Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0E020407.342ON70132215070.0
Smik_4.757.342ON4602506142e-71
TDEL0C020507.342ON5012496093e-70
Skud_4.947.342ON4472515923e-68
Suva_4.837.342ON4622515741e-65
YDL161W (ENT1)7.342ON4542515713e-65
ZYRO0F11550g7.342ON5382525764e-65
KNAG0C038007.342ON4472495695e-65
TPHA0D045607.342ON4872495602e-63
NCAS0H006707.342ON4832525575e-63
Skud_12.2707.342ON6262715666e-63
Smik_12.2647.342ON6122235612e-62
CAGL0A03872g7.342ON5102535421e-60
KAFR0L014607.342ON5502575451e-60
TBLA0E004807.342ON5992695437e-60
Suva_10.3007.342ON6182225351e-58
YLR206W (ENT2)7.342ON6132235332e-58
Kwal_56.246107.342ON5082175211e-57
Kpol_2001.707.342ON5332525161e-56
SAKL0F10934g7.342ON4982555122e-56
Ecym_47317.342ON5142165105e-56
KNAG0B026507.342ON6462535097e-55
NDAI0D006107.342ON4861894701e-50
KAFR0B008907.342ON4142424535e-49
ACL157C7.342ON5152174581e-48
KLTH0H01430g7.342ON5022644517e-48
KLLA0C16731g7.342ON4782564312e-45
Smik_10.4184.346ON4091432409e-21
Suva_12.2164.346ON4101432391e-20
KLTH0D16896g4.346ON4011432391e-20
YJR125C (ENT3)4.346ON4081432363e-20
Skud_10.3494.346ON4101432355e-20
NCAS0A062104.346ON4231432321e-19
Kpol_1001.24.346ON4181432311e-19
KAFR0B067404.346ON3991432283e-19
SAKL0G17952g4.346ON4151432266e-19
Kwal_47.168574.346ON3821432231e-18
TDEL0D007104.346ON3751432221e-18
KLLA0B04587g4.346ON4001432231e-18
NDAI0D032004.346ON4351432222e-18
TPHA0B004004.346ON3991432203e-18
KNAG0M003804.346ON4031352185e-18
ZYRO0B14784g4.346ON4241432195e-18
TBLA0E047604.346ON4261602151e-17
AER155C4.346ON3641432132e-17
Ecym_11334.346ON3921532105e-17
CAGL0H04323g4.346ON4121431902e-14
SAKL0H25762g4.17ON2621451711e-12
ACL061C4.17ON2341651673e-12
Kpol_388.54.17ON2681481657e-12
TBLA0G006504.17ON4231341591e-10
Suva_10.354.17ON2471401532e-10
TDEL0G017404.17ON2571481514e-10
Skud_12.304.17ON2471401452e-09
TPHA0F002304.17ON2801331453e-09
ZYRO0G07876g4.17ON2591531418e-09
Kwal_55.206114.17ON2541451382e-08
TBLA0B062204.346ON3391391393e-08
CAGL0E03806g4.17ON2601261363e-08
Ecym_84074.17ON2541461321e-07
KLTH0E05874g4.17ON2551351302e-07
YLL038C (ENT4)4.17ON2471091293e-07
Smik_12.194.17ON2471101274e-07
KLLA0D03949g4.17ON2251201256e-07
NCAS0C058404.17ON2671331223e-06
NDAI0H002804.17ON3101701206e-06
KLTH0B04554g5.84ON6861041064e-04
KAFR0I014604.17ON2751161045e-04
Kwal_33.148995.84ON685107940.013
Suva_15.153.5ON110484930.019
Kpol_344.88.335ON384181890.040
Skud_15.93.5ON108383900.041
NDAI0J009308.335ON418180890.043
KNAG0K026303.5ON107672880.063
NCAS0B036608.335ON416180860.10
ZYRO0F13508g5.84ON68776860.12
Smik_15.93.5ON107773860.12
Smik_8.2455.84ON62740830.24
TDEL0G010805.84ON51540820.26
TPHA0A052105.84ON63252820.33
NDAI0C032805.84ON71966800.53
TDEL0A002403.5ON105972790.72
YHR161C (YAP1801)5.84ON63784780.90
TDEL0E038705.239ON67376771.3
TPHA0P015903.5ON107782771.4
Smik_11.1832.603ON20758732.0
Skud_10.1885.239ON68274752.3
ZYRO0F13684g8.335ON407103742.3
YJL034W (KAR2)5.239ON68274752.5
NDAI0C023105.239ON68574752.5
Smik_10.2385.239ON68374742.7
KAFR0J010605.239ON71872743.1
KAFR0B058008.335ON38296733.1
Skud_11.1642.603ON20758713.4
Kpol_1036.768.335ON368179733.4
Suva_11.1602.603ON20758714.0
CAGL0J11572g3.149ON460119724.1
KAFR0E016505.239ON68172734.2
NCAS0A012205.239ON68374724.7
KNAG0F026205.239ON68372725.5
Kwal_YGOB_27.112618.335ON404165707.0
Kpol_1004.115.239ON68572717.1
Suva_12.475.239ON68374708.3
Suva_2.6871.52ON112854709.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0E02040
         (701 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0E02040 Chr5 complement(494899..497004) [2106 bp, 701 aa] {O...   585   0.0  
Smik_4.75 Chr4 (144483..145865) [1383 bp, 460 aa] {ON} YDL161W (...   241   2e-71
TDEL0C02050 Chr3 (355071..356576) [1506 bp, 501 aa] {ON} Anc_7.3...   239   3e-70
Skud_4.94 Chr4 (163372..164715) [1344 bp, 447 aa] {ON} YDL161W (...   232   3e-68
Suva_4.83 Chr4 (155278..156666) [1389 bp, 462 aa] {ON} YDL161W (...   225   1e-65
YDL161W Chr4 (167714..169078) [1365 bp, 454 aa] {ON}  ENT1Epsin-...   224   3e-65
ZYRO0F11550g Chr6 complement(947131..948747) [1617 bp, 538 aa] {...   226   4e-65
KNAG0C03800 Chr3 (746891..748234) [1344 bp, 447 aa] {ON} Anc_7.3...   223   5e-65
TPHA0D04560 Chr4 complement(994552..996015) [1464 bp, 487 aa] {O...   220   2e-63
NCAS0H00670 Chr8 (117595..119046) [1452 bp, 483 aa] {ON} Anc_7.342    219   5e-63
Skud_12.270 Chr12 (501192..503072) [1881 bp, 626 aa] {ON} YLR206...   222   6e-63
Smik_12.264 Chr12 (501598..503436) [1839 bp, 612 aa] {ON} YLR206...   220   2e-62
CAGL0A03872g Chr1 complement(392922..394454) [1533 bp, 510 aa] {...   213   1e-60
KAFR0L01460 Chr12 complement(270433..272085) [1653 bp, 550 aa] {...   214   1e-60
TBLA0E00480 Chr5 complement(88019..89818) [1800 bp, 599 aa] {ON}...   213   7e-60
Suva_10.300 Chr10 (527412..529268) [1857 bp, 618 aa] {ON} YLR206...   210   1e-58
YLR206W Chr12 (554578..556419) [1842 bp, 613 aa] {ON}  ENT2Epsin...   209   2e-58
Kwal_56.24610 s56 complement(1073855..1075381) [1527 bp, 508 aa]...   205   1e-57
Kpol_2001.70 s2001 complement(192214..193815) [1602 bp, 533 aa] ...   203   1e-56
SAKL0F10934g Chr6 (856966..858462) [1497 bp, 498 aa] {ON} some s...   201   2e-56
Ecym_4731 Chr4 (1427875..1429419) [1545 bp, 514 aa] {ON} similar...   201   5e-56
KNAG0B02650 Chr2 (511995..513935) [1941 bp, 646 aa] {ON} Anc_7.3...   200   7e-55
NDAI0D00610 Chr4 (133678..135138) [1461 bp, 486 aa] {ON} Anc_7.3...   185   1e-50
KAFR0B00890 Chr2 (166365..167609) [1245 bp, 414 aa] {ON} Anc_7.3...   179   5e-49
ACL157C Chr3 complement(79325..80872) [1548 bp, 515 aa] {ON} Syn...   181   1e-48
KLTH0H01430g Chr8 (132738..134246) [1509 bp, 502 aa] {ON} some s...   178   7e-48
KLLA0C16731g Chr3 complement(1463616..1465052) [1437 bp, 478 aa]...   170   2e-45
Smik_10.418 Chr10 complement(643833..645062) [1230 bp, 409 aa] {...    97   9e-21
Suva_12.216 Chr12 complement(334254..335486) [1233 bp, 410 aa] {...    97   1e-20
KLTH0D16896g Chr4 complement(1395711..1396916) [1206 bp, 401 aa]...    97   1e-20
YJR125C Chr10 complement(654737..655963) [1227 bp, 408 aa] {ON} ...    96   3e-20
Skud_10.349 Chr10 complement(613398..614630) [1233 bp, 410 aa] {...    95   5e-20
NCAS0A06210 Chr1 complement(1229758..1231029) [1272 bp, 423 aa] ...    94   1e-19
Kpol_1001.2 s1001 (8057..9313) [1257 bp, 418 aa] {ON} (8057..931...    94   1e-19
KAFR0B06740 Chr2 (1406075..1407274) [1200 bp, 399 aa] {ON} Anc_4...    92   3e-19
SAKL0G17952g Chr7 complement(1555520..1556767) [1248 bp, 415 aa]...    92   6e-19
Kwal_47.16857 s47 (145176..146324) [1149 bp, 382 aa] {ON} YJR125...    91   1e-18
TDEL0D00710 Chr4 (127174..128301) [1128 bp, 375 aa] {ON} Anc_4.3...    90   1e-18
KLLA0B04587g Chr2 (411097..412299) [1203 bp, 400 aa] {ON} simila...    91   1e-18
NDAI0D03200 Chr4 complement(764129..765436) [1308 bp, 435 aa] {O...    90   2e-18
TPHA0B00400 Chr2 (83356..84555) [1200 bp, 399 aa] {ON} Anc_4.346...    89   3e-18
KNAG0M00380 Chr13 (56675..57886) [1212 bp, 403 aa] {ON} Anc_4.34...    89   5e-18
ZYRO0B14784g Chr2 complement(1205944..1207218) [1275 bp, 424 aa]...    89   5e-18
TBLA0E04760 Chr5 complement(1226806..1228086) [1281 bp, 426 aa] ...    87   1e-17
AER155C Chr5 complement(929042..930136) [1095 bp, 364 aa] {ON} S...    87   2e-17
Ecym_1133 Chr1 (274069..275247) [1179 bp, 392 aa] {ON} similar t...    86   5e-17
CAGL0H04323g Chr8 (407884..409122) [1239 bp, 412 aa] {ON} simila...    78   2e-14
SAKL0H25762g Chr8 (2256842..2257630) [789 bp, 262 aa] {ON} some ...    70   1e-12
ACL061C Chr3 complement(256803..257507) [705 bp, 234 aa] {ON} Sy...    69   3e-12
Kpol_388.5 s388 complement(17825..18631) [807 bp, 268 aa] {ON} c...    68   7e-12
TBLA0G00650 Chr7 (140678..141949) [1272 bp, 423 aa] {ON} Anc_4.1...    66   1e-10
Suva_10.35 Chr10 complement(70188..70931) [744 bp, 247 aa] {ON} ...    64   2e-10
TDEL0G01740 Chr7 (342371..343144) [774 bp, 257 aa] {ON} Anc_4.17...    63   4e-10
Skud_12.30 Chr12 complement(56967..57710) [744 bp, 247 aa] {ON} ...    60   2e-09
TPHA0F00230 Chr6 complement(43589..44431) [843 bp, 280 aa] {ON} ...    60   3e-09
ZYRO0G07876g Chr7 complement(636468..637247) [780 bp, 259 aa] {O...    59   8e-09
Kwal_55.20611 s55 complement(489968..490732) [765 bp, 254 aa] {O...    58   2e-08
TBLA0B06220 Chr2 (1466908..1467927) [1020 bp, 339 aa] {ON} Anc_4...    58   3e-08
CAGL0E03806g Chr5 (356594..357376) [783 bp, 260 aa] {ON} similar...    57   3e-08
Ecym_8407 Chr8 (843359..844123) [765 bp, 254 aa] {ON} similar to...    55   1e-07
KLTH0E05874g Chr5 complement(530814..531581) [768 bp, 255 aa] {O...    55   2e-07
YLL038C Chr12 complement(65775..66518) [744 bp, 247 aa] {ON}  EN...    54   3e-07
Smik_12.19 Chr12 complement(50134..50877) [744 bp, 247 aa] {ON} ...    54   4e-07
KLLA0D03949g Chr4 (333566..334243) [678 bp, 225 aa] {ON} similar...    53   6e-07
NCAS0C05840 Chr3 (1202292..1203095) [804 bp, 267 aa] {ON} Anc_4....    52   3e-06
NDAI0H00280 Chr8 complement(48177..49109) [933 bp, 310 aa] {ON} ...    51   6e-06
KLTH0B04554g Chr2 (367962..370022) [2061 bp, 686 aa] {ON} weakly...    45   4e-04
KAFR0I01460 Chr9 (304865..305692) [828 bp, 275 aa] {ON} Anc_4.17...    45   5e-04
Kwal_33.14899 s33 complement(863727..865784) [2058 bp, 685 aa] {...    41   0.013
Suva_15.15 Chr15 complement(27309..30623) [3315 bp, 1104 aa] {ON...    40   0.019
Kpol_344.8 s344 complement(20765..21919) [1155 bp, 384 aa] {ON} ...    39   0.040
Skud_15.9 Chr15 complement(14799..18050) [3252 bp, 1083 aa] {ON}...    39   0.041
NDAI0J00930 Chr10 (209579..210835) [1257 bp, 418 aa] {ON} Anc_8....    39   0.043
KNAG0K02630 Chr11 (523259..526489) [3231 bp, 1076 aa] {ON} Anc_3...    39   0.063
NCAS0B03660 Chr2 complement(653627..654877) [1251 bp, 416 aa] {O...    38   0.10 
ZYRO0F13508g Chr6 complement(1114200..1116263) [2064 bp, 687 aa]...    38   0.12 
Smik_15.9 Chr15 complement(17702..20935) [3234 bp, 1077 aa] {ON}...    38   0.12 
Smik_8.245 Chr8 complement(397342..399225) [1884 bp, 627 aa] {ON...    37   0.24 
TDEL0G01080 Chr7 (220997..222544) [1548 bp, 515 aa] {ON} Anc_5.8...    36   0.26 
TPHA0A05210 Chr1 complement(1173573..1175471) [1899 bp, 632 aa] ...    36   0.33 
NDAI0C03280 Chr3 complement(745118..747277) [2160 bp, 719 aa] {O...    35   0.53 
TDEL0A00240 Chr1 complement(39383..42562) [3180 bp, 1059 aa] {ON...    35   0.72 
YHR161C Chr8 complement(420373..422286) [1914 bp, 637 aa] {ON}  ...    35   0.90 
TDEL0E03870 Chr5 complement(726712..728733) [2022 bp, 673 aa] {O...    34   1.3  
TPHA0P01590 Chr16 (328049..331282) [3234 bp, 1077 aa] {ON} Anc_3...    34   1.4  
Smik_11.183 Chr11 complement(302731..303354) [624 bp, 207 aa] {O...    33   2.0  
Skud_10.188 Chr10 (349263..351311) [2049 bp, 682 aa] {ON} YJL034...    33   2.3  
ZYRO0F13684g Chr6 complement(1125731..1126954) [1224 bp, 407 aa]...    33   2.3  
YJL034W Chr10 (381327..383375) [2049 bp, 682 aa] {ON}  KAR2ATPas...    33   2.5  
NDAI0C02310 Chr3 (524786..526843) [2058 bp, 685 aa] {ON} Anc_5.239     33   2.5  
Smik_10.238 Chr10 (377586..379637) [2052 bp, 683 aa] {ON} YJL034...    33   2.7  
KAFR0J01060 Chr10 (195020..197176) [2157 bp, 718 aa] {ON} Anc_5....    33   3.1  
KAFR0B05800 Chr2 complement(1200666..1201814) [1149 bp, 382 aa] ...    33   3.1  
Skud_11.164 Chr11 complement(296221..296844) [624 bp, 207 aa] {O...    32   3.4  
Kpol_1036.76 s1036 complement(205197..206303) [1107 bp, 368 aa] ...    33   3.4  
Suva_11.160 Chr11 complement(299168..299791) [624 bp, 207 aa] {O...    32   4.0  
CAGL0J11572g Chr10 complement(1124993..1126375) [1383 bp, 460 aa...    32   4.1  
KAFR0E01650 Chr5 complement(337914..339959) [2046 bp, 681 aa] {O...    33   4.2  
NCAS0A01220 Chr1 (238768..240819) [2052 bp, 683 aa] {ON} Anc_5.239     32   4.7  
KNAG0F02620 Chr6 complement(491602..493653) [2052 bp, 683 aa] {O...    32   5.5  
Kwal_YGOB_27.11261 s27 complement(716644..717033,717035..717859)...    32   7.0  
Kpol_1004.11 s1004 (21688..23745) [2058 bp, 685 aa] {ON} (21688....    32   7.1  
Suva_12.47 Chr12 (64212..66263) [2052 bp, 683 aa] {ON} YJL034W (...    32   8.3  
Suva_2.687 Chr2 complement(1215095..1218481) [3387 bp, 1128 aa] ...    32   9.2  

>TBLA0E02040 Chr5 complement(494899..497004) [2106 bp, 701 aa] {ON}
           Anc_7.342 YLR206W
          Length = 701

 Score =  585 bits (1507), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/322 (89%), Positives = 288/322 (89%)

Query: 380 SRPESGSNNPFALEKEEQDSGSNNPFSLTNYNTGXXXXXXXXXXXXKYDSPQTSPVSPNE 439
           SRPESGSNNPFALEKEEQDSGSNNPFSLTNYNTG            KYDSPQTSPVSPNE
Sbjct: 380 SRPESGSNNPFALEKEEQDSGSNNPFSLTNYNTGTTTTTAAAATTAKYDSPQTSPVSPNE 439

Query: 440 GLNLINANSNFTHMPMEEEGRSVSASTNAYSNGNAYTNASYVHGTNTSYLTQNTLPTAST 499
           GLNLINANSNFTHMPMEEEGRSVSASTNAYSNGNAYTNASYVHGTNTSYLTQNTLPTAST
Sbjct: 440 GLNLINANSNFTHMPMEEEGRSVSASTNAYSNGNAYTNASYVHGTNTSYLTQNTLPTAST 499

