similarities with Saccharomyces cerevisiae YDL224C WHI4
           and to uniprot|P34761 Saccharomyces cerevisiae YNL197C
           WHI3
          Length = 639

 Score = 33.1 bits (74), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 19/31 (61%), Gaps = 1/31 (3%)

Query: 202 VLYMNNLPPDTTQSELETWF-TQFGVRPIGF 231
            LY+ NLPPD T+ EL   F TQ G R + F
Sbjct: 522 TLYVGNLPPDATEHELRQLFSTQKGFRRLSF 552

>Kwal_56.23486 s56 complement(561558..563321) [1764 bp, 587 aa] {ON}
           YER165W (PAB1) - Poly(A) binding protein, cytoplasmic
           and nuclear [contig 176] FULL
          Length = 587

 Score = 32.7 bits (73), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 25/39 (64%), Gaps = 3/39 (7%)

Query: 188 SKLDWDIFIETSSTVLYMNNLPPDTTQSELETWFTQFGV 226
           SKLD    ++++ T +Y+ N+ P+T Q E E  F+Q+G 
Sbjct: 211 SKLDE---VKSNFTNVYVKNIDPETKQDEFEKLFSQYGA 246

>CAGL0G05401g Chr7 complement(508557..510572) [2016 bp, 671 aa] {ON}
           similar to uniprot|P34761 Saccharomyces cerevisiae
           YNL197c WHI3 involved in regulation of cell size
          Length = 671

 Score = 32.3 bits (72), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 19/31 (61%), Gaps = 1/31 (3%)

Query: 202 VLYMNNLPPDTTQSELETWFT-QFGVRPIGF 231
            LY+ NLP D T+ EL   F+ QFG R + F
Sbjct: 545 TLYVGNLPSDATEQELRQLFSNQFGFRRLSF 575

>CAGL0G05511g Chr7 complement(522026..524050) [2025 bp, 674 aa] {ON}
           similar to uniprot|P34761 Saccharomyces cerevisiae
           YNL197c WHI3 involved in regulation of cell size
          Length = 674

 Score = 32.3 bits (72), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 21/36 (58%), Gaps = 1/36 (2%)

Query: 202 VLYMNNLPPDTTQSELETWFT-QFGVRPIGFWTVKN 236
            LY+ NLPPDT++ EL   F+ Q G R + F    N
Sbjct: 559 TLYVGNLPPDTSEQELRQLFSPQPGFRRLSFKNKNN 594

>KLTH0F09922g Chr6 (858143..862984) [4842 bp, 1613 aa] {ON} similar
           to uniprot|Q12674 Saccharomyces cerevisiae YMR162C DNF3
           Non-essential P-type ATPase that is a potential
           aminophospholipid translocase localizes to the
           trans-Golgi likely involved in protein transport
          Length = 1613

 Score = 32.7 bits (73), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 30/134 (22%), Positives = 52/134 (38%), Gaps = 21/134 (15%)

Query: 235 KNILEDTSIINNNWCVNNSPYVEEIDSISGFIVFSTHKEAIDVLTLNGHSILSNIANTKQ 294
           K +    S+  ++W  +N P  +E+D        S   + IDV++++  S L N  N+  
Sbjct: 551 KMVFRGLSVCGSSWVHDNDPQEQELDRTE-----SNESKTIDVVSVDDRSFLKNFQNSDG 605

Query: 295 PRVVEHVVE---------IQPSSPKVMERIQSILTPFPQSKNKPRP-GDWNCPSCGFSNF 344
            +V               I    P +  R+QS+      S     P GD      G +N 
Sbjct: 606 NQVQRQRTSVDFKGNSSAIYTGRPSIASRVQSMRNSMEDSSKVREPSGD------GENNK 659

Query: 345 QRRTACFRCSFPQQ 358
           + R++     + QQ
Sbjct: 660 EARSSAELIHYIQQ 673

>NDAI0C02340 Chr3 (533251..534414) [1164 bp, 387 aa] {ON} Anc_3.74
           YNL286W
          Length = 387

 Score = 32.3 bits (72), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 12/26 (46%), Positives = 18/26 (69%)

Query: 201 TVLYMNNLPPDTTQSELETWFTQFGV 226
           T +Y++NLP D T+ EL   FT +G+
Sbjct: 131 TSIYISNLPKDITEDELIREFTHYGI 156

>NDAI0H03850 Chr8 (943316..945544) [2229 bp, 742 aa] {ON} Anc_2.52
           YDL224C
          Length = 742

 Score = 32.0 bits (71), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 20/31 (64%), Gaps = 1/31 (3%)