Query: 500 YQSSYSTGHEFTSSNINSSPLQNSKYVLHDHDHDFVSRDSELVSRNSELVSHDQELLSHN 559
           YQSSYSTGHEFTSSNINSSPLQNSKYVLHDHDHDFVSRDSELVSRNSELVSHDQELLSHN
Sbjct: 500 YQSSYSTGHEFTSSNINSSPLQNSKYVLHDHDHDFVSRDSELVSRNSELVSHDQELLSHN 559

Query: 560 NELSSQDDPFSNMHXXXXXXXXXXXXXXXXXXQPMHTGNSVISAKYSNLNQLLAQGTGID 619
           NELSSQDDPFSNMH                  QPMHTGNSVISAKYSNLNQLLAQGTGID
Sbjct: 560 NELSSQDDPFSNMHTLLPTNNNTNPSPSSSPLQPMHTGNSVISAKYSNLNQLLAQGTGID 619

Query: 620 TFGNEGATRIPAQHTKTGTFINSQGTGYKQVTXXXXPIPLLPTQYTGLPAQTAVHVPSPS 679
           TFGNEGATRIPAQHTKTGTFINSQGTGYKQVT    PIPLLPTQYTGLPAQTAVHVPSPS
Sbjct: 620 TFGNEGATRIPAQHTKTGTFINSQGTGYKQVTSSSSPIPLLPTQYTGLPAQTAVHVPSPS 679

Query: 680 PLQPSEKEHQTQQTQGFTLVDL 701
           PLQPSEKEHQTQQTQGFTLVDL
Sbjct: 680 PLQPSEKEHQTQQTQGFTLVDL 701

 Score =  513 bits (1320), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 241/241 (100%), Positives = 241/241 (100%)

Query: 1   MSHQFVRSTKNMFKGYSPTQVLVRDATANNDSGTSIDVLDQLGEMSYDTHEFRDIFSVLD 60
           MSHQFVRSTKNMFKGYSPTQVLVRDATANNDSGTSIDVLDQLGEMSYDTHEFRDIFSVLD
Sbjct: 1   MSHQFVRSTKNMFKGYSPTQVLVRDATANNDSGTSIDVLDQLGEMSYDTHEFRDIFSVLD 60

Query: 61  RRISDKPKYWRHVAKSLTVVDYLVRFGSEACVQWARDNARQLEILRDFYYSDSAGIDQGQ 120
           RRISDKPKYWRHVAKSLTVVDYLVRFGSEACVQWARDNARQLEILRDFYYSDSAGIDQGQ
Sbjct: 61  RRISDKPKYWRHVAKSLTVVDYLVRFGSEACVQWARDNARQLEILRDFYYSDSAGIDQGQ 120

Query: 121 LIRVKAAELIDLLRDPERLATERGMNMRGRRNALPPRRMGPHRRPSMPRRPEDEEDVDRA 180
           LIRVKAAELIDLLRDPERLATERGMNMRGRRNALPPRRMGPHRRPSMPRRPEDEEDVDRA
Sbjct: 121 LIRVKAAELIDLLRDPERLATERGMNMRGRRNALPPRRMGPHRRPSMPRRPEDEEDVDRA 180

Query: 181 LEESKKTAEEDEARRRKDQEREKQDLKEAVKLSKEEDELKRLQDEANNKPQYFDENGNPI 240
           LEESKKTAEEDEARRRKDQEREKQDLKEAVKLSKEEDELKRLQDEANNKPQYFDENGNPI
Sbjct: 181 LEESKKTAEEDEARRRKDQEREKQDLKEAVKLSKEEDELKRLQDEANNKPQYFDENGNPI 240

Query: 241 S 241
           S
Sbjct: 241 S 241

>Smik_4.75 Chr4 (144483..145865) [1383 bp, 460 aa] {ON} YDL161W
           (REAL)
          Length = 460

 Score =  241 bits (614), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 124/250 (49%), Positives = 170/250 (68%), Gaps = 20/250 (8%)

Query: 1   MSHQFVRSTKNMFKGYSPTQVLVRDATANNDSGTSIDVLDQLGEMSYDTHEFRDIFSVLD 60
           MS QFVRS KN+ KGYS TQVLVR+AT+N++   S D L +L E SYD+ +F +I  +LD
Sbjct: 1   MSKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLD 60

Query: 61  RRISDKPKYWRHVAKSLTVVDYLVRFGSEACVQWARDNARQLEILRDFYYSDSAGIDQGQ 120
           +R++DK KYWRH+AK+LTV+DYL+RFGSE CV W ++N   ++ L++F + D  GIDQGQ
Sbjct: 61  KRLNDKGKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHEDDEGIDQGQ 120

Query: 121 LIRVKAAELIDLLRDPERLATERGMNMRGRRNALPPRRMGPHRRPSMPRRPEDEEDVDRA 180
           ++RVK+ EL  LL D ERL  ER MN++GR       R G  RR +     +++ D+ RA
Sbjct: 121 IVRVKSKELTALLSDDERLNEERNMNIKGR------NRKGRSRRGTGRSSNDNDNDLQRA 174

Query: 181 LEESKKTAEEDEARRRKDQEREKQDLKEAVKLSKEEDELKRLQD---------EANNKPQ 231
           L+ S+ TAEEDE RR+ D     +D + A++LSKEE+ELKRLQD         +   +P 
Sbjct: 175 LDASRMTAEEDEKRRKMD-----EDYETALQLSKEEEELKRLQDLQRMQQLQTQQQQQPM 229

Query: 232 YFDENGNPIS 241
           Y+D  GNPI+
Sbjct: 230 YYDIFGNPIT 239

 Score =  108 bits (270), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 56/109 (51%), Positives = 68/109 (62%), Gaps = 3/109 (2%)

Query: 596 TGNSVISAKYSNLNQLLAQGTGIDTFGNEGATRIPAQHTKTGTFINSQGTGYKQVTXXXX 655
           TGN  ++ KY+ LN+LLA GTGIDTFGN G  R+PAQHTKTGTFINSQGTGYKQV+    
Sbjct: 352 TGNQSMTDKYNKLNELLATGTGIDTFGNVGDARVPAQHTKTGTFINSQGTGYKQVSNDPK 411

Query: 656 PIPLLPTQYTGLPAQTAVHVPSPSPLQPSEKEHQTQQ---TQGFTLVDL 701
             P L  QYTGLP+   V   +        ++         QG+ L+DL
Sbjct: 412 YNPFLSGQYTGLPSTNVVPTQTGYGFGNQPQQQSQNNHLNNQGYALIDL 460

>TDEL0C02050 Chr3 (355071..356576) [1506 bp, 501 aa] {ON} Anc_7.342
           YLR206W
          Length = 501

 Score =  239 bits (609), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 132/249 (53%), Positives = 166/249 (66%), Gaps = 15/249 (6%)

Query: 1   MSHQFVRSTKNMFKGYSPTQVLVRDATANNDSGTSIDVLDQLGEMSYDTHEFRDIFSVLD 60
           MS QFVRS KN+ KGYS  QVLVR+ATAN   G S+D LD+L E +YD+ EF +I  ++D
Sbjct: 1   MSKQFVRSAKNVVKGYSSAQVLVRNATANESEGPSVDELDELAEKTYDSVEFFEIMDMID 60

Query: 61  RRISDKPKYWRHVAKSLTVVDYLVRFGSEACVQWARDNARQLEILRDFYYSDSAGIDQGQ 120
           +R++DK KYWRH+AKSLTV+DYLVRFGSE CV W R+N   ++ L +F   D  G+DQGQ
Sbjct: 61  KRLNDKGKYWRHIAKSLTVLDYLVRFGSENCVLWCRENLYVIKTLMEFRNDDDGGVDQGQ 120

Query: 121 LIRVKAAELIDLLRDPERLATERGMNMRGRRNALPPRRMGPHRRPSMPRRPEDEEDVDRA 180
           +IRVKA EL +LL D ERL  ER MN +GR+N    RR     +         ++D+ RA
Sbjct: 121 IIRVKAKELTNLLSDDERLREEREMNRKGRKNGTRRRRRTTGEQDGF------DDDLQRA 174

Query: 181 LEESKKTAEEDEARRRKDQEREKQDLKEAVKLSKEEDELKRL--------QDEANNKPQY 232
           L+ES+ TAEEDE RRRK    E  DL+ A++LSKEE+ELKRL        Q       QY
Sbjct: 175 LDESRLTAEEDE-RRRKMLGSEDDDLQAALQLSKEEEELKRLQEMQKLQQQQTQQQPSQY 233

Query: 233 FDENGNPIS 241
           +D  GNPIS
Sbjct: 234 YDIFGNPIS 242

 Score =  112 bits (279), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 51/82 (62%), Positives = 61/82 (74%)

Query: 592 QPMHTGNSVISAKYSNLNQLLAQGTGIDTFGNEGATRIPAQHTKTGTFINSQGTGYKQVT 651
           +P+ TG+  ++ KY  LN+LLA GTGIDTFGN G  RIPAQHTKTGTFINSQGTGY+QVT
Sbjct: 387 KPVRTGDLAMTEKYGELNKLLATGTGIDTFGNTGDARIPAQHTKTGTFINSQGTGYRQVT 446

Query: 652 XXXXPIPLLPTQYTGLPAQTAV 673
                 P L +QYTG+P+   V
Sbjct: 447 GEPKKNPFLQSQYTGIPSSNIV 468

>Skud_4.94 Chr4 (163372..164715) [1344 bp, 447 aa] {ON} YDL161W
           (REAL)
          Length = 447

 Score =  232 bits (592), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 123/251 (49%), Positives = 170/251 (67%), Gaps = 22/251 (8%)

Query: 1   MSHQFVRSTKNMFKGYSPTQVLVRDATANNDSGTSIDVLDQLGEMSYDTHEFRDIFSVLD 60
           MS QFVRS KN+ KGYS TQVLVR+AT+N++   S D L +L E SYD+ +F +I  +LD
Sbjct: 1   MSKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLD 60

Query: 61  RRISDKPKYWRHVAKSLTVVDYLVRFGSEACVQWARDNARQLEILRDFYYSDSAGIDQGQ 120
           +R++DK KYWRH+AK+LTV+DYL+RFGSE CV W ++N   ++ L++F + D  G+DQGQ
Sbjct: 61  KRLNDKGKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHEDDEGVDQGQ 120

Query: 121 LIRVKAAELIDLLRDPERLATERGMNMRGRRNALPPRRMGPHRRPSMPRRPEDEEDVDRA 180
           ++RVKA EL  LL D ERL  ER MN++GR            +R    R  ED++D+ RA
Sbjct: 121 IVRVKAKELTTLLSDDERLNEERNMNIKGRSRK-------GRKRRGTGRNDEDDDDLQRA 173

Query: 181 LEESKKTAEEDEARRRKDQEREKQDLKEAVKLSKEEDELKRLQD----------EANNKP 230
           ++ S+ TAEEDE RR++D     +D + A++LSKEE+ELKRLQD          +   +P
Sbjct: 174 IDASRMTAEEDERRRKQD-----EDYETALQLSKEEEELKRLQDLQRMQQVHAQQQQQQP 228

Query: 231 QYFDENGNPIS 241
            Y+D  GNPI+
Sbjct: 229 MYYDIFGNPIT 239

 Score =  110 bits (276), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 56/109 (51%), Positives = 71/109 (65%), Gaps = 3/109 (2%)

Query: 596 TGNSVISAKYSNLNQLLAQGTGIDTFGNEGATRIPAQHTKTGTFINSQGTGYKQVTXXXX 655
           TGN  ++ KY  LN+LLA GTGIDTFGN G +R+PAQHTKTGTFINSQGTGY+QV+    
Sbjct: 339 TGNQSMTDKYGKLNELLATGTGIDTFGNVGDSRVPAQHTKTGTFINSQGTGYRQVSNDPK 398

Query: 656 PIPLLPTQYTGLPAQTAVHVPSPSPLQPSEKEHQTQQ---TQGFTLVDL 701
             P L +QYTGLP+   V   +        ++        +QG+TL+DL
Sbjct: 399 QNPFLNSQYTGLPSTNIVPTQTGYGFGNQPQQQSQNNRSNSQGYTLIDL 447

>Suva_4.83 Chr4 (155278..156666) [1389 bp, 462 aa] {ON} YDL161W
           (REAL)
          Length = 462

 Score =  225 bits (574), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 122/251 (48%), Positives = 168/251 (66%), Gaps = 22/251 (8%)

Query: 1   MSHQFVRSTKNMFKGYSPTQVLVRDATANNDSGTSIDVLDQLGEMSYDTHEFRDIFSVLD 60
           MS Q VRS KN+ KGYS TQVLVR+AT+N+++  S D L +L E SYD+ +F +I  +LD
Sbjct: 1   MSKQLVRSAKNLVKGYSSTQVLVRNATSNDNNQVSKDSLIELAEKSYDSADFFEIMDMLD 60

Query: 61  RRISDKPKYWRHVAKSLTVVDYLVRFGSEACVQWARDNARQLEILRDFYYSDSAGIDQGQ 120
           +R++DK KYWRH+AK+LTV+DYL+RFGSE CV W ++N   ++ L++F + D  G DQGQ
Sbjct: 61  KRLNDKGKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHDDDEGTDQGQ 120

Query: 121 LIRVKAAELIDLLRDPERLATERGMNMRGRRNALPPRRMGPHRRPSMPRRPEDEEDVDRA 180
           ++RVKA EL  LL D ERL  ER MN++GR            RR    R  ED++D+ RA
Sbjct: 121 IVRVKAKELTSLLSDEERLNEERNMNIKGRNRGG-------RRRRRTNRSSEDDDDLQRA 173

Query: 181 LEESKKTAEEDEARRRKDQEREKQDLKEAVKLSKEEDELKRLQD----------EANNKP 230
           ++ S+ TA+EDE RR++D     +D + A++LSKEE+ELKRLQD          +   +P
Sbjct: 174 IDASRMTADEDERRRKQD-----EDYETALQLSKEEEELKRLQDLQRIQAQQQQQQQQQP 228

Query: 231 QYFDENGNPIS 241
            Y D  GNPI+
Sbjct: 229 MYCDIFGNPIT 239

 Score =  114 bits (284), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 60/112 (53%), Positives = 73/112 (65%), Gaps = 7/112 (6%)

Query: 595 HTGNSVISAKYSNLNQLLAQGTGIDTFGNEGATRIPAQHTKTGTFINSQGTGYKQVTXXX 654
            TGN  ++ KYS LN+LL  GTGIDTFGN G TR+PAQHTKTGTFINSQGTGY+QV+   
Sbjct: 353 RTGNQSMTDKYSKLNELLGTGTGIDTFGNFGDTRVPAQHTKTGTFINSQGTGYRQVSNDP 412

Query: 655 XPIPLLPTQYTGLPAQTAVHVPSPSPLQPSEKEHQTQQT-----QGFTLVDL 701
              P L +QYTGLP+     VP+ +      +  Q  QT     QG+ L+DL
Sbjct: 413 KHNPFLNSQYTGLPSTNV--VPAQTGYGFGNQPQQQSQTNGTNSQGYALIDL 462

>YDL161W Chr4 (167714..169078) [1365 bp, 454 aa] {ON}
           ENT1Epsin-like protein involved in endocytosis and actin
           patch assembly and functionally redundant with Ent2p;
           binds clathrin via a clathrin-binding domain motif at
           C-terminus
          Length = 454

 Score =  224 bits (571), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 123/251 (49%), Positives = 167/251 (66%), Gaps = 22/251 (8%)

Query: 1   MSHQFVRSTKNMFKGYSPTQVLVRDATANNDSGTSIDVLDQLGEMSYDTHEFRDIFSVLD 60
           MS QFVRS KN+ KGYS TQVLVR+AT+N++   S D L +L E SYD+ +F +I  +LD
Sbjct: 1   MSKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLD 60

Query: 61  RRISDKPKYWRHVAKSLTVVDYLVRFGSEACVQWARDNARQLEILRDFYYSDSAGIDQGQ 120
           +R++DK KYWRH+AK+LTV+DYL+RFGSE CV W R+N   ++ L++F + D  GIDQGQ
Sbjct: 61  KRLNDKGKYWRHIAKALTVIDYLIRFGSENCVLWCRENLYIIKTLKEFRHEDDEGIDQGQ 120

Query: 121 LIRVKAAELIDLLRDPERLATERGMNMRGRRNALPPRRMGPHRRPSMPRRPEDEEDVDRA 180
           ++RVKA EL  LL D ERL  ER MN++GR            RR    R  E+++D+ RA
Sbjct: 121 IVRVKAKELTALLSDDERLNEERNMNIKGRNRK-------GRRRRGTGRSDENDDDLQRA 173

Query: 181 LEESKKTAEEDEARRRKDQEREKQDLKEAVKLSKEEDELKRL----------QDEANNKP 230
           +  S+ TAEEDE RR++D     +D + A++LSKEE+ELKRL            +   +P
Sbjct: 174 ISASRLTAEEDERRRKQD-----EDYETALQLSKEEEELKRLQDLQRMQQQQGQQQLQQP 228

Query: 231 QYFDENGNPIS 241
            Y+D  GNPI+
Sbjct: 229 MYYDIFGNPIT 239

 Score =  111 bits (278), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 57/109 (52%), Positives = 72/109 (66%), Gaps = 3/109 (2%)

Query: 596 TGNSVISAKYSNLNQLLAQGTGIDTFGNEGATRIPAQHTKTGTFINSQGTGYKQVTXXXX 655
           TGN  ++ KYS LN+LLA GTGIDTFGN G  RIPAQHTKTGTFINSQGTGY+QV+    
Sbjct: 346 TGNQSMTDKYSKLNELLATGTGIDTFGNVGEARIPAQHTKTGTFINSQGTGYRQVSDDPN 405

Query: 656 PIPLLPTQYTGLPAQTAVHVPSPSPL---QPSEKEHQTQQTQGFTLVDL 701
             P L +QYTGLP+ + V   +          + ++     +G+TL+DL
Sbjct: 406 HNPFLNSQYTGLPSTSVVPTQTGYGFGNQSQQQSQNNGSNNRGYTLIDL 454

>ZYRO0F11550g Chr6 complement(947131..948747) [1617 bp, 538 aa] {ON}
           some similarities with uniprot|Q12518 Saccharomyces
           cerevisiae YDL161W ENT1
          Length = 538

 Score =  226 bits (576), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 128/252 (50%), Positives = 162/252 (64%), Gaps = 19/252 (7%)

Query: 1   MSHQFVRSTKNMFKGYSPTQVLVRDATANNDSGTSIDVLDQLGEMSYDTHEFRDIFSVLD 60
           M  QFVRS KN  KGY+  QVLVRDATAN   G S+D+LD+L   SYD+ EF +I  ++D
Sbjct: 1   MPTQFVRSAKNALKGYTSAQVLVRDATANEVEGPSVDMLDELAHRSYDSVEFFEIMDMID 60

Query: 61  RRISDKPKYWRHVAKSLTVVDYLVRFGSEACVQWARDNARQLEILRDFYYSDSAGIDQGQ 120
           +R++DK KYWRHVAKSLTV+DYLVRFGSE CV W R+N   ++ LR+F + D    D GQ
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENLYIIKTLREFRHDDDGTQDGGQ 120

Query: 121 LIRVKAAELIDLLRDPERLATERGMNMRGRRNALPPRRMGPHRRPSMPRRPEDEEDVDRA 180
           +IRVKA EL +LL D ERL  ERG +       +          P  PRR   + ++ RA
Sbjct: 121 IIRVKAKELTNLLMDDERLRMERGEDKGAPPRMM-------SPSPPTPRRNSYDSEMQRA 173

Query: 181 LEESKKTAEEDEARRRKDQEREKQDLKEAVKLSKEEDELKRLQD----------EANNKP 230
           L+ S+ TAEEDE RRRK    E  DL+ A++LSKEE+ELKRLQ+           +  +P
Sbjct: 174 LDASRLTAEEDE-RRRKTLNNEDADLETALQLSKEEEELKRLQELQKAQQDQQRLSQMQP 232

Query: 231 Q-YFDENGNPIS 241
           Q Y+D  GNPIS
Sbjct: 233 QGYYDIFGNPIS 244

 Score =  116 bits (290), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 54/82 (65%), Positives = 63/82 (76%)

Query: 592 QPMHTGNSVISAKYSNLNQLLAQGTGIDTFGNEGATRIPAQHTKTGTFINSQGTGYKQVT 651
           QP+ TGN  IS KY++LNQLLAQ TG+DTFGN G  RIPAQHTKTGTFINSQGTG+KQ +
Sbjct: 421 QPVRTGNQSISDKYNDLNQLLAQPTGVDTFGNVGDARIPAQHTKTGTFINSQGTGFKQYS 480

Query: 652 XXXXPIPLLPTQYTGLPAQTAV 673
                 P LPTQ+TG+P  + V
Sbjct: 481 NEPKKNPFLPTQFTGIPTSSVV 502

>KNAG0C03800 Chr3 (746891..748234) [1344 bp, 447 aa] {ON} Anc_7.342
           YLR206W
          Length = 447

 Score =  223 bits (569), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 126/249 (50%), Positives = 169/249 (67%), Gaps = 21/249 (8%)

Query: 5   FVRSTKNMFKGYSPTQVLVRDATANNDSGTSIDVLDQLGEMSYDTHEFRDIFSVLDRRIS 64
            +RS KN+ KGYS T+VLVRDATANN +  S ++LD L + SY++ EF +I  +LD+RI+
Sbjct: 1   MLRSAKNIVKGYSDTEVLVRDATANNSTNPSRELLDDLADKSYNSVEFFEILDMLDKRIN 60

Query: 65  DKPKYWRHVAKSLTVVDYLVRFGSEACVQWARDNARQLEILRDFYYSDSAGIDQGQLIRV 124
           DK KYWRHVAK+LTV+DYLVRFGSE CV W ++N   ++ LR+F + D+ G D+G++IRV
Sbjct: 61  DKGKYWRHVAKALTVLDYLVRFGSENCVIWCQENLYIIKTLREFSHEDAGGEDEGKIIRV 120

Query: 125 KAAELIDLLRDPERLATERGMNMRGRRNALPPRRMGPHRRP--SMPRRPEDEEDVDRALE 182
           KA EL  LL D ERL  ER MN+R        RR GP RR   S  R    +ED+ RA+E
Sbjct: 121 KAKELTSLLMDEERLKEERAMNIR--------RRGGPKRRSGGSRERNNRSDEDLQRAIE 172

Query: 183 ESKKTAEEDEARRRKDQEREKQDLKEAVKLSKEEDELKRLQDEAN----------NKPQY 232
           ESK+TAEE+E RRR     E  D + A++LS+EE++L+RLQ++A            +P Y
Sbjct: 173 ESKRTAEEEERRRRNGASSEA-DRQAALQLSREEEDLRRLQEQARLAQQQQQQQQQQPMY 231

Query: 233 FDENGNPIS 241
           +D  GNPI+
Sbjct: 232 YDVFGNPIT 240

 Score =  110 bits (274), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 53/79 (67%), Positives = 57/79 (72%)

Query: 595 HTGNSVISAKYSNLNQLLAQGTGIDTFGNEGATRIPAQHTKTGTFINSQGTGYKQVTXXX 654
            +GN  IS KYS LN LLA GTGIDTFGN G  RIPAQHT+TGTFINSQGTGY+QV    
Sbjct: 339 RSGNQAISDKYSALNNLLASGTGIDTFGNTGEQRIPAQHTQTGTFINSQGTGYRQVNNDD 398

Query: 655 XPIPLLPTQYTGLPAQTAV 673
            P P L  QYTGLP+   V
Sbjct: 399 KPNPFLNGQYTGLPSTNIV 417

>TPHA0D04560 Chr4 complement(994552..996015) [1464 bp, 487 aa] {ON}
           Anc_7.342 YLR206W
          Length = 487

 Score =  220 bits (560), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 125/249 (50%), Positives = 166/249 (66%), Gaps = 20/249 (8%)

Query: 1   MSHQFVRSTKNMFKGYSPTQVLVRDATANNDSGTSIDVLDQLGEMSYDTHEFRDIFSVLD 60
           MS+QFVRS KN+ KGYS TQVLVR+ATAN  +G +ID+L  + E +YD+ +F +I  +LD
Sbjct: 1   MSNQFVRSMKNVVKGYSSTQVLVRNATANEGTGPNIDLLADIAEKTYDSADFFEIMDMLD 60

Query: 61  RRISDKPKYWRHVAKSLTVVDYLVRFGSEACVQWARDNARQLEILRDFYYSD--SAGIDQ 118
           +R++DK KYW+H+AKSLTV+DYLVRFGSE CV W ++N   ++ L +F Y D  S G+DQ
Sbjct: 61  KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYLIKTLTEFRYEDENSGGVDQ 120

Query: 119 GQLIRVKAAELIDLLRDPERLATERGMNMRGRRNALPPRRMGPHRRPSMPRRPEDEEDVD 178
           GQ+IRVKA EL  LL D          + R R       R   +R    P R   +ED+ 
Sbjct: 121 GQIIRVKAKELTALLMD----------DERLREERRLNNRRDRNRNRRPPARNGSDEDLQ 170

Query: 179 RALEESKKTAEEDEARRRKDQEREKQDLKEAVKLSKEEDELKRLQD------EANNKPQY 232
           RALEES++TAEEDE +RR +Q  +  DL+ A++LSKEE+ELKRLQ+          +P Y
Sbjct: 171 RALEESRRTAEEDERKRRLNQ--DDSDLQAALQLSKEEEELKRLQELQSSMHMQQQQPVY 228

Query: 233 FDENGNPIS 241
           +D  GNPIS
Sbjct: 229 YDVFGNPIS 237

 Score =  107 bits (266), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 50/79 (63%), Positives = 58/79 (73%)

Query: 595 HTGNSVISAKYSNLNQLLAQGTGIDTFGNEGATRIPAQHTKTGTFINSQGTGYKQVTXXX 654
            TGN  ++ KY+ LNQLLA GTGIDTFGN G TRIPAQHT+TGTFINSQGTGY+Q +   
Sbjct: 375 RTGNKEMTNKYNELNQLLASGTGIDTFGNTGETRIPAQHTQTGTFINSQGTGYRQQSGES 434

Query: 655 XPIPLLPTQYTGLPAQTAV 673
              P L  QYTGLP+   +
Sbjct: 435 KVNPFLSNQYTGLPSSNII 453

>NCAS0H00670 Chr8 (117595..119046) [1452 bp, 483 aa] {ON} Anc_7.342
          Length = 483

 Score =  219 bits (557), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 130/252 (51%), Positives = 172/252 (68%), Gaps = 11/252 (4%)

Query: 1   MSHQFVRSTKNMFKGYSPTQVLVRDATANNDSGTSIDVLDQLGEMSYDTHEFRDIFSVLD 60
           MS QFVRS KNM KGYS TQVLVRDAT+N+ S  S ++L +L + S+D+ +F +I  +LD
Sbjct: 1   MSKQFVRSAKNMVKGYSTTQVLVRDATSNDASNPSFELLYELAQRSFDSVDFFEIMDMLD 60

Query: 61  RRISDKPKYWRHVAKSLTVVDYLVRFGSEACVQWARDNARQLEILRDFYYSDSAGIDQGQ 120
           +R++DK KYWRHVAKSLTV+DYLVRFGSE CV W ++N   ++ LR+F + D  G DQGQ
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDDGGADQGQ 120

Query: 121 LIRVKAAELIDLLRDPERLATERGMNMRGRRNALPPRRMGPHRRPSMPRRPEDEEDVDRA 180
           +IRVKA EL  LL D ERL  ER +N++ RR+     R       +     ED++++ RA
Sbjct: 121 IIRVKAKELTSLLLDEERLKEERTINLKNRRDGDMKGRRRRRGTRNGRGNDEDQDELQRA 180

Query: 181 LEESKKTAEEDEARRRKDQEREKQ--DLKEAVKLSKEEDELKRLQDEANNKPQ------- 231
           LEES+ TAEEDE RRR+  + + Q  DL+ A++LSKEE+ELK+LQ+    + Q       
Sbjct: 181 LEESRLTAEEDERRRRQMAQYDDQDPDLQTALQLSKEEEELKKLQEMQRLQQQQGQMNQP 240

Query: 232 --YFDENGNPIS 241
             YFD  GNPIS
Sbjct: 241 QGYFDIFGNPIS 252

 Score =  115 bits (288), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 75/114 (65%), Gaps = 7/114 (6%)

Query: 595 HTGNSVISAKYSNLNQLLAQGTGIDTFGNEGATRIPAQHTKTGTFINSQGTGYKQVTXXX 654
            TGN  I+ KYS LN LLA GTGIDTFGN G  RIPAQHT+TGTFINSQGTGY+QVT   
Sbjct: 370 RTGNQSITDKYSQLNTLLATGTGIDTFGNTGEQRIPAQHTQTGTFINSQGTGYRQVTNDP 429

Query: 655 XPIPLLPTQYTGLPAQTAVHVP-------SPSPLQPSEKEHQTQQTQGFTLVDL 701
              P L +QYTGLP+   V          +PS  Q  +++ Q +  QGF+L+DL
Sbjct: 430 KNNPFLNSQYTGLPSTNIVSTQTGYGFGNAPSQQQQQQQQQQQRPDQGFSLIDL 483

>Skud_12.270 Chr12 (501192..503072) [1881 bp, 626 aa] {ON} YLR206W
           (REAL)
          Length = 626

 Score =  222 bits (566), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 129/271 (47%), Positives = 169/271 (62%), Gaps = 31/271 (11%)

Query: 1   MSHQFVRSTKNMFKGYSPTQVLVRDATANNDSGTSIDVLDQLGEMSYDTHEFRDIFSVLD 60
           M  QFVRS KNM KGYS TQVLVRDATAN+    SID LD L + SYD+ +F +I  +LD
Sbjct: 1   MPKQFVRSAKNMVKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60

Query: 61  RRISDKPKYWRHVAKSLTVVDYLVRFGSEACVQWARDNARQLEILRDFYYSDSAGIDQGQ 120
           +R++DK KYWRHVAKSLTV+DYLVRFGSE CV W R+N   ++ LR+F + + +G D+GQ
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120

Query: 121 LIRVKAAELIDLLRDPERLATERGMNMRGRRNALPPRRMGPHRR--PSMPR--RPEDEED 176
           +IRVKA EL+ LL D ERL  ER MN R R     P R GP R+   S PR   P  +++
Sbjct: 121 IIRVKAKELVSLLNDDERLREERSMNTRNRGANKAP-RPGPRRQRTGSNPRDSSPSYQDE 179

Query: 177 VDRALEESKKTAEEDEARRRK--DQEREKQDLKEAVKLS----------------KEEDE 218
           +++ LEES+ TA+EDE RRR+    + E  D + A++LS                K++  
Sbjct: 180 LEKVLEESRITAQEDEQRRRELAQYDDEDPDFQAALQLSKEEEELKQLQELQRLQKQQQP 239

Query: 219 LKRL--------QDEANNKPQYFDENGNPIS 241
           L ++        Q +    P Y+D  GNPIS
Sbjct: 240 LSQMPVPVQQQQQQQQQQLPAYYDIFGNPIS 270

 Score =  110 bits (276), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 54/79 (68%), Positives = 58/79 (73%)

Query: 595 HTGNSVISAKYSNLNQLLAQGTGIDTFGNEGATRIPAQHTKTGTFINSQGTGYKQVTXXX 654
            TGN  IS KY++LN LLA GTG+DTFGN G  RIPAQHTKTGTFINSQGTGYKQVT   
Sbjct: 455 RTGNQSISDKYNDLNVLLATGTGLDTFGNTGEARIPAQHTKTGTFINSQGTGYKQVTSEP 514

Query: 655 XPIPLLPTQYTGLPAQTAV 673
              P L  QYTGLP+   V
Sbjct: 515 KNNPFLSNQYTGLPSTNIV 533

>Smik_12.264 Chr12 (501598..503436) [1839 bp, 612 aa] {ON} YLR206W
           (REAL)
          Length = 612

 Score =  220 bits (561), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 117/223 (52%), Positives = 149/223 (66%), Gaps = 15/223 (6%)

Query: 1   MSHQFVRSTKNMFKGYSPTQVLVRDATANNDSGTSIDVLDQLGEMSYDTHEFRDIFSVLD 60
           MS QFVRS KNM KGYS TQVLVRDATAN+    SID LD L + SYD+ +F +I  +LD
Sbjct: 1   MSKQFVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60

Query: 61  RRISDKPKYWRHVAKSLTVVDYLVRFGSEACVQWARDNARQLEILRDFYYSDSAGIDQGQ 120
           +R++DK KYWRHVAKSLTV+DYLVRFGSE CV W R+N   ++ LR+F + + +G D+GQ
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120

Query: 121 LIRVKAAELIDLLRDPERLATERGMNMRGRRNALPPRRM--------GPHRRPSMPRRPE 172
           +IRVKA EL+ LL D ERL  ER MN R RR+    R           PH        P 
Sbjct: 121 IIRVKAKELVSLLNDDERLREERSMNTRNRRDRSAARPRPRRQRTRSNPH-----DSSPS 175

Query: 173 DEEDVDRALEESKKTAEEDEARRRK--DQEREKQDLKEAVKLS 213
            + D+++ALEES+ TA+EDE RRR+    + E  D + A++LS
Sbjct: 176 YQNDLEKALEESRITAQEDEQRRRELAQYDDEDPDFQAALQLS 218

 Score =  108 bits (270), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 53/78 (67%), Positives = 56/78 (71%)

Query: 596 TGNSVISAKYSNLNQLLAQGTGIDTFGNEGATRIPAQHTKTGTFINSQGTGYKQVTXXXX 655
           TGN  IS KY++LN LLA GTG DTFGN G  RIPAQHTKTGTFINSQGTGYKQV     
Sbjct: 431 TGNQSISDKYNDLNTLLATGTGTDTFGNTGEARIPAQHTKTGTFINSQGTGYKQVINEPK 490

Query: 656 PIPLLPTQYTGLPAQTAV 673
             P L  QYTGLP+   V
Sbjct: 491 NNPFLSNQYTGLPSTNIV 508

>CAGL0A03872g Chr1 complement(392922..394454) [1533 bp, 510 aa] {ON}
           highly similar to uniprot|Q05785 Saccharomyces
           cerevisiae YLR206w ENT2
          Length = 510

 Score =  213 bits (542), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 132/253 (52%), Positives = 170/253 (67%), Gaps = 12/253 (4%)

Query: 1   MSHQFVRSTKNMFKGYSPTQVLVRDATANNDSGTSIDVLDQLGEMSYDTHEFRDIFSVLD 60
           M  Q VRS KNM KGYS TQV+VRDATAN+ +  S+ VL+ L + +YDT EF +I  +LD
Sbjct: 1   MPSQLVRSAKNMVKGYSSTQVMVRDATANDSTSPSVGVLEDLADKTYDTVEFFEIMDMLD 60

Query: 61  RRISDKPKYWRHVAKSLTVVDYLVRFGSEACVQWARDNARQLEILRDFYYSDS-AGIDQG 119
           +R++DK KYWRHVAKSLTV+DYLVRFGSE CV W ++N   ++ LR+F + D  +G D+G
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDEVSGSDEG 120

Query: 120 QLIRVKAAELIDLLRDPERLATERGMNMRGRRNALPPRRMGPHRRPSMPRRPEDEEDVDR 179
           Q+IRVKA EL  LL D ERL  ER +N   RRN    RR    R  S   R   ++D+ +
Sbjct: 121 QIIRVKAKELTSLLTDDERLREERALNRANRRNGDAKRRRRRSRSRSTSYRNAYDDDLQK 180

Query: 180 ALEESKKTAEEDEARRRKDQEREKQ--DLKEAVKLSKEEDELKRLQD---------EANN 228
           ALEES+ TAEE+EARRR+  + E Q  DL  A++LSKEE+ELK+LQD         +   
Sbjct: 181 ALEESRMTAEEEEARRREQAQYENQDPDLLAALQLSKEEEELKKLQDMQRMQELQAQQQQ 240

Query: 229 KPQYFDENGNPIS 241
           +  Y+D  GNPIS
Sbjct: 241 QNVYYDIFGNPIS 253

 Score =  114 bits (284), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 56/78 (71%), Positives = 58/78 (74%)

Query: 596 TGNSVISAKYSNLNQLLAQGTGIDTFGNEGATRIPAQHTKTGTFINSQGTGYKQVTXXXX 655
           TGN  IS KYS LN LLA GTGIDTFGN G  RIPAQHTKTGTFINSQGTGYKQVT    
Sbjct: 363 TGNQSISDKYSELNNLLASGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGYKQVTNEPK 422

Query: 656 PIPLLPTQYTGLPAQTAV 673
             P L +QYTGLP+   V
Sbjct: 423 NNPFLSSQYTGLPSTNIV 440

>KAFR0L01460 Chr12 complement(270433..272085) [1653 bp, 550 aa] {ON}
           Anc_7.342 YLR206W
          Length = 550

 Score =  214 bits (545), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 130/257 (50%), Positives = 165/257 (64%), Gaps = 17/257 (6%)

Query: 1   MSHQFVRSTKNMFKGYSPTQVLVRDATANNDSGTSIDVLDQLGEMSYDTHEFRDIFSVLD 60
           MS QFVRS KN+ KGYS TQVLVRDAT+N++  T+ID LD +   SYD+ +F +I  +LD
Sbjct: 1   MSKQFVRSAKNVMKGYSSTQVLVRDATSNDNRVTNIDTLDDIASRSYDSVDFFEIMDMLD 60

Query: 61  RRISDKPKYWRHVAKSLTVVDYLVRFGSEACVQWARDNARQLEILRDFYYSDSAGIDQGQ 120
           +R++DK KYW+H+ KSLTV+DYLVRFGSE CV W ++N   ++ LR+F Y D  GIDQGQ
Sbjct: 61  KRLNDKGKYWKHIVKSLTVLDYLVRFGSENCVLWCKENLYVIKTLREFRYEDDTGIDQGQ 120

Query: 121 LIRVKAAELIDLLRDPERLATERGMNMRGRRNALPPRRMGPHRRPSMPRRPEDEEDVDRA 180
           +IRVKA EL  LL+D ERL  ER  N R  R              S      D++D+ R 
Sbjct: 121 IIRVKAKELTSLLQDEERLREERRFNNRRNRRNNRSANRSRATSRSQSNIGPDDDDLQRV 180

Query: 181 LEESKKTAEEDEARRRKDQER---EKQDLKEAVKLSKEEDELKRLQDEANNKPQ------ 231
           +EESKKTAEEDE RRRK+  R   E  + + A++LSKEE+ELK LQD    + Q      
Sbjct: 181 IEESKKTAEEDE-RRRKELARYDEEDPEFQAALQLSKEEEELKNLQDLQRQQQQLQMLQQ 239

Query: 232 -------YFDENGNPIS 241
                  Y+D  GNPIS
Sbjct: 240 QQTSANVYYDVFGNPIS 256

 Score =  112 bits (281), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 56/80 (70%), Positives = 59/80 (73%), Gaps = 1/80 (1%)

Query: 595 HTGNSVISAKYSNLNQLLAQGTGIDTFGNEGATRIPAQHTKTGTFINSQGTGYKQVTXXX 654
            TGN  I+ KYS LN LLAQGTG+DTFGN G  RIPAQHTKTGTFINSQGTGYKQVT   
Sbjct: 389 RTGNEEITEKYSELNNLLAQGTGVDTFGNTGQERIPAQHTKTGTFINSQGTGYKQVTNER 448

Query: 655 XP-IPLLPTQYTGLPAQTAV 673
               P L TQYTGLP+   V
Sbjct: 449 SKNNPFLNTQYTGLPSSNIV 468

>TBLA0E00480 Chr5 complement(88019..89818) [1800 bp, 599 aa] {ON}
           Anc_7.342 YLR206W
          Length = 599

 Score =  213 bits (543), Expect = 7e-60,   Method: Compositional matrix adjust.
 Identities = 131/269 (48%), Positives = 181/269 (67%), Gaps = 28/269 (10%)

Query: 1   MSHQFVRSTKNMFKGYSPTQVLVRDATANNDSGTSIDVLDQLGEMSYDTHEFRDIFSVLD 60
           MS QF+RSTKNM KGYS TQ+LVRDATAN+++  SID+LD + E +YD+ +F +I  +LD
Sbjct: 1   MSKQFLRSTKNMVKGYSSTQILVRDATANDENTPSIDILDDIAEKTYDSVDFFEIMDMLD 60

Query: 61  RRISDKPKYWRHVAKSLTVVDYLVRFGSEACVQWARDNARQLEILRDFYYSDS----AGI 116
           +R++DK KYW+HVAKSLTV+DYL+RFGSE CV W ++N   ++ L++F   D+     G 
Sbjct: 61  KRLNDKGKYWKHVAKSLTVLDYLIRFGSENCVFWCKENLYLIKTLKEFRVDDAIDYNTGY 120

Query: 117 DQGQLIRVKAAELIDLLRDPERLATERGMNMRGRRNALPPRRMGPHRRPSM-----PRRP 171
           DQGQ++RV+A EL  LL D ERL  ER ++ RG R + PP RM P RR +       +R 
Sbjct: 121 DQGQIVRVRATELTSLLMDDERLREERSLHSRGGRRSAPPPRMAPQRRNTSRSDFNRQRA 180

Query: 172 ED--EEDVDRALEESKKTAEEDEARRRKDQEREKQDLKEAVKLSKEEDELKR-------- 221
           +D  ++D+ +A+EESK+TAEEDE RRR  +  ++ D + A++LSKEE+ELK+        
Sbjct: 181 DDHYDDDLQKAIEESKRTAEEDERRRRNREGDQEDDFETALQLSKEEEELKKLQELHAQQ 240

Query: 222 --LQDEANNKPQ-------YFDENGNPIS 241
             LQ++ N  P        Y D  GNPIS
Sbjct: 241 IALQNQQNATPTTQNVANVYTDIFGNPIS 269

 Score =  107 bits (268), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 56/80 (70%)

Query: 594 MHTGNSVISAKYSNLNQLLAQGTGIDTFGNEGATRIPAQHTKTGTFINSQGTGYKQVTXX 653
           M TGN  IS KY+NLN LLA GTGIDTFGN G  RIPAQHT TGTFINSQGTGYKQ    
Sbjct: 470 MRTGNQEISDKYNNLNTLLATGTGIDTFGNTGDMRIPAQHTATGTFINSQGTGYKQYIND 529

Query: 654 XXPIPLLPTQYTGLPAQTAV 673
               P +  QYTGLP+   V
Sbjct: 530 PKNNPFMSNQYTGLPSTNVV 549

>Suva_10.300 Chr10 (527412..529268) [1857 bp, 618 aa] {ON} YLR206W
           (REAL)
          Length = 618

 Score =  210 bits (535), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 115/222 (51%), Positives = 147/222 (66%), Gaps = 9/222 (4%)

Query: 1   MSHQFVRSTKNMFKGYSPTQVLVRDATANNDSGTSIDVLDQLGEMSYDTHEFRDIFSVLD 60
           MS QFVRS KNM KGYS TQVLVRDATAN+    SID LD L + SYD+ +F +I  +LD
Sbjct: 1   MSKQFVRSAKNMVKGYSSTQVLVRDATANDPRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60

Query: 61  RRISDKPKYWRHVAKSLTVVDYLVRFGSEACVQWARDNARQLEILRDFYYSDSAGIDQGQ 120
           +R++DK KYWRHVAKSLTV+DYLVRFGSE CV W R+N   ++ LR+F + + +G D+GQ
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120

Query: 121 LIRVKAAELIDLLRDPERLATERGMNMRGRRNALPPRRMGPHRRPSMPRR-------PED 173
           +IRVKA EL+ LL D ERL  ER MN R RR     R     R      R       P  
Sbjct: 121 IIRVKAKELVSLLNDDERLREERTMNTRNRRTNKTARPTPTPRPRRQRTRSNLYDSPPTY 180

Query: 174 EEDVDRALEESKKTAEEDEARRRKDQEREKQ--DLKEAVKLS 213
           + D+++ALEES+ TA+EDE RR +  + +    D + A++LS
Sbjct: 181 QNDLEKALEESRITAQEDELRRNEMAQYDDDDPDFQAALQLS 222

 Score =  108 bits (271), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 53/79 (67%), Positives = 59/79 (74%)

Query: 595 HTGNSVISAKYSNLNQLLAQGTGIDTFGNEGATRIPAQHTKTGTFINSQGTGYKQVTXXX 654
            TGN  IS KY++LN LLA GTG DTFGN G +RIPAQHTKTGTFINSQGTGYKQV    
Sbjct: 438 RTGNQSISDKYNDLNVLLATGTGADTFGNTGESRIPAQHTKTGTFINSQGTGYKQVVNEP 497

Query: 655 XPIPLLPTQYTGLPAQTAV 673
              P L +QYTGLP+ + V
Sbjct: 498 KNNPFLNSQYTGLPSTSIV 516

>YLR206W Chr12 (554578..556419) [1842 bp, 613 aa] {ON}
           ENT2Epsin-like protein required for endocytosis and
           actin patch assembly and functionally redundant with
           Ent1p; contains clathrin-binding motif at C-terminus
          Length = 613

 Score =  209 bits (533), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 117/223 (52%), Positives = 149/223 (66%), Gaps = 15/223 (6%)

Query: 1   MSHQFVRSTKNMFKGYSPTQVLVRDATANNDSGTSIDVLDQLGEMSYDTHEFRDIFSVLD 60
           MS QFVRS KNM KGYS TQVLVRDATAN+    SID LD L + SYD+ +F +I  +LD
Sbjct: 1   MSKQFVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60

Query: 61  RRISDKPKYWRHVAKSLTVVDYLVRFGSEACVQWARDNARQLEILRDFYYSDSAGIDQGQ 120
           +R++DK KYWRHVAKSLTV+DYLVRFGSE CV W R+N   ++ LR+F + + +G D+GQ
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120

Query: 121 LIRVKAAELIDLLRDPERLATERGMNMRGRRNALPPRRM--------GPHRRPSMPRRPE 172
           +IRVKA EL+ LL D ERL  ER MN R RR     R           PH        P 
Sbjct: 121 IIRVKAKELVSLLNDEERLREERSMNTRNRRANRAARPRPRRQRTRSNPH-----DSSPS 175

Query: 173 DEEDVDRALEESKKTAEEDEARRRK--DQEREKQDLKEAVKLS 213
            ++D+++ALEES+ TA+EDE RRR+    + E  D + A++LS
Sbjct: 176 YQDDLEKALEESRITAQEDEQRRRELAQYDDEDPDFQAALQLS 218

 Score =  113 bits (283), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 56/78 (71%), Positives = 58/78 (74%)

Query: 596 TGNSVISAKYSNLNQLLAQGTGIDTFGNEGATRIPAQHTKTGTFINSQGTGYKQVTXXXX 655
           TGN  IS KYS+LN LLA GTGIDTFGN G  RIPAQHTKTGTFINSQGTGYKQVT    
Sbjct: 430 TGNQSISDKYSDLNTLLATGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGYKQVTNEPK 489

Query: 656 PIPLLPTQYTGLPAQTAV 673
             P L  QYTGLP+   V
Sbjct: 490 NNPFLSNQYTGLPSTNIV 507

>Kwal_56.24610 s56 complement(1073855..1075381) [1527 bp, 508 aa]
           {ON} YDL161W (ENT1) - Ent1p [contig 161] FULL
          Length = 508

 Score =  205 bits (521), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 104/217 (47%), Positives = 146/217 (67%), Gaps = 15/217 (6%)

Query: 1   MSHQFVRSTKNMFKGYSPTQVLVRDATANNDSGTSIDVLDQLGEMSYDTHEFRDIFSVLD 60
           MS   +R  KN+  GYS TQVL+R+AT+N+  G S+D++D++ E S+D+  F +I  +LD
Sbjct: 1   MSKSLIRKAKNVVNGYSTTQVLLREATSNDPEGPSLDIMDEIAERSWDSVSFFEIMDMLD 60

Query: 61  RRISDKPKYWRHVAKSLTVVDYLVRFGSEACVQWARDNARQLEILRDFYYSDSAGIDQGQ 120
           +R++DK K WRHVAKSLTV+DYLVR GSE CV WA++N   ++ LR+F + D  GIDQGQ
Sbjct: 61  KRLNDKGKNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYVIKTLREFMHEDELGIDQGQ 120

Query: 121 LIRVKAAELIDLLRDPERLATERGMNMRGRRNALPPRRMGPHRRPSMPRRPEDEEDVDRA 180
           ++RVKA EL  LL D ERL  ER +  + R+         P RRP+      ++ED+ RA
Sbjct: 121 IVRVKARELTALLLDDERLREERSLRTKNRK---------PRRRPTA---GSEDEDLQRA 168

Query: 181 LEESKKTAEEDEARRRKDQE---REKQDLKEAVKLSK 214
           +EES+ TAE++EA RR+  E       DL+ A++LSK
Sbjct: 169 MEESRLTAEQEEAERRRKLEIYDNSSDDLQTALQLSK 205

 Score =  107 bits (268), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 52/78 (66%), Positives = 57/78 (73%)

Query: 596 TGNSVISAKYSNLNQLLAQGTGIDTFGNEGATRIPAQHTKTGTFINSQGTGYKQVTXXXX 655
           TGN  I+ K+S LN LLA GTG+DTFGN G TRIPAQHTKTG FINSQGTGYKQV+    
Sbjct: 397 TGNQSITEKHSELNNLLASGTGLDTFGNTGQTRIPAQHTKTGNFINSQGTGYKQVSSTPK 456

Query: 656 PIPLLPTQYTGLPAQTAV 673
             P L  QYTGLP+   V
Sbjct: 457 HNPFLGQQYTGLPSTNVV 474

>Kpol_2001.70 s2001 complement(192214..193815) [1602 bp, 533 aa]
           {ON} complement(192214..193815) [1602 nt, 534 aa]
          Length = 533

 Score =  203 bits (516), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 123/252 (48%), Positives = 166/252 (65%), Gaps = 22/252 (8%)

Query: 1   MSHQFVRSTKNMFKGYSPTQVLVRDATANNDSGTSIDVLDQLGEMSYDTHEFRDIFSVLD 60
           M  QFVRS KN+ KGYS TQV+VR+AT+N+  G  ID LD L E +YD+ EF +I  +LD
Sbjct: 1   MPKQFVRSAKNVVKGYSSTQVMVRNATSNDSGGPDIDTLDALAEKTYDSVEFFEIMDMLD 60

Query: 61  RRISDKPKYWRHVAKSLTVVDYLVRFGSEACVQWARDNARQLEILRDFYYSDSAGIDQGQ 120
           +R++DK KYW+H+AKSLTV+DYLVRFGSE CV W ++N   ++ L++F Y D +  DQGQ
Sbjct: 61  KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYIIQTLKEFSYIDDSDHDQGQ 120

Query: 121 LIRVKAAELIDLLRDPERLATERGMNMRGRRNALPPRRMGPHRRPSMPRRPEDEEDVDRA 180
           +IRVKA EL  LL D ERL          R      RR G   R    RRP D++++ RA
Sbjct: 121 IIRVKAKELTSLLNDEERL----------RDERGMNRRGGRRERARPRRRPSDDDELQRA 170

Query: 181 LEESKKTAEEDEARRRKDQEREKQDLKEAVKLSKEEDELK-----------RLQDEANNK 229
           +EESK+TAE+ + RRR+ ++ E+ DL+ A++LSKEE+ELK           + Q +   +
Sbjct: 171 IEESKRTAED-DDRRRRMRDDEEADLQTALQLSKEEEELKRLQELQRLQQQQQQQQQQQQ 229

Query: 230 PQYFDENGNPIS 241
           P Y+D  GNPIS
Sbjct: 230 PMYYDIFGNPIS 241

 Score =  109 bits (273), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 53/78 (67%), Positives = 58/78 (74%)

Query: 596 TGNSVISAKYSNLNQLLAQGTGIDTFGNEGATRIPAQHTKTGTFINSQGTGYKQVTXXXX 655
           TGN  I+ K+  LNQLLA GTGIDTFGN G  RIPAQHTKTGTFINSQGTGY+QVT    
Sbjct: 385 TGNQDITDKFGELNQLLASGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGYRQVTNDPK 444

Query: 656 PIPLLPTQYTGLPAQTAV 673
             P L +QYTGLP+   V
Sbjct: 445 NNPFLNSQYTGLPSTNIV 462

>SAKL0F10934g Chr6 (856966..858462) [1497 bp, 498 aa] {ON} some
           similarities with uniprot|Q12518 Saccharomyces
           cerevisiae YDL161W ENT1
          Length = 498

 Score =  201 bits (512), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 119/255 (46%), Positives = 164/255 (64%), Gaps = 23/255 (9%)

Query: 1   MSHQFVRSTKNMFKGYSPTQVLVRDATANNDSGTSIDVLDQLGEMSYDTHEFRDIFSVLD 60
           MS   +R+ KN+  GYS  QVLVR+AT+N  +G ++D LD+L E +YD  EF +I  +LD
Sbjct: 1   MSKALLRTAKNVVNGYSSVQVLVRNATSNEPTGPTVDQLDELAEKTYDNVEFFEIMDMLD 60

Query: 61  RRISDKPKYWRHVAKSLTVVDYLVRFGSEACVQWARDNARQLEILRDFYYSDSAGIDQGQ 120
           +R++DK K WRHVAKSLTV+DYLVR+GSE CV W+++N   ++ LR+F + D  G+D GQ
Sbjct: 61  KRLNDKGKNWRHVAKSLTVLDYLVRYGSENCVLWSQENLYIIKTLREFMHEDEMGVDHGQ 120

Query: 121 LIRVKAAELIDLLRDPERLATERGMNMRGRRNALPPRRMGPHRRPSMPRRPED-EEDVDR 179
           +IRVKA EL  LLRD ERL  ER M  + R     P R          R  E+ ++D+ R
Sbjct: 121 IIRVKAKELTSLLRDEERLTEERNMRKKRRGKTRRPER---------SRGGEEYDDDLQR 171

Query: 180 ALEESKKTAEEDEARRRKDQ-EREKQDLKEAVKLSKEEDELKRLQD------------EA 226
           ALEES+ TAEE+E RRR D    +  D + A++LSKEE+EL+RL++            + 
Sbjct: 172 ALEESRLTAEEEERRRRTDSGSNDDDDFQTALQLSKEEEELRRLRNLQMQQQQTAMFQQQ 231

Query: 227 NNKPQYFDENGNPIS 241
             +P Y+D  GNPI+
Sbjct: 232 QQQPMYYDVFGNPIT 246

 Score =  110 bits (274), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 54/82 (65%), Positives = 60/82 (73%), Gaps = 1/82 (1%)

Query: 593 PMHTGNSVISAKYSNLNQLLAQGTGIDTFGNEGATRIPAQHTKTGTFINSQGTGYKQVTX 652
           P  TGN  IS KY++LN LLA GTG+DTFGN G TRIPAQHT+TG FINSQGTGYKQVT 
Sbjct: 373 PTRTGNQSISQKYNDLNNLLASGTGLDTFGNTGQTRIPAQHTRTGNFINSQGTGYKQVTN 432

Query: 653 XX-XPIPLLPTQYTGLPAQTAV 673
                 P L  QYTGLP+ + V
Sbjct: 433 DQPKNNPFLAAQYTGLPSTSVV 454

>Ecym_4731 Chr4 (1427875..1429419) [1545 bp, 514 aa] {ON} similar to
           Ashbya gossypii ACL157C
          Length = 514

 Score =  201 bits (510), Expect = 5e-56,   Method: Compositional matrix adjust.
 Identities = 110/216 (50%), Positives = 149/216 (68%), Gaps = 12/216 (5%)

Query: 1   MSHQFVRSTKNMFKGYSPTQVLVRDATANNDSGTSIDVLDQLGEMSYDTHEFRDIFSVLD 60
           MS Q +RS KN+  GYS  QVLVR+AT+N++ G S+D +++L E +Y   EF +I  +LD
Sbjct: 1   MSKQLLRSAKNVMNGYSQAQVLVRNATSNDEYGPSLDQMEELAERTYSAVEFFEIMVMLD 60

Query: 61  RRISDKPKYWRHVAKSLTVVDYLVRFGSEACVQWARDNARQLEILRDFYYSD-SAGIDQG 119
           RR++DKPK WRHVAKSLTV DYLVR G+EACV WAR+N   +  L +F + D S+G D G
Sbjct: 61  RRLNDKPKNWRHVAKSLTVTDYLVRTGAEACVDWARENMFIIRKLTEFVHVDESSGTDHG 120

Query: 120 QLIRVKAAELIDLLRDPERLATERGMNM-RGRRNALPPRRMGPHRRPSMPRRPEDEEDVD 178
           QLIRVKA ELI LLRD ERL  ER + + RG++N   P+ + P   P        + D+ 
Sbjct: 121 QLIRVKAKELIALLRDDERLKEERNLRLGRGKKN---PQNV-PETNPDGV-----DPDLK 171

Query: 179 RALEESKKTAEEDEARRRKDQERE-KQDLKEAVKLS 213
           RALEES+ TAEE+E RR+  ++ E  ++L+ A++LS
Sbjct: 172 RALEESRITAEEEERRRKLAEKTEDAEELQAALQLS 207

 Score = 98.2 bits (243), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 57/110 (51%), Positives = 65/110 (59%), Gaps = 4/110 (3%)

Query: 596 TGNSVISAKYSNLNQLLAQGTGIDTFGNEGATRIPAQHTKTGTFINSQGTGYKQVTXXXX 655
           TGN  IS KY  LN LLA GTGIDTFGN G  RI +QHTKT TFINS GTG+KQV+    
Sbjct: 405 TGNQSISDKYGELNALLATGTGIDTFGNTGQARISSQHTKTETFINSHGTGFKQVSNEPP 464

Query: 656 PI-PLLPTQYTGLPAQTAVHVPSPSPLQPSEKEHQTQQT---QGFTLVDL 701
              P L TQYTGLP+   V   +      +    QT      QG +L+DL
Sbjct: 465 KHNPFLTTQYTGLPSTNIVPSHTGYGFGNASSFQQTASKPNDQGMSLIDL 514

>KNAG0B02650 Chr2 (511995..513935) [1941 bp, 646 aa] {ON} Anc_7.342
           YLR206W
          Length = 646

 Score =  200 bits (509), Expect = 7e-55,   Method: Compositional matrix adjust.
 Identities = 112/253 (44%), Positives = 157/253 (62%), Gaps = 33/253 (13%)

Query: 1   MSHQFVRSTKNMFKGYSPTQVLVRDATANNDSGTSIDVLDQLGEMSYDTHEFRDIFSVLD 60
           MS QFVRS KN+ KGYS TQVLVRDATAN+     +D L+ +  +S+D+ +F +I  VL+
Sbjct: 1   MSRQFVRSAKNVMKGYSSTQVLVRDATANDGRTPHLDTLEDIAGLSFDSVDFFEIMDVLE 60

Query: 61  RRISDKPKYWRHVAKSLTVVDYLVRFGSEACVQWARDNARQLEILRDF-YYSDSAGIDQG 119
           +R++D  KYWRH+ KSLTV+DYLVRFGSE C  WARD+   L+ LR+F +  D  G DQG
Sbjct: 61  KRLNDSGKYWRHIEKSLTVLDYLVRFGSEHCADWARDHLFLLKALRNFRFVDDGIGFDQG 120

Query: 120 QLIRVKAAELIDLLRDPERLATERGMNMRG--------------------RRNALP---- 155
           Q++RVKA +L++LL+  E+L   +    RG                    +R   P    
Sbjct: 121 QIVRVKARDLVELLQSGEQLGGRKAKRARGASRRDRGRRRGGDRGGGEYRQRGDDPEDEY 180

Query: 156 -PRRMG---PHRR--PSMPRRPEDEEDVDRALEESKKTAEEDEARRRKDQEREKQD--LK 207
            PR  G   P R+   S   R  D++D+ RA+EESK+T +EDE RRR+    +++D   +
Sbjct: 181 YPRPAGGPPPQRQGYESGGARGNDDDDLQRAIEESKRTVQEDEERRRQLSMYDEEDPEFQ 240

Query: 208 EAVKLSKEEDELK 220
            A++LS+EE+ELK
Sbjct: 241 AALQLSREEEELK 253

 Score =  107 bits (266), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 53/83 (63%), Positives = 61/83 (73%), Gaps = 3/83 (3%)

Query: 594 MHTGNSVISAKYSNLNQLLAQGTGIDTFGNEGATRIPAQHTKTGTFINSQGTGYKQVTXX 653
           M+TGN  ++ KYS LN LLAQGTG+DTFGNEG  RIPAQHT+TGTFINSQGTG+KQV   
Sbjct: 494 MNTGNQEVTNKYSELNNLLAQGTGVDTFGNEGTQRIPAQHTQTGTFINSQGTGFKQVNSE 553

Query: 654 XXPI---PLLPTQYTGLPAQTAV 673
                  P L +QYTGLP+   V
Sbjct: 554 GKDPNSNPFLNSQYTGLPSTGIV 576

>NDAI0D00610 Chr4 (133678..135138) [1461 bp, 486 aa] {ON} Anc_7.342
           YDL161W
          Length = 486

 Score =  185 bits (470), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 93/189 (49%), Positives = 131/189 (69%), Gaps = 4/189 (2%)

Query: 1   MSHQFVRSTKNMFKGYSPTQVLVRDATANNDSGTSIDVLDQLGEMSYDTHEFRDIFSVLD 60
           MS QFVRS KNM KGYS TQVLVRDAT+N+ S  S ++L ++ + S+D+ +F +I  +LD
Sbjct: 1   MSKQFVRSAKNMMKGYSTTQVLVRDATSNDSSNPSFEILYEISKRSFDSVDFFEIMDMLD 60

Query: 61  RRISDKPKYWRHVAKSLTVVDYLVRFGSEACVQWARDNARQLEILRDFYYSDSAGIDQGQ 120
           +R++DK KYW+H+AKSLTV+DYLVRFGSE CV W + N   ++ L++F   D   +D+  
Sbjct: 61  KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKQNLYIIKTLKEFKLEDD-NVDESS 119

Query: 121 LIRVKAAELIDLLRDPERLATERGMNMRGRRNALPPRRMGPHRRPSMPRR-PEDEEDVDR 179
           +IRVKA EL  LL+D ERL  ER +N++  R +   R+    R  +  RR  + +ED+ +
Sbjct: 120 IIRVKAKELTALLQDDERLKEERSINLKNNRRS--ERKNRSRRGTNATRRGTKSDEDLQK 177

Query: 180 ALEESKKTA 188
           ALEES+ TA
Sbjct: 178 ALEESRITA 186

 Score =  105 bits (262), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 53/82 (64%), Positives = 58/82 (70%), Gaps = 5/82 (6%)

Query: 595 HTGNSVISAKYSNLNQLLAQGTGIDTFGNEGATRIPAQHTKTGTFINSQGTGYKQVTXXX 654
            TGN  IS KY+ LN LLA GTGIDTFGN G  RIPAQHT+TGTFINSQGTGYKQ+    
Sbjct: 369 RTGNQSISDKYNELNNLLASGTGIDTFGNTGDQRIPAQHTQTGTFINSQGTGYKQIV--N 426

Query: 655 XPI---PLLPTQYTGLPAQTAV 673
            P+   P L  QYTGLP+   V
Sbjct: 427 DPVKKNPFLNNQYTGLPSSNIV 448

>KAFR0B00890 Chr2 (166365..167609) [1245 bp, 414 aa] {ON} Anc_7.342
           YLR206W
          Length = 414

 Score =  179 bits (453), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 102/242 (42%), Positives = 150/242 (61%), Gaps = 19/242 (7%)

Query: 5   FVRSTKNMFKGYSPTQVLVRDATANNDSGTSIDVLDQLGEMSYDTHEFRDIFSVLDRRIS 64
            +RS KN+ KGYS TQ LVRDAT+N+     ID L +L EM+Y+  EF +I  +LD+RI+
Sbjct: 1   MLRSAKNLVKGYSSTQKLVRDATSNSHDNPPIDQLSELAEMTYNNMEFFEIMDMLDKRIN 60

Query: 65  DKPKYWRHVAKSLTVVDYLVRFGSEACVQWARDNARQLEILRDFYYSDSAGIDQGQLIRV 124
            K KYW+HV KSL V+DYLVRFGSE CV W ++N   ++ LR+F Y D +G+DQGQ++RV
Sbjct: 61  SKGKYWKHVIKSLIVLDYLVRFGSENCVIWCKENLYIIKTLREFTYEDESGMDQGQMVRV 120

Query: 125 KAAELIDLLRDPERLATERGMNMRGRRNALPPRRMGPHRRPSMPRRPEDEEDVDRALEES 184
           +A EL  LL D ERL  ER +N RG  N    +           R  +D++D++RA    
Sbjct: 121 RAKELTSLLMDEERLREERALNRRGGGNRRRAK----------SRNSDDDDDLERA---- 166

Query: 185 KKTAEEDEARRRKDQEREKQDLKEAVKLSKEEDELK-----RLQDEANNKPQYFDENGNP 239
           K+ +        + + R++ + + A++L++EE EL+     + Q +   +P Y+D  GNP
Sbjct: 167 KEESRRTAREEEELRRRQEAERQFALQLNQEEQELRALQQLQQQQQQQQQPMYYDIFGNP 226

Query: 240 IS 241
           I+
Sbjct: 227 IT 228

 Score =  105 bits (261), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 53/78 (67%), Positives = 57/78 (73%)

Query: 596 TGNSVISAKYSNLNQLLAQGTGIDTFGNEGATRIPAQHTKTGTFINSQGTGYKQVTXXXX 655
           TG+  IS KYS LN LLA GTGIDTFGN G  RIPAQHTKTGTFINSQGTGYKQV+    
Sbjct: 316 TGSQSISDKYSALNTLLATGTGIDTFGNTGNQRIPAQHTKTGTFINSQGTGYKQVSTNGF 375

Query: 656 PIPLLPTQYTGLPAQTAV 673
               L +QYTGLP+   V
Sbjct: 376 NNVFLNSQYTGLPSSNIV 393

>ACL157C Chr3 complement(79325..80872) [1548 bp, 515 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR206W
           (ENT2) and YDL161W (ENT1)
          Length = 515

 Score =  181 bits (458), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 106/217 (48%), Positives = 146/217 (67%), Gaps = 13/217 (5%)

Query: 1   MSHQFVRSTKNMFKGYSPTQVLVRDATANNDSGTSIDVLDQLGEMSYDTHEFRDIFSVLD 60
           MS Q +RS KN+  GYSP Q+LVR+AT+N + G S+D +++L E SY   EF +I  +LD
Sbjct: 1   MSKQLLRSAKNVVNGYSPAQILVRNATSNEEYGPSMDQMEELAERSYSAVEFFEIVVMLD 60

Query: 61  RRISDKPKYWRHVAKSLTVVDYLVRFGSEACVQWARDNARQLEILRDFYYSD-SAGIDQG 119
           +R+SDKPK+WRHVAKSLTV D+LVR G+E CV WAR+N      L +FY+ D S G+D G
Sbjct: 61  KRLSDKPKHWRHVAKSLTVTDFLVRTGAETCVDWARENLYLFRRLTEFYHVDESTGVDHG 120

Query: 120 QLIRVKAAELIDLLRDPERLATERGMNMRGRRNALPPRRMGPHRRPSMPRRPED-EEDVD 178
           Q+IRVKA EL+ LLR  +        NMR  RN   PR    +R+ S+P   ED + D+ 
Sbjct: 121 QIIRVKARELVALLR--DEERLREERNMRLGRN---PR----NRQASVPPPAEDLDPDLQ 171

Query: 179 RALEESKKTA--EEDEARRRKDQEREKQDLKEAVKLS 213
           RALEES+ TA  EE   R + +Q+++ ++L+ A++LS
Sbjct: 172 RALEESRITAEEEERRRREKTNQQQDNEELEVALQLS 208

 Score =  109 bits (272), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 56/83 (67%), Positives = 60/83 (72%), Gaps = 1/83 (1%)

Query: 592 QPMHTGNSVISAKYSNLNQLLAQGTGIDTFGNEGATRIPAQHTKTGTFINSQGTGYKQVT 651
           QP  TGN  I+ KYS LN LLA GTG+DTFGN G TRIPAQHTKTGTFINSQGTGYKQV 
Sbjct: 399 QPTRTGNQSITDKYSELNTLLASGTGLDTFGNTGQTRIPAQHTKTGTFINSQGTGYKQVG 458

Query: 652 XXXXPI-PLLPTQYTGLPAQTAV 673
                  P + TQYTGLP+   V
Sbjct: 459 NEPPKHNPFIATQYTGLPSTNMV 481

>KLTH0H01430g Chr8 (132738..134246) [1509 bp, 502 aa] {ON} some
           similarities with uniprot|Q12518 Saccharomyces
           cerevisiae YDL161W ENT1
          Length = 502

 Score =  178 bits (451), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 112/264 (42%), Positives = 161/264 (60%), Gaps = 36/264 (13%)

Query: 1   MSHQFVRSTKNMFKGYSPTQVLVRDATANNDSGTSIDVLDQLGEMSYDTHEFRDIFSVLD 60
           MS   +R  KN+  GYS TQVL+R+AT+N+  G S+D++D++ E S+D+  F +I  +LD
Sbjct: 1   MSKSLMRRAKNVVNGYSTTQVLLREATSNDPDGPSLDLMDEIAERSWDSVSFFEIMDMLD 60

Query: 61  RRISDKPKYWRHVAKSLTVVDYLVRFGSEACVQWARDNARQLEILRDFYYSDSAGIDQGQ 120
           +R++DK K WRHVAKSLTV+DYLVR GSE CV WA++N   ++ LR+F + D  G+DQGQ
Sbjct: 61  KRLNDKGKNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYIIKTLREFTHEDETGVDQGQ 120

Query: 121 LIRVKAAELIDLLRDPERLATERGMNMRGRRNALPPRRMGPHRRPSMPRRPED-EEDVDR 179
           ++RVKA EL  LL+D ERL  ER +              G +RRP   +  +  ++D+ R
Sbjct: 121 IVRVKARELTALLQDEERLREERELK-------------GRNRRPRRRKNSDSYDDDMQR 167

Query: 180 ALEESKKTAEEDEARRRKDQE---REKQDLKEAVKLSK-------------------EED 217
           ALEES+ TAE++EA RR+  E       DL+ A++LSK                    + 
Sbjct: 168 ALEESRMTAEQEEAERRRKLEMYDNSADDLQTALQLSKEEEELRRLRELQMQQQMQQAQQ 227

Query: 218 ELKRLQDEANNKPQYFDENGNPIS 241
           ++  LQ +   +P Y+D  GNPIS
Sbjct: 228 QMFGLQQQQTQQPMYYDVFGNPIS 251

 Score =  109 bits (273), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 60/114 (52%), Positives = 72/114 (63%), Gaps = 8/114 (7%)

Query: 596 TGNSVISAKYSNLNQLLAQGTGIDTFGNEGATRIPAQHTKTGTFINSQGTGYKQVTXXXX 655
           TGN  ++ K+S+LN LLA GTG+DTFGN G TRIPAQHTKTGTFINSQGTGYKQV+    
Sbjct: 389 TGNQSVTDKFSDLNNLLASGTGLDTFGNTGQTRIPAQHTKTGTFINSQGTGYKQVSNMPQ 448

Query: 656 PI--PLLPTQYTGLPAQTAVHVPSPSPLQPSEKEHQTQQT------QGFTLVDL 701
               P L  QYTGLP+ + V   +         + QT Q       QG +L+DL
Sbjct: 449 GKHNPFLGQQYTGLPSTSVVPSYTGYGFGNQNVQKQTNQNRANGADQGVSLIDL 502

>KLLA0C16731g Chr3 complement(1463616..1465052) [1437 bp, 478 aa]
           {ON} some similarities with uniprot|Q12518 Saccharomyces
           cerevisiae YDL161W ENT1
          Length = 478

 Score =  170 bits (431), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 117/256 (45%), Positives = 162/256 (63%), Gaps = 25/256 (9%)

Query: 1   MSHQFVRSTKNMFKGYSPTQVLVRDATANNDSGTSIDVLDQLGEMSYDTHEFRDIFSVLD 60
           MS  F+RS KN+  GYS  QVLVR AT+N+  G S+D L++L E ++D  EF +I  +LD
Sbjct: 1   MSKAFLRSAKNLVNGYSQAQVLVRSATSNDKDGPSVDQLEELAERTFDNVEFFEIMDMLD 60

Query: 61  RRISDKPKYWRHVAKSLTVVDYLVRFGSEACVQWARDNARQLEILRDFYYSDS-AGIDQG 119
           +R++DK + WRHVAKSLT +D+LVR GSE CV W ++N   ++ LR+F ++D    ID G
Sbjct: 61  KRLNDKGRNWRHVAKSLTCLDFLVRCGSENCVFWCKENLYIIKTLREFTHTDEFTEIDNG 120

Query: 120 QLIRVKAAELIDLLRDPERLATERGMNMRGRRNALPPRRMGPHRRPSMPRRPEDEEDVDR 179
           +++RVKA EL  LLRD ERL  ER M ++GR+            R +     ED++D+ R
Sbjct: 121 EIVRVKAKELTALLRDEERLKEERMMRLKGRKRG---------GRKNRRDDNEDDDDLQR 171

Query: 180 ALEESKKTAEEDEARRRKDQEREKQD--LKEAVKLSKEEDELKR------------LQDE 225
           ALEES+ TAEE+E RRRK    +  D  L+ A++LSKEE+EL+R             Q +
Sbjct: 172 ALEESRITAEEEE-RRRKQLMMQGDDSSLQAALELSKEEEELRRLQQLQAQQQAALWQQQ 230

Query: 226 ANNKPQYFDENGNPIS 241
              +P Y+D  GNPIS
Sbjct: 231 QQQQPMYYDIFGNPIS 246

 Score =  107 bits (267), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 52/76 (68%), Positives = 58/76 (76%), Gaps = 1/76 (1%)

Query: 595 HTGNSVISAKYSNLNQLLAQGTGIDTFGNEGATRIPAQHTKTGTFINSQGTGYKQVTXXX 654
            TGN  IS K+S LN LLA GTGIDTFGN G TR+PAQHTKTGTFINSQGTGYKQ+T   
Sbjct: 360 RTGNQSISDKFSELNNLLASGTGIDTFGNTGETRVPAQHTKTGTFINSQGTGYKQITNDA 419

Query: 655 XPI-PLLPTQYTGLPA 669
               P L +QYTG+P+
Sbjct: 420 PKHNPFLTSQYTGIPS 435

>Smik_10.418 Chr10 complement(643833..645062) [1230 bp, 409 aa] {ON}
           YJR125C (REAL)
          Length = 409

 Score = 97.1 bits (240), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 83/143 (58%), Gaps = 1/143 (0%)

Query: 2   SHQFVRSTKNMFKGYSPTQVLVRDATANNDSGTSIDVLDQLGEMSYDTHEFRDIFSVLDR 61
           + ++ R  +N+   Y+  +  VR+AT N   G S  ++DQ+ + +Y+  E  +I S++ R
Sbjct: 15  AKKYFRKAQNVVFNYTEMEGKVREATNNEPWGASSTLMDQISQGTYNFREREEILSMIFR 74

Query: 62  RISDKP-KYWRHVAKSLTVVDYLVRFGSEACVQWARDNARQLEILRDFYYSDSAGIDQGQ 120
           R ++K    WR + K+L ++DYL++ GSE  +   R++   + IL  F+Y DS G DQG 
Sbjct: 75  RFTEKAGSEWRQIYKALQLLDYLIKHGSERFIDDTRNSINLIRILETFHYIDSQGRDQGI 134

Query: 121 LIRVKAAELIDLLRDPERLATER 143
            +R +   LIDLL D  ++  ER
Sbjct: 135 NVRTRVKALIDLLSDDNKIRAER 157

>Suva_12.216 Chr12 complement(334254..335486) [1233 bp, 410 aa] {ON}
           YJR125C (REAL)
          Length = 410

 Score = 96.7 bits (239), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 47/143 (32%), Positives = 84/143 (58%), Gaps = 1/143 (0%)

Query: 2   SHQFVRSTKNMFKGYSPTQVLVRDATANNDSGTSIDVLDQLGEMSYDTHEFRDIFSVLDR 61
           + ++ R  +N+   Y+  +  VR+AT N   G S  ++DQ+ + +Y+  E  +I S++ R
Sbjct: 15  AKKYFRKAQNVVFNYTEMEGKVREATNNEPWGASSTLMDQISQGTYNFREREEILSMIFR 74

Query: 62  RISDKP-KYWRHVAKSLTVVDYLVRFGSEACVQWARDNARQLEILRDFYYSDSAGIDQGQ 120
           R ++K    WR + K+L ++DYL++ GSE  +   R +   ++IL  F+Y+DS G DQG 
Sbjct: 75  RFTEKAGSEWRQIYKALQLLDYLIKHGSERFIDDTRSSINLIKILESFHYTDSQGRDQGI 134

Query: 121 LIRVKAAELIDLLRDPERLATER 143
            +R +   L++LL D  ++  ER
Sbjct: 135 NVRTRVKALVELLSDDSKIRAER 157

>KLTH0D16896g Chr4 complement(1395711..1396916) [1206 bp, 401 aa]
           {ON} similar to uniprot|P47160 Saccharomyces cerevisiae
           YJR125C ENT3 Protein containing an N-terminal epsin-like
           domain involved in clathrin recruitment and traffic
           between the Golgi and endosomes associates with the
           clathrin adaptor Gga2p
          Length = 401

 Score = 96.7 bits (239), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 84/143 (58%), Gaps = 1/143 (0%)

Query: 2   SHQFVRSTKNMFKGYSPTQVLVRDATANNDSGTSIDVLDQLGEMSYDTHEFRDIFSVLDR 61
           + ++ R  +NM   Y+  +  VR+AT N   G S  +++Q+ + +Y+  E  +I  ++ R
Sbjct: 15  AKKYFRKAQNMVFNYTEMEAKVREATNNEPWGASSTLMEQISQGTYNYREREEILGMIFR 74

Query: 62  RISDK-PKYWRHVAKSLTVVDYLVRFGSEACVQWARDNARQLEILRDFYYSDSAGIDQGQ 120
           R ++K    WR + K+L ++DYL+R G+E  +   R N   +++L  F+Y DS G DQG 
Sbjct: 75  RFTEKTASEWRQIYKALQLLDYLIRHGAERFIDDTRANLSLIKMLESFHYIDSQGRDQGI 134

Query: 121 LIRVKAAELIDLLRDPERLATER 143
            +R +A EL+ LL D  ++ TER
Sbjct: 135 NVRNRAHELVLLLDDDGKIRTER 157

>YJR125C Chr10 complement(654737..655963) [1227 bp, 408 aa] {ON}
           ENT3Protein containing an N-terminal epsin-like domain
           involved in clathrin recruitment and traffic between the
           Golgi and endosomes; associates with the clathrin
           adaptor Gga2p
          Length = 408

 Score = 95.5 bits (236), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 48/143 (33%), Positives = 83/143 (58%), Gaps = 1/143 (0%)

Query: 2   SHQFVRSTKNMFKGYSPTQVLVRDATANNDSGTSIDVLDQLGEMSYDTHEFRDIFSVLDR 61
           + ++ R  +N+   Y+  +  VR+AT N   G S  ++DQ+ + +Y+  E  +I S++ R
Sbjct: 15  AKKYFRKAQNVVFNYTEMEGKVREATNNEPWGASSTLMDQISQGTYNFREREEILSMIFR 74

Query: 62  RISDKP-KYWRHVAKSLTVVDYLVRFGSEACVQWARDNARQLEILRDFYYSDSAGIDQGQ 120
           R ++K    WR + K+L ++DYL++ GSE  +   R++   + IL  F+Y DS G DQG 
Sbjct: 75  RFTEKAGSEWRQIYKALQLLDYLIKHGSERFIDDTRNSINLIRILETFHYIDSQGRDQGI 134

Query: 121 LIRVKAAELIDLLRDPERLATER 143
            +R +   LI+LL D  ++  ER
Sbjct: 135 NVRTRVKALIELLSDDNKIRAER 157

>Skud_10.349 Chr10 complement(613398..614630) [1233 bp, 410 aa] {ON}
           YJR125C (REAL)
          Length = 410

 Score = 95.1 bits (235), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 48/143 (33%), Positives = 83/143 (58%), Gaps = 1/143 (0%)

Query: 2   SHQFVRSTKNMFKGYSPTQVLVRDATANNDSGTSIDVLDQLGEMSYDTHEFRDIFSVLDR 61
           + ++ R  +N+   Y+  +  VR+AT N   G S  ++DQ+ + +Y+  E  +I S++ R
Sbjct: 15  AKKYFRKAQNVVFNYTEMEGKVREATNNEPWGASSTLMDQISQGTYNFREREEILSMIFR 74

Query: 62  RISDKP-KYWRHVAKSLTVVDYLVRFGSEACVQWARDNARQLEILRDFYYSDSAGIDQGQ 120
           R ++K    WR + K+L ++DYL++ GSE  +   R +   ++IL  F+Y DS G DQG 
Sbjct: 75  RFTEKAGSEWRQIYKALQLLDYLIKHGSERFIDDTRSSINLIKILETFHYIDSQGRDQGI 134

Query: 121 LIRVKAAELIDLLRDPERLATER 143
            +R +   LI+LL D  ++  ER
Sbjct: 135 NVRTRVKTLIELLSDDNKIRAER 157

>NCAS0A06210 Chr1 complement(1229758..1231029) [1272 bp, 423 aa]
           {ON} Anc_4.346
          Length = 423

 Score = 94.0 bits (232), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 47/143 (32%), Positives = 84/143 (58%), Gaps = 1/143 (0%)

Query: 2   SHQFVRSTKNMFKGYSPTQVLVRDATANNDSGTSIDVLDQLGEMSYDTHEFRDIFSVLDR 61
           + ++ R  +N+   Y+  +  VR+AT N   G S  +++Q+ + +Y+  E  +I S++ R
Sbjct: 15  AKKYFRKAQNVVFNYTEMEGKVREATNNEPWGASSTLMEQIAQGTYNIREREEILSMIFR 74

Query: 62  RISDKP-KYWRHVAKSLTVVDYLVRFGSEACVQWARDNARQLEILRDFYYSDSAGIDQGQ 120
           R ++K    WR + K+L ++DYL++ GSE  +   R +   L++L+ F+Y D+ G DQG 
Sbjct: 75  RFTEKTGSEWRQIYKALQLLDYLIKHGSEKFIDDVRSSVAVLKLLQTFHYIDAEGRDQGI 134

Query: 121 LIRVKAAELIDLLRDPERLATER 143
            +R +   LI+LLRD   +  ER
Sbjct: 135 NVRNRVTTLIELLRDDNSIRQER 157

>Kpol_1001.2 s1001 (8057..9313) [1257 bp, 418 aa] {ON} (8057..9313)
           [1257 nt, 419 aa]
          Length = 418

 Score = 93.6 bits (231), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 47/143 (32%), Positives = 84/143 (58%), Gaps = 1/143 (0%)

Query: 2   SHQFVRSTKNMFKGYSPTQVLVRDATANNDSGTSIDVLDQLGEMSYDTHEFRDIFSVLDR 61
           + ++ R  +N+   Y+  +  VR+AT N   G S  +++Q+ + +Y+  E  +I S++ R
Sbjct: 15  AKKYFRKAQNVMFNYTEMEGKVREATNNEPWGASSTLMEQISQGTYNIREREEILSMIFR 74

Query: 62  RISDK-PKYWRHVAKSLTVVDYLVRFGSEACVQWARDNARQLEILRDFYYSDSAGIDQGQ 120
           R ++K    WR + K+L +++YL++ GSE  +   R +   +++L  F+Y DS G DQG 
Sbjct: 75  RFTEKTASEWRQIYKALQLLEYLIKHGSERFIDDVRSSLSLIKMLESFHYIDSQGRDQGI 134

Query: 121 LIRVKAAELIDLLRDPERLATER 143
            +R KA  L  LL+D E++  ER
Sbjct: 135 NVRNKAQSLTALLKDDEQIRAER 157

>KAFR0B06740 Chr2 (1406075..1407274) [1200 bp, 399 aa] {ON}
           Anc_4.346 YJR125C
          Length = 399

 Score = 92.4 bits (228), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 83/143 (58%), Gaps = 1/143 (0%)

Query: 2   SHQFVRSTKNMFKGYSPTQVLVRDATANNDSGTSIDVLDQLGEMSYDTHEFRDIFSVLDR 61
           + ++ R  +N+   Y+  +  VR+AT N   G S  +++Q+ + +Y+  E  +I  ++ R
Sbjct: 15  AKKYFRKAQNVVFNYTEMEGKVREATNNEPWGASSTLMEQIAQGTYNLREREEILGMIFR 74

Query: 62  RISDKP-KYWRHVAKSLTVVDYLVRFGSEACVQWARDNARQLEILRDFYYSDSAGIDQGQ 120
           R ++K    WR + KSL ++DYL+R GSE  +   R + R +E+L  F+Y DS G DQG 
Sbjct: 75  RFTEKAGSEWRQIYKSLQLLDYLIRRGSERFIDDVRSSIRLIELLETFHYIDSQGRDQGI 134

Query: 121 LIRVKAAELIDLLRDPERLATER 143
            +R +A  L +LL D  ++  ER
Sbjct: 135 NVRNRAKALGELLSDDTKIRQER 157

>SAKL0G17952g Chr7 complement(1555520..1556767) [1248 bp, 415 aa]
           {ON} similar to uniprot|P47160 Saccharomyces cerevisiae
           YJR125C ENT3 Protein containing an N-terminal epsin-like
           domain involved in clathrin recruitment and traffic
           between the Golgi and endosomes associates with the
           clathrin adaptor Gga2p
          Length = 415

 Score = 91.7 bits (226), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 45/143 (31%), Positives = 85/143 (59%), Gaps = 1/143 (0%)

Query: 2   SHQFVRSTKNMFKGYSPTQVLVRDATANNDSGTSIDVLDQLGEMSYDTHEFRDIFSVLDR 61
           + ++ R  +N+   Y+  +  VR+AT N   G S  +++Q+   +Y+  E  +I  ++ R
Sbjct: 15  AKKYFRKAQNVVFNYTEMEAKVREATNNEPWGASSTLMEQISAGTYNYREREEILGMIFR 74

Query: 62  RISDK-PKYWRHVAKSLTVVDYLVRFGSEACVQWARDNARQLEILRDFYYSDSAGIDQGQ 120
           R ++K    WR + K+L +++YL++ GSE  +  +R N   +++L  F+Y+DS G DQG 
Sbjct: 75  RFTEKTASEWRQIYKALQLLEYLIKHGSERFIDDSRANLTLIKMLESFHYTDSQGRDQGI 134

Query: 121 LIRVKAAELIDLLRDPERLATER 143
            +R +A EL+ LL + +++  ER
Sbjct: 135 NVRNRAQELVKLLNNDDQIRAER 157

>Kwal_47.16857 s47 (145176..146324) [1149 bp, 382 aa] {ON} YJR125C
           (ENT3) - Ent3p [contig 219] FULL
          Length = 382

 Score = 90.5 bits (223), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 47/143 (32%), Positives = 82/143 (57%), Gaps = 1/143 (0%)

Query: 2   SHQFVRSTKNMFKGYSPTQVLVRDATANNDSGTSIDVLDQLGEMSYDTHEFRDIFSVLDR 61
           + ++ R  +N+   Y+  +  VR+AT N   G S  +++Q+ + +Y+  E  +I  ++ R
Sbjct: 15  AKKYFRKAQNVVFNYTEMEAKVREATNNEPWGASSTLMEQIAQGTYNYREREEILGMIFR 74

Query: 62  RISDK-PKYWRHVAKSLTVVDYLVRFGSEACVQWARDNARQLEILRDFYYSDSAGIDQGQ 120
           R ++K    WR + K+L ++DYL+R G+E  +   R N   +++L  F+Y DS G DQG 
Sbjct: 75  RFTEKTASEWRQIYKALQLLDYLIRHGAERFIDDTRANLSLIKMLESFHYIDSQGRDQGI 134

Query: 121 LIRVKAAELIDLLRDPERLATER 143
            +R +A EL  LL D  ++  ER
Sbjct: 135 NVRNRAHELALLLDDDAKVRAER 157

>TDEL0D00710 Chr4 (127174..128301) [1128 bp, 375 aa] {ON} Anc_4.346
           YJR125C
          Length = 375

 Score = 90.1 bits (222), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 46/143 (32%), Positives = 82/143 (57%), Gaps = 1/143 (0%)

Query: 2   SHQFVRSTKNMFKGYSPTQVLVRDATANNDSGTSIDVLDQLGEMSYDTHEFRDIFSVLDR 61
           + ++ R  +N+   Y+  +  VR+AT N   G S  +++Q+ + +Y+  E  +I  ++ R
Sbjct: 15  AKKYFRRAQNVVFNYTDMEAKVREATNNEPWGASTTLMEQISQGTYNMREREEILGMIFR 74

Query: 62  RISDK-PKYWRHVAKSLTVVDYLVRFGSEACVQWARDNARQLEILRDFYYSDSAGIDQGQ 120
           R+++K    WR + K+L ++DYL+R  SE  +   R +   +++L  F+Y DS G DQG 
Sbjct: 75  RLTEKRANEWRQIYKALQLLDYLIRHASERFIDDTRSSISLIKMLESFHYIDSQGRDQGI 134

Query: 121 LIRVKAAELIDLLRDPERLATER 143
            +R +A  L +LL D E +  ER
Sbjct: 135 NVRNRAKALAELLSDDETIRAER 157

>KLLA0B04587g Chr2 (411097..412299) [1203 bp, 400 aa] {ON} similar
           to uniprot|P47160 Saccharomyces cerevisiae YJR125C ENT3
           Protein containing an N-terminal epsin-like domain
           involved in clathrin recruitment and traffic between the
           Golgi and endosomes associates with the clathrin adaptor
           Gga2p
          Length = 400

 Score = 90.5 bits (223), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 45/143 (31%), Positives = 83/143 (58%), Gaps = 1/143 (0%)

Query: 2   SHQFVRSTKNMFKGYSPTQVLVRDATANNDSGTSIDVLDQLGEMSYDTHEFRDIFSVLDR 61
           + ++ R  +N+   Y+  +  VR+AT N   G S  +++ + + +Y+  E  +I  ++ R
Sbjct: 15  AKKYFRKAQNVVFNYTEMEAKVREATNNEPWGASSTLMEHIAQGTYNYREREEILGMIFR 74

Query: 62  RISDK-PKYWRHVAKSLTVVDYLVRFGSEACVQWARDNARQLEILRDFYYSDSAGIDQGQ 120
           R ++K    WR + K+L +++YLV+ GSE  +   R N   +++L  F+Y DS G DQG 
Sbjct: 75  RFTEKTASEWRQIYKALQLLEYLVKHGSERFIDDVRTNLNLVKMLESFHYIDSQGRDQGI 134

Query: 121 LIRVKAAELIDLLRDPERLATER 143
            +R +A++L+ LL   E++  ER
Sbjct: 135 NVRNRASQLVKLLESDEQIRQER 157

>NDAI0D03200 Chr4 complement(764129..765436) [1308 bp, 435 aa] {ON}
           Anc_4.346
          Length = 435

 Score = 90.1 bits (222), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 45/143 (31%), Positives = 84/143 (58%), Gaps = 1/143 (0%)

Query: 2   SHQFVRSTKNMFKGYSPTQVLVRDATANNDSGTSIDVLDQLGEMSYDTHEFRDIFSVLDR 61
           + ++ R  +N+   Y+  +  VR+AT N   G S  +++Q+ + +Y+  E  +I  ++ R
Sbjct: 15  AKKYFRKAQNVVFNYTEMESKVREATNNEPWGASSTLMEQIAQGTYNVRERYEIVGMIFR 74

Query: 62  RISDKP-KYWRHVAKSLTVVDYLVRFGSEACVQWARDNARQLEILRDFYYSDSAGIDQGQ 120
           R ++K    WR + K+L ++DYL++ GSE  +   R + + +++L  F+Y DS G DQG 
Sbjct: 75  RFTEKAGSEWRQIYKALQLLDYLIKHGSEPFIDDVRSSLKLIQMLETFHYIDSEGRDQGI 134

Query: 121 LIRVKAAELIDLLRDPERLATER 143
            +R +A  L++LL+D   +  ER
Sbjct: 135 NVRNRAKLLVELLQDDSNIRQER 157

>TPHA0B00400 Chr2 (83356..84555) [1200 bp, 399 aa] {ON} Anc_4.346
           YJR125C
          Length = 399

 Score = 89.4 bits (220), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 46/143 (32%), Positives = 80/143 (55%), Gaps = 1/143 (0%)

Query: 2   SHQFVRSTKNMFKGYSPTQVLVRDATANNDSGTSIDVLDQLGEMSYDTHEFRDIFSVLDR 61
           + ++ R  +N+   Y+  +  VR+AT N   G S  ++ Q+ + +Y+  E  +I  ++ R
Sbjct: 15  AKKYFRKAQNVMFNYTDMEAKVREATNNEPWGASSTLMKQIAQGTYNIREREEILGMVFR 74

Query: 62  RISDK-PKYWRHVAKSLTVVDYLVRFGSEACVQWARDNARQLEILRDFYYSDSAGIDQGQ 120
           R ++K    WR + KSL + DYL++ GSE  +   R +   +++L  F+Y DS G DQG 
Sbjct: 75  RYTEKTASEWRQIYKSLQLTDYLIKHGSERFIDDVRTSISLIKMLESFHYIDSQGRDQGI 134

Query: 121 LIRVKAAELIDLLRDPERLATER 143
            +R KA  L+  L+D + +  ER
Sbjct: 135 NVRNKAQSLVAFLKDDDLIRAER 157

>KNAG0M00380 Chr13 (56675..57886) [1212 bp, 403 aa] {ON} Anc_4.346
           YJR125C
          Length = 403

 Score = 88.6 bits (218), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 43/135 (31%), Positives = 80/135 (59%), Gaps = 1/135 (0%)

Query: 2   SHQFVRSTKNMFKGYSPTQVLVRDATANNDSGTSIDVLDQLGEMSYDTHEFRDIFSVLDR 61
           + ++ R  +N+   ++  +  VR+AT N   G S  +++Q+ + +Y+  E  ++  +L R
Sbjct: 15  AKKYFRKAQNVVFNFTEMESKVREATNNEPWGASSTLMEQIAQGTYNYKEREEVMMMLMR 74

Query: 62  RISDKP-KYWRHVAKSLTVVDYLVRFGSEACVQWARDNARQLEILRDFYYSDSAGIDQGQ 120
           R ++K    WR + K+L ++DYL+R GSE  +   R   R + +L  F+Y DS G DQG 
Sbjct: 75  RFTEKAGSEWRQIYKALQLLDYLIRRGSEKFIDDVRAALRIVRLLESFHYIDSQGRDQGV 134

Query: 121 LIRVKAAELIDLLRD 135
            +R +A ++++LL+D
Sbjct: 135 NVRNRAKQIVELLQD 149

>ZYRO0B14784g Chr2 complement(1205944..1207218) [1275 bp, 424 aa]
           {ON} similar to uniprot|P47160 Saccharomyces cerevisiae
           YJR125C ENT3 Protein containing an N-terminal epsin-like
           domain involved in clathrin recruitment and traffic
           between the Golgi and endosomes associates with the
           clathrin adaptor Gga2p
          Length = 424

 Score = 89.0 bits (219), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 45/143 (31%), Positives = 82/143 (57%), Gaps = 1/143 (0%)

Query: 2   SHQFVRSTKNMFKGYSPTQVLVRDATANNDSGTSIDVLDQLGEMSYDTHEFRDIFSVLDR 61
           + ++ R  +N+   Y+  +  VR+AT N   GTS  +++ + + +Y+  E  +I  ++ R
Sbjct: 50  AKKYFRKAQNVVFNYTEMEAKVREATNNEPWGTSSTLMEYIAQGTYNLREREEILGMIFR 109

Query: 62  RISDK-PKYWRHVAKSLTVVDYLVRFGSEACVQWARDNARQLEILRDFYYSDSAGIDQGQ 120
           R ++K    WR + K+L +++YL++ GSE  +   R +   L++L  F+Y DS G DQG 
Sbjct: 110 RFTEKTANEWRQIYKALQLLEYLIKHGSERFIDDTRCSISLLKMLESFHYVDSQGRDQGI 169

Query: 121 LIRVKAAELIDLLRDPERLATER 143
            +R +A  L +LL D  ++  ER
Sbjct: 170 NVRTRAKALTELLGDDNKIRAER 192

>TBLA0E04760 Chr5 complement(1226806..1228086) [1281 bp, 426 aa]
           {ON} Anc_4.346 YJR125C
          Length = 426

 Score = 87.4 bits (215), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 48/160 (30%), Positives = 84/160 (52%), Gaps = 7/160 (4%)

Query: 2   SHQFVRSTKNMFKGYSPTQVLVRDATANNDSGTSIDVLDQLGEMSYDTHEFRDIFSVLDR 61
           + ++ R  +N+   Y+  +  VR+AT N   G S  +++Q+ + +Y+  E  +I S++ R
Sbjct: 15  AKKYFRKAQNVVFNYTDMEAKVREATNNEPWGASSTLMEQIAQGTYNPREREEILSMILR 74

Query: 62  RISDKP-KYWRHVAKSLTVVDYLVRFGSEACVQWARDNARQLEILRDFYYSDSAGIDQGQ 120
           R ++K    WR + K+L +++YL+  G+E  +  AR +   + +L  F+Y DS G DQG 
Sbjct: 75  RFTEKSGNLWRQIYKALQLLEYLITHGAERFIDEARSSLGLIRMLESFHYVDSEGRDQGA 134

Query: 121 LIRVKAAELIDLL------RDPERLATERGMNMRGRRNAL 154
            +R +A  +  LL      R   R A       RG  NA+
Sbjct: 135 NVRSRAQAMTSLLSSDDAIRSARRKARSTAGKFRGTGNAM 174

>AER155C Chr5 complement(929042..930136) [1095 bp, 364 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJR125C
           (ENT3)
          Length = 364

 Score = 86.7 bits (213), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 46/143 (32%), Positives = 79/143 (55%), Gaps = 1/143 (0%)

Query: 2   SHQFVRSTKNMFKGYSPTQVLVRDATANNDSGTSIDVLDQLGEMSYDTHEFRDIFSVLDR 61
           + ++ R  +N+   Y+  +  VR+AT N   G S  ++ Q+ + +Y+  E  +I +++ R
Sbjct: 15  AKKYFRKAQNVMLNYTGMEAKVREATNNEPWGASSTLMTQIAQGTYNFREREEILAMILR 74

Query: 62  RISDK-PKYWRHVAKSLTVVDYLVRFGSEACVQWARDNARQLEILRDFYYSDSAGIDQGQ 120
           R  +K    WR + KS+ +++YLV+ GSE  +   R N   + +L  F+Y DS G DQG 
Sbjct: 75  RFLEKSANEWRQIYKSMQLLEYLVKHGSERFIDDVRSNLNLIRMLETFHYIDSQGRDQGI 134

Query: 121 LIRVKAAELIDLLRDPERLATER 143
            +R +   L+ LL D E +  ER
Sbjct: 135 NVRNRTKALVKLLEDDELIRAER 157

>Ecym_1133 Chr1 (274069..275247) [1179 bp, 392 aa] {ON} similar to
           Ashbya gossypii AER155C
          Length = 392

 Score = 85.5 bits (210), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 46/153 (30%), Positives = 83/153 (54%), Gaps = 4/153 (2%)

Query: 2   SHQFVRSTKNMFKGYSPTQVLVRDATANNDSGTSIDVLDQLGEMSYDTHEFRDIFSVLDR 61
           + ++ R  +N+   Y+  +  VR+AT N   G    ++ Q+ + +Y+  E ++I  ++ R
Sbjct: 15  AKKYFRKAQNVVFNYTGMEAKVREATNNESWGAPSSLMAQIAQGTYNYRERKEILGMIFR 74

Query: 62  RISDK-PKYWRHVAKSLTVVDYLVRFGSEACVQWARDNARQLEILRDFYYSDSAGIDQGQ 120
           R  +K    WR + KS+ +++YL+  GSE  +   R     +++L  F+Y DS G DQG 
Sbjct: 75  RFVEKTASEWRQIYKSVQLLEYLIYHGSEGFIDDVRSGLNLIKMLESFHYIDSQGRDQGI 134

Query: 121 LIRVKAAELIDLLRDPERLATERGMNMRGRRNA 153
            +R +   L+ LL + E++  ER    + RRNA
Sbjct: 135 NVRNRTQALVQLLNNDEQIRIER---KKARRNA 164

>CAGL0H04323g Chr8 (407884..409122) [1239 bp, 412 aa] {ON} similar
           to uniprot|P47160 Saccharomyces cerevisiae YJR125c ENT3
           cytoskeletal adaptor
          Length = 412

 Score = 77.8 bits (190), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 45/143 (31%), Positives = 82/143 (57%), Gaps = 1/143 (0%)

Query: 2   SHQFVRSTKNMFKGYSPTQVLVRDATANNDSGTSIDVLDQLGEMSYDTHEFRDIFSVLDR 61
           + ++ R  +N+   Y+  +  VR+AT N   G S  +++Q+ + +Y+  E  +I  ++ R
Sbjct: 15  AKKYFRKAQNVVYNYTDMESKVREATNNEPWGASSTLMEQIAQGTYNIREREEILGMIFR 74

Query: 62  RISDKP-KYWRHVAKSLTVVDYLVRFGSEACVQWARDNARQLEILRDFYYSDSAGIDQGQ 120
           R ++K    WR + K+L +++YL++ GSE  +   R++   +++L  F+Y DS G DQG 
Sbjct: 75  RFTEKSGSEWRQIYKALQLLEYLIKHGSERFIDDTRNSISIVKLLESFHYIDSQGRDQGV 134

Query: 121 LIRVKAAELIDLLRDPERLATER 143
            +R +AA L  LL D   +  ER
Sbjct: 135 NVRNRAAALTALLADDSSIRAER 157

>SAKL0H25762g Chr8 (2256842..2257630) [789 bp, 262 aa] {ON} some
           similarities with uniprot|Q07872 Saccharomyces
           cerevisiae YLL038C ENT4 Protein of unknown function
           contains an N-terminal epsin-like domain
          Length = 262

 Score = 70.5 bits (171), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 44/145 (30%), Positives = 77/145 (53%), Gaps = 8/145 (5%)

Query: 5   FVRSTKNMFKGYSPTQVLVRDATANND-SGTSIDVLDQLGEMSYDTHEFRDIFSVLDRRI 63
           F+RS +NM  G S T+V V+ AT +++ SG +  +++++  ++Y     R+I  V+ RR+
Sbjct: 3   FIRSVRNM--GQSTTEVKVKKATDDDEYSGATGALMNEISVLTYSAKTLREITQVIHRRL 60

Query: 64  S-----DKPKYWRHVAKSLTVVDYLVRFGSEACVQWARDNARQLEILRDFYYSDSAGIDQ 118
           S        +   H+ K+LT++ YL+  GS   V W R  A  ++ LR+F  S       
Sbjct: 61  SGNYRKSSHRNAVHILKTLTLISYLINNGSNDFVSWIRQYAYLVDTLREFNVSADKDRKM 120

Query: 119 GQLIRVKAAELIDLLRDPERLATER 143
            + +R+ + +L  LL+D   L   R
Sbjct: 121 AEQVRMLSIKLSKLLKDDLMLQERR 145

>ACL061C Chr3 complement(256803..257507) [705 bp, 234 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLL038C
           (ENT4)
          Length = 234

 Score = 68.9 bits (167), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 49/165 (29%), Positives = 78/165 (47%), Gaps = 6/165 (3%)

Query: 13  FKGYSPTQVLVRDATANND-SGTSIDVLDQLGEMSYDTHEFRDIFSVLDRRISDKP---- 67
           + G SPT   VR AT +N+  G S  ++ ++  ++Y      D+  VL +R+S       
Sbjct: 9   YLGSSPTAAKVRKATDDNEFVGASSALISEITILTYSCKTLLDVTRVLKKRLSGNANKSS 68

Query: 68  -KYWRHVAKSLTVVDYLVRFGSEACVQWARDNARQLEILRDFYYSDSAGIDQGQLIRVKA 126
            K   H+ K+LT+ +YL+  GSE  VQW +  A  L  L+DF   +         IR  +
Sbjct: 69  HKNAVHILKALTLTNYLIANGSEDFVQWLQGCAVLLRRLKDFTTGNERDSHMASQIRSFS 128

Query: 127 AELIDLLRDPERLATERGMNMRGRRNALPPRRMGPHRRPSMPRRP 171
             L++L+++P  L   R   +R R +   P      R  S+P  P
Sbjct: 129 LSLLELMQNPALLEDHRRSVVRFRSSISTPGYKSDQRSQSLPGLP 173

>Kpol_388.5 s388 complement(17825..18631) [807 bp, 268 aa] {ON}
           complement(17825..18631) [807 nt, 269 aa]
          Length = 268

 Score = 68.2 bits (165), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 41/148 (27%), Positives = 74/148 (50%), Gaps = 6/148 (4%)

Query: 17  SPTQVLVRDATANND-SGTSIDVLDQLGEMSYDTHEFRDIFSVLDRRISDKPKY-----W 70
           S T+  V++AT +N+ SG +  +++++  ++Y     ++I  VL +R++   K       
Sbjct: 13  SATEAKVKEATDDNETSGATGTLMNEISVLTYSPKTLKEIIQVLKKRLTGSSKKSSHRNC 72

Query: 71  RHVAKSLTVVDYLVRFGSEACVQWARDNARQLEILRDFYYSDSAGIDQGQLIRVKAAELI 130
            H+ K++T++ YL+  GS   + WAR N    E+L+DF           + IR  A +L 
Sbjct: 73  VHILKTMTLISYLINNGSNDFIAWARSNIMIFEVLKDFEVIHEDDEKMAEQIRYIAGDLC 132

Query: 131 DLLRDPERLATERGMNMRGRRNALPPRR 158
            L+ D E L   R   ++ R +   P R
Sbjct: 133 ILINDDELLEARRKDVIQFRSSISSPGR 160

>TBLA0G00650 Chr7 (140678..141949) [1272 bp, 423 aa] {ON} Anc_4.17
           YLL038C
          Length = 423

 Score = 65.9 bits (159), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 37/134 (27%), Positives = 78/134 (58%), Gaps = 7/134 (5%)

Query: 17  SPTQVLVRDATANND-SGTSIDVLDQLGEMSYDTHEFRDIFSVLDRRISDKPKY-----W 70
           SPT++ VR AT +N+ SG +  +++++  ++Y T   ++I +VL +R++   K       
Sbjct: 13  SPTELKVRTATDDNENSGATGTLMNEISVLTYSTKTNKEIVTVLKKRLTGYGKKSSHRNC 72

Query: 71  RHVAKSLTVVDYLVRFGSEACVQWARDNARQLEILRDFYYSDSAGIDQGQL-IRVKAAEL 129
            H+ K+LT++ YL+  GS   ++W  +N    E++++F  SD+   ++  + IR  +  +
Sbjct: 73  IHIIKTLTLIAYLMNNGSLEFIRWINENQLLFEVMKNFEVSDTIHDEKFAIQIRDLSERI 132

Query: 130 IDLLRDPERLATER 143
           ++L+ + E L  +R
Sbjct: 133 LELINNRELLEQKR 146

>Suva_10.35 Chr10 complement(70188..70931) [744 bp, 247 aa] {ON}
           YLL038C (REAL)
          Length = 247

 Score = 63.5 bits (153), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 41/140 (29%), Positives = 75/140 (53%), Gaps = 9/140 (6%)

Query: 13  FKGY--SPTQVLVRDATANND-SGTSIDVLDQLGEMSYDTHEFRDIFSVLDRRI------ 63
           FK +  SPT+  V+ AT+ ++ SG +  +++++  ++Y     R+I  ++ +R+      
Sbjct: 7   FKSFIQSPTESKVKQATSEDETSGATGTLMNEISILTYSPKTVREIIQIVRKRLLLGQNR 66

Query: 64  SDKPKYWRHVAKSLTVVDYLVRFGSEACVQWARDNARQLEILRDFYYSDSAGIDQGQLIR 123
            +  +    V K+LT+V YL+  GS   ++W + N   +EIL DF   D+     G+ IR
Sbjct: 67  RNSHRSCIQVMKTLTLVSYLMNNGSNEFIKWLKGNMILIEILEDFQAQDARDDRNGEEIR 126

Query: 124 VKAAELIDLLRDPERLATER 143
             +  L +LL+D E L  +R
Sbjct: 127 KLSRNLHELLQDDELLERQR 146

>TDEL0G01740 Chr7 (342371..343144) [774 bp, 257 aa] {ON} Anc_4.17
           YLL038C
          Length = 257

 Score = 62.8 bits (151), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 40/148 (27%), Positives = 75/148 (50%), Gaps = 6/148 (4%)

Query: 17  SPTQVLVRDATANNDS-GTSIDVLDQLGEMSYDTHEFRDIFSVLDRRI-----SDKPKYW 70
           S T++ V+ AT  N+S G +  +++++  ++Y     ++I  V+ +R+      +  K  
Sbjct: 13  STTELKVKQATDENESSGATGTLMNEISVLTYSPKTLKEIVQVVRKRLMGHGRRNSHKIC 72

Query: 71  RHVAKSLTVVDYLVRFGSEACVQWARDNARQLEILRDFYYSDSAGIDQGQLIRVKAAELI 130
            H+ K+LT+V YL+  GS   + W R N   ++ L++F   D      GQ IR  + +L 
Sbjct: 73  IHLVKTLTLVTYLMNNGSNDFIAWVRGNMALVDCLKEFNVQDRNDEKIGQQIRAMSQDLC 132

Query: 131 DLLRDPERLATERGMNMRGRRNALPPRR 158
            L++D + L   R   ++ R +   P R
Sbjct: 133 TLIKDDDLLENRRAEVIQFRSSISSPGR 160

>Skud_12.30 Chr12 complement(56967..57710) [744 bp, 247 aa] {ON}
           YLL038C (REAL)
          Length = 247

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 39/140 (27%), Positives = 75/140 (53%), Gaps = 9/140 (6%)

Query: 13  FKGY--SPTQVLVRDATANND-SGTSIDVLDQLGEMSYDTHEFRDIFSVLDRRI------ 63
           FK +  SPT+  V+ AT+ ++ SG +  +++++  ++Y     R+I  V+ +R+      
Sbjct: 7   FKSFIQSPTESKVKQATSEDETSGATGTLMNEISILTYSPKTVREIIQVIRKRLLLGQNR 66

Query: 64  SDKPKYWRHVAKSLTVVDYLVRFGSEACVQWARDNARQLEILRDFYYSDSAGIDQGQLIR 123
            +  +    V K+LT+V YL+  GS   ++W + N   +EIL +F+  D     + + IR
Sbjct: 67  RNSHRNCIQVMKTLTLVSYLMNNGSNEFIKWLKGNMILIEILENFHIQDVRDERKREEIR 126

Query: 124 VKAAELIDLLRDPERLATER 143
             +  L++LL+D   L  +R
Sbjct: 127 KLSRNLLELLQDDGLLEKQR 146

>TPHA0F00230 Chr6 complement(43589..44431) [843 bp, 280 aa] {ON}
           Anc_4.17 YLL038C
          Length = 280

 Score = 60.5 bits (145), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 34/133 (25%), Positives = 69/133 (51%), Gaps = 6/133 (4%)

Query: 17  SPTQVLVRDATANND-SGTSIDVLDQLGEMSYDTHEFRDIFSVLDRRIS-----DKPKYW 70
           SPT+  VR AT +++ SG +  +++++  ++Y     ++I  +L +R++     +  K  
Sbjct: 13  SPTESKVRQATDDDETSGATGTLMNEISVLTYSPKTLKEIVQILKKRLTGYSKKNSHKNC 72

Query: 71  RHVAKSLTVVDYLVRFGSEACVQWARDNARQLEILRDFYYSDSAGIDQGQLIRVKAAELI 130
            H+ K+LT++ YL+  GS   + W R N    E L++F   +      GQ I     ++ 
Sbjct: 73  VHILKTLTLITYLINNGSNDFIAWTRSNIMLFEYLKNFEVQNLEDEKMGQQIVFICNDIC 132

Query: 131 DLLRDPERLATER 143
           +++ D + L  +R
Sbjct: 133 NIINDDDMLEQKR 145

>ZYRO0G07876g Chr7 complement(636468..637247) [780 bp, 259 aa] {ON}
           similar to uniprot|Q07872 Saccharomyces cerevisiae
           YLL038C ENT4 Protein of unknown function contains an N-
           terminal epsin-like domain
          Length = 259

 Score = 58.9 bits (141), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 43/153 (28%), Positives = 74/153 (48%), Gaps = 12/153 (7%)

Query: 15  GYSPTQVLVRDATANND-SGTSIDVLDQLGEMSYDTHEFRDIFSVLDRRISDKPKYWR-- 71
           G S T++ VR AT  ++ +G +  +++++  ++Y     R+I  VL RR+S    Y R  
Sbjct: 11  GPSSTELKVRKATNEDEKTGATGTLMNEISVLTYSPKTVREITQVLKRRLSS---YGRRT 67

Query: 72  ------HVAKSLTVVDYLVRFGSEACVQWARDNARQLEILRDFYYSDSAGIDQGQLIRVK 125
                 H+ K+LT++ YL+  GSE  V W R N    E L+    S        + IR  
Sbjct: 68  SHKNSIHIVKALTLILYLINNGSEEFVAWVRGNLIYFECLKSCEVSQKRDEPLAKQIRSM 127

Query: 126 AAELIDLLRDPERLATERGMNMRGRRNALPPRR 158
           + ++ D ++D E L  ++   +  R +   P R
Sbjct: 128 SNQICDCVKDDELLENKKKEIIEFRSSISSPGR 160

>Kwal_55.20611 s55 complement(489968..490732) [765 bp, 254 aa] {ON}
           YLL038C (ENT4) - Ent4p [contig 144] FULL
          Length = 254

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 40/145 (27%), Positives = 74/145 (51%), Gaps = 8/145 (5%)

Query: 5   FVRSTKNMFKGYSPTQVLVRDATANND-SGTSIDVLDQLGEMSYDTHEFRDIFSVLDRRI 63
            +++ +N+  G S T+V  R+AT +++ +G +  ++++L  ++Y     R+I  V+ +R+
Sbjct: 3   LLKTVRNI--GQSSTEVKTRNATNDDEHNGATGSLMNELSVLTYSPRTLREITQVIRKRL 60

Query: 64  SDKP-----KYWRHVAKSLTVVDYLVRFGSEACVQWARDNARQLEILRDFYYSDSAGIDQ 118
           S        K   H+ K+LT++ YL+  GS+  V W R     ++ L++F          
Sbjct: 61  SGNSRMSSHKNAVHLLKTLTLIAYLINNGSDEFVVWIRSYLYLIDTLKEFNGGSRTKERM 120

Query: 119 GQLIRVKAAELIDLLRDPERLATER 143
              IR  A+ L  +LRD E L   R
Sbjct: 121 ASQIRNLASSLAAILRDEELLRQRR 145

>TBLA0B06220 Chr2 (1466908..1467927) [1020 bp, 339 aa] {ON}
           Anc_4.346 YJR125C
          Length = 339

 Score = 58.2 bits (139), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 38/139 (27%), Positives = 69/139 (49%), Gaps = 1/139 (0%)

Query: 2   SHQFVRSTKNMFKGYSPTQVLVRDATANNDSGTSIDVLDQLGEMSYDTHEFRDIFSVLDR 61
           + +F R  +N     +  +  VR+AT N+  GTS+ ++ Q+   +++ ++  DI ++L  
Sbjct: 15  AKKFFRMAENFLFNLTDMESKVREATNNDPWGTSVILMAQINAGTFEINQRADIINMLLN 74

Query: 62  RISDK-PKYWRHVAKSLTVVDYLVRFGSEACVQWARDNARQLEILRDFYYSDSAGIDQGQ 120
           R  +K    WR + KS+ ++ YL+  GS   V   + N   ++ L  F + D  G +Q  
Sbjct: 75  RFLEKNGSQWRQIYKSVLLLQYLLINGSTEFVSEVKLNLTLIKNLMLFEFIDDQGYNQSS 134

Query: 121 LIRVKAAELIDLLRDPERL 139
            I      LI+L+ D   L
Sbjct: 135 KISKATERLIELMTDDHLL 153

>CAGL0E03806g Chr5 (356594..357376) [783 bp, 260 aa] {ON} similar to
           uniprot|Q07872 Saccharomyces cerevisiae YLL038c ENT4
          Length = 260

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 35/126 (27%), Positives = 66/126 (52%), Gaps = 8/126 (6%)

Query: 13  FKGY--SPTQVLVRDATANND-SGTSIDVLDQLGEMSYDTHEFRDIFSVLDRRIS----- 64
           FKG+  SPT++ VR AT +N+ +G +  +++++  ++Y     +D+  V+ +R+S     
Sbjct: 7   FKGFLLSPTELKVRQATDDNELAGATGTLMNEISVLTYSKKTLKDVIQVIRKRLSGVNKR 66

Query: 65  DKPKYWRHVAKSLTVVDYLVRFGSEACVQWARDNARQLEILRDFYYSDSAGIDQGQLIRV 124
           +  +   HV K+LT+V YL+  GS   + W + +   +E L  F    S+       IR 
Sbjct: 67  NSHRTCLHVLKTLTLVSYLLNNGSNDFIAWLKSSKYVIEYLSSFEAQSSSDEPMVNQIRF 126

Query: 125 KAAELI 130
              ++I
Sbjct: 127 LCNDII 132

>Ecym_8407 Chr8 (843359..844123) [765 bp, 254 aa] {ON} similar to
           Ashbya gossypii ACL061C
          Length = 254

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 39/146 (26%), Positives = 76/146 (52%), Gaps = 14/146 (9%)

Query: 5   FVRSTKNMFKGYSPTQVLVRDATANND-SGTSIDVLDQLGEMSYDTHEFRDIFSVLDRRI 63
           F+ S +++  G S T V V+ AT +++ +G    +++++  ++Y  +  R+I  VL +R+
Sbjct: 3   FLSSVRHL--GSSSTTVKVKKATDDSEHNGAYGSLMNEIAILTYSPNTLREITQVLKKRL 60

Query: 64  SDK-----PKYWRHVAKSLTVVDYLVRFGSEACVQWARDNARQLEILRDFYYSDSAG--- 115
                    K   ++ K+LT++ +LV  GSE C+ W R +   +   +DF   D      
Sbjct: 61  VGNYKKTPSKRAVNLLKTLTLIRFLVINGSEECIAWLRRHLVLIRSFQDFTLRDGEKKQM 120

Query: 116 IDQGQLIRVKAAELI---DLLRDPER 138
           ++Q QL+  K  +L+   +LL D  +
Sbjct: 121 VNQIQLLSCKLCQLLTDSNLLEDMRK 146

>KLTH0E05874g Chr5 complement(530814..531581) [768 bp, 255 aa] {ON}
           similar to uniprot|Q07872 Saccharomyces cerevisiae
           YLL038C ENT4 Protein of unknown function contains an N-
           terminal epsin-like domain
          Length = 255

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 37/135 (27%), Positives = 68/135 (50%), Gaps = 6/135 (4%)

Query: 15  GYSPTQVLVRDATANND-SGTSIDVLDQLGEMSYDTHEFRDIFSVLDRRIS-----DKPK 68
           G S T++  ++AT +++ SG +  +++++  ++Y +   R+I +V+ +R+S        K
Sbjct: 11  GQSQTEIKTKNATNDDEYSGATGSLMNEISVLTYSSRTLREITAVVRKRLSGNNRKSSHK 70

Query: 69  YWRHVAKSLTVVDYLVRFGSEACVQWARDNARQLEILRDFYYSDSAGIDQGQLIRVKAAE 128
              H+ K+LT+  YL+  GS   V W R     ++ L++F             IR  A+ 
Sbjct: 71  NAVHILKTLTLTAYLINNGSNEFVAWIRSYVYLIDSLKEFTIGSRGQERMAVQIRSLAST 130

Query: 129 LIDLLRDPERLATER 143
           L  +LRD E L   R
Sbjct: 131 LSVILRDDELLRQRR 145

>YLL038C Chr12 complement(65775..66518) [744 bp, 247 aa] {ON}
           ENT4Protein of unknown function, contains an N-terminal
           epsin-like domain; proposed to be involved in the
           trafficking of Arn1p in the absence of ferrichrome
          Length = 247

 Score = 54.3 bits (129), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 32/109 (29%), Positives = 58/109 (53%), Gaps = 9/109 (8%)

Query: 13  FKGY--SPTQVLVRDATANND-SGTSIDVLDQLGEMSYDTHEFRDIFSVLDRRI------ 63
           FK +  SPT+  V+ AT  ++ SG +  +++++  ++Y     R+I  V+ +R+      
Sbjct: 7   FKSFIQSPTESKVKQATNEDETSGATGTLMNEISILTYSPKTVREIIQVIRKRLLLGQNR 66

Query: 64  SDKPKYWRHVAKSLTVVDYLVRFGSEACVQWARDNARQLEILRDFYYSD 112
            +  +    V K+LT+V YL+  GS   ++W + N   +EIL DF   D
Sbjct: 67  RNSHRNCIQVMKTLTLVSYLMNNGSNEFIKWLKGNMILIEILEDFQVQD 115

>Smik_12.19 Chr12 complement(50134..50877) [744 bp, 247 aa] {ON}
           YLL038C (REAL)
          Length = 247

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 32/110 (29%), Positives = 59/110 (53%), Gaps = 9/110 (8%)

Query: 13  FKGY--SPTQVLVRDATANND-SGTSIDVLDQLGEMSYDTHEFRDIFSVLDRRI------ 63
           FK +  SPT+  V+ AT  ++ SG +  +++++  ++Y     R+I  V+ +R+      
Sbjct: 7   FKSFIQSPTESKVKQATNEDETSGATGTLMNEISILTYSPKTVREIIQVVRKRLLLGQNR 66

Query: 64  SDKPKYWRHVAKSLTVVDYLVRFGSEACVQWARDNARQLEILRDFYYSDS 113
            +  +    V K+LT+V YL+  GS   ++W + N   +EIL DF   D+
Sbjct: 67  RNSHRNCIQVMKTLTLVSYLMNNGSNEFIKWLKSNMILVEILEDFQVQDA 116

>KLLA0D03949g Chr4 (333566..334243) [678 bp, 225 aa] {ON} similar to
           uniprot|Q07872 Saccharomyces cerevisiae YLL038C ENT4
           Protein of unknown function contains an N- terminal
           epsin- like domain
          Length = 225

 Score = 52.8 bits (125), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 33/120 (27%), Positives = 68/120 (56%), Gaps = 10/120 (8%)

Query: 15  GYSPTQVLVRDATANNDS-GTSIDVLDQLGEMSYDTHEFRDIFSVLDRRISDKPKYWR-- 71
           G S TQ+ V+ AT +N+S G +  ++++L  ++Y      +I+ V+ +R+ +     +  
Sbjct: 11  GQSTTQLKVKQATDSNESYGATGTLMNELSVLTYSEKSANEIYEVIRKRLMNGSSRLKNS 70

Query: 72  -----HVAKSLTVVDYLVRFGSEACVQWARDNARQLEILRDFYYSDSAGIDQGQLIRVKA 126
                 V K+LT+++YL+  GSE  V W R +   +E L+D++ S+    D+ ++ ++K+
Sbjct: 71  HDSVVQVLKTLTLIEYLLYNGSEEFVLWMRRHLAYIEALKDYHCSNDK--DKSKVKQIKS 128

>NCAS0C05840 Chr3 (1202292..1203095) [804 bp, 267 aa] {ON} Anc_4.17
           YLL038C
          Length = 267

 Score = 51.6 bits (122), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 35/133 (26%), Positives = 68/133 (51%), Gaps = 6/133 (4%)

Query: 17  SPTQVLVRDATANNDS-GTSIDVLDQLGEMSYDTHEFRDIFSVLDRRISDKPKYWRH--- 72
           SPT+  V+ AT  +++ G +  +++++  ++Y     ++I  VL +R+S   +   H   
Sbjct: 13  SPTESKVKQATNEDETMGATGTLMNEISVLTYSPKTLKEIVQVLKKRLSGYSRKTSHKNC 72

Query: 73  --VAKSLTVVDYLVRFGSEACVQWARDNARQLEILRDFYYSDSAGIDQGQLIRVKAAELI 130
             + K+LT++ YL+  GS   V W R+N+  +  L             G  I+  AA+L+
Sbjct: 73  IFIIKTLTLMAYLINNGSNEFVAWIRNNSSLISNLISEKVEYPKDDKMGPEIKSIAADLM 132

Query: 131 DLLRDPERLATER 143
           +L++D + L   R
Sbjct: 133 ELIQDDDLLEERR 145

>NDAI0H00280 Chr8 complement(48177..49109) [933 bp, 310 aa] {ON}
           Anc_4.17 YLL038C
          Length = 310

 Score = 50.8 bits (120), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 41/170 (24%), Positives = 83/170 (48%), Gaps = 18/170 (10%)

Query: 17  SPTQVLVRDATANNDS-GTSIDVLDQLGEMSYDTHEFRDIFSVLDRRISDKP-------- 67
           +PT+  V+ AT +N++ G +  +++++  ++Y     +DI  V+ +R+S           
Sbjct: 13  TPTESKVKQATDDNETTGATGTLMNEISVLTYSPKTLKDIIQVIKKRLSSATSSNKKLSH 72

Query: 68  KYWRHVAKSLTVVDYLVRFGSEACVQWARDNARQLEILR---DFYYSDSAGIDQ--GQLI 122
           K   ++ K+LT++ YL+  GS   ++W R N   +E +    +F   D++   +  GQ I
Sbjct: 73  KTSVYIIKTLTLISYLINNGSNEFIEWLRLNFYLVENITKKCNFQLQDNSADSKMIGQ-I 131

Query: 123 RVKAAELIDLLRDPERLATERGMNMRGRRNALPPRRMG---PHRRPSMPR 169
           +V A ++ +L+ +   L   R   ++ R +   P R      H R S  +
Sbjct: 132 KVIAEDMTNLINNENLLEQRRKDVIQFRSSISSPGRKSTDNSHLRNSFTK 181

>KLTH0B04554g Chr2 (367962..370022) [2061 bp, 686 aa] {ON} weakly
           similar to uniprot|P53309 Saccharomyces cerevisiae
           YGR241C
          Length = 686

 Score = 45.4 bits (106), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 30/104 (28%), Positives = 46/104 (44%), Gaps = 2/104 (1%)

Query: 22  LVRDATANNDSGTSIDVLDQLGEMSYDTHEFRDIFSVLDRRISDKPKYWRHVAKSLTVVD 81
           LV+ AT    +      +D +   + D HEFR+I + LD R+ D    W  V KSL VV 
Sbjct: 7   LVKGATKIKMAPPKAKYVDPILLGTADPHEFREIMNALDARVQDTA--WTIVYKSLIVVH 64

Query: 82  YLVRFGSEACVQWARDNARQLEILRDFYYSDSAGIDQGQLIRVK 125
            ++R G            +    L+D ++S  +  D   L R +
Sbjct: 65  LMIREGEPLVTIKYLSKNQDFFSLKDIFHSKLSSGDLQALRRYR 108

>KAFR0I01460 Chr9 (304865..305692) [828 bp, 275 aa] {ON} Anc_4.17
           YLL038C
          Length = 275

 Score = 44.7 bits (104), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 30/116 (25%), Positives = 56/116 (48%), Gaps = 20/116 (17%)

Query: 5   FVRSTKNMFKGYSPTQVLVRDATANND----SGTSIDVLDQLGEMSYDTHEFRDIFSVLD 60
           F  S +N+   YS T++ VR AT  N+    +GT   +++++  ++Y     ++I  +L 
Sbjct: 3   FFNSVRNLV--YSQTELKVRQATDENEIIRSTGT---LMNEISVLTYSAKTLKEIIGILK 57

Query: 61  RRIS-----------DKPKYWRHVAKSLTVVDYLVRFGSEACVQWARDNARQLEIL 105
           +++S              K    V K+ T++ YL+  GS   + W + N   L+IL
Sbjct: 58  KKLSLLYGLKNGNGIISHKVCVQVLKTFTLISYLLNNGSNDFINWLKLNNGVLQIL 113

>Kwal_33.14899 s33 complement(863727..865784) [2058 bp, 685 aa] {ON}
           YGR241C (YAP1802) - member of clathrin assembly
           polypeptide AP180 family [contig 100] FULL
          Length = 685

 Score = 40.8 bits (94), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 30/107 (28%), Positives = 50/107 (46%), Gaps = 8/107 (7%)

Query: 22  LVRDATANNDSGTSIDVLDQLGEMSYDTHEFRDIFSVLDRRISDKPKYWRHVAKSLTVVD 81
           LV+ AT    +      +D +   + D HEFR+I   LD R+ D    W  V KSL +  
Sbjct: 7   LVKGATKIKMAPPKAKYVDPILLGTADPHEFREIIRALDARVQDTA--WTIVYKSLILAH 64

Query: 82  YLVRFGS-EACVQWARDNARQLEI--LRDFYYSDSAGIDQGQLIRVK 125
            ++R G     +++    ++ LE   L+D ++S  +  D   L R +
Sbjct: 65  LMIREGEPNVTIEYL---SKHLEFFRLKDIFHSKLSSGDLQALRRYR 108

>Suva_15.15 Chr15 complement(27309..30623) [3315 bp, 1104 aa] {ON}
           YOL145C (REAL)
          Length = 1104

 Score = 40.4 bits (93), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 49/84 (58%), Gaps = 6/84 (7%)

Query: 150 RRNALPPRRMGPHRRPSMPRRPEDEEDVDRALEESKKTAEEDEARRRKDQEREKQDLKEA 209
           +R  L    M      S+  + E E+D +  ++E++KT EE+E    K+QER KQ+ +EA
Sbjct: 904 QRIQLGETTMKSALERSLNEQEEFEKDQNAKIDEARKTLEENEL---KEQERIKQE-EEA 959

Query: 210 --VKLSKEEDELKRLQDEANNKPQ 231
             +KL ++ +E KRLQDEA    Q
Sbjct