Query: 202 VLYMNNLPPDTTQSELETWFT-QFGVRPIGF 231
            LY+ NLPPD T++EL   F+ Q G R + F
Sbjct: 627 TLYVGNLPPDATENELRQLFSCQNGFRRLSF 657

>ABL158C Chr2 complement(102437..104626) [2190 bp, 729 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL224C
           (WHI4) and YNL197C (WHI3)
          Length = 729

 Score = 32.0 bits (71), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 19/31 (61%), Gaps = 1/31 (3%)

Query: 202 VLYMNNLPPDTTQSELETWF-TQFGVRPIGF 231
            LY+ NLPPD T+ EL   F +Q G R + F
Sbjct: 608 TLYVGNLPPDATEQELRQLFSSQKGFRRLSF 638

>Skud_12.23 Chr12 complement(37510..38280) [771 bp, 256 aa] {ON}
           YLL046C (REAL)
          Length = 256

 Score = 31.6 bits (70), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 35/152 (23%), Positives = 57/152 (37%), Gaps = 20/152 (13%)

Query: 169 HEKCTTEDDQEKVLTSPYDSKLDWDIFIETSSTVLYMNNLPPDTTQSELETWFTQFGVRP 228
            E+  +ED+   + T P         F   S+  LY+ N+P  ++  EL      FGV P
Sbjct: 115 REEKRSEDNNNHINTKPESDTKSNSGFKALSTHTLYVKNIPMKSSNEELAEI---FGVAP 171

Query: 229 IGFWTVKNILEDTSIINNNWCVNNSPYVEEIDSISGFIVFSTHKEAIDV----------L 278
                VK  L D          N + + +E  +   FI F   +   D+           
Sbjct: 172 RNINFVKRQLVD-------LRTNKAFFSDEFHTGEAFIKFDNLRAKDDIQKKCQEFQGQK 224

Query: 279 TLNGHSILSNIANTKQPRVVEHVVEIQPSSPK 310
             NG  +L  +A+ K+    + V +I+    K
Sbjct: 225 ASNGRVLLVKVASAKKNEQDQKVKDIEKIKQK 256

>CAGL0D05236g Chr4 (499006..500337) [1332 bp, 443 aa] {ON} weakly
           similar to uniprot|P43607 Saccharomyces cerevisiae
           YFR032c
          Length = 443

 Score = 31.6 bits (70), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 22/39 (56%)

Query: 199 SSTVLYMNNLPPDTTQSELETWFTQFGVRPIGFWTVKNI 237
           S   +Y   LP +TT ++L  +FT +G R I  +  KN+
Sbjct: 181 SEDTVYCAFLPKETTDNDLRNYFTDYGSREIWIFRTKNV 219

>Ecym_6441 Chr6 (856251..858320) [2070 bp, 689 aa] {ON} similar to
           Ashbya gossypii ABL158C
          Length = 689

 Score = 32.0 bits (71), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 19/31 (61%), Gaps = 1/31 (3%)

Query: 202 VLYMNNLPPDTTQSELETWF-TQFGVRPIGF 231
            LY+ NLPPD T+ EL   F +Q G R + F
Sbjct: 568 TLYVGNLPPDATEQELRQLFSSQKGFRRLSF 598

>TPHA0I00420 Chr9 (82903..84300) [1398 bp, 465 aa] {ON} Anc_8.822
           YMR268C
          Length = 465

 Score = 31.6 bits (70), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 26/107 (24%), Positives = 48/107 (44%), Gaps = 8/107 (7%)

Query: 126 KELVQTRDPRKLKDL-KQLATLLHIPSVETLSSISLASKVLVQLHEKCTTEDDQEKVLTS 184
           K L ++ +  K+K + K    +LHI + E L  +   +++  + HE           LT 
Sbjct: 53  KNLPKSFNQGKIKKIFKDCGNILHIETAEPLDKVFRYARIEFEAHENALM------ALTK 106

Query: 185 PYDSKLDWDI-FIETSSTVLYMNNLPPDTTQSELETWFTQFGVRPIG 230
                 D +I  I   +  +++ N PP  T ++++  F + GV PI 
Sbjct: 107 TNKKYGDNEIEVIVLQNMTVWITNFPPSFTVNDIKNLFLENGVVPIS 153

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.133    0.412 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 48,604,643
Number of extensions: 2006077
Number of successful extensions: 6365
Number of sequences better than 10.0: 56
Number of HSP's gapped: 6567
Number of HSP's successfully gapped: 115
Length of query: 564
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 449
Effective length of database: 40,294,809
Effective search space: 18092369241
Effective search space used: 18092369241
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 68 (30.8 bits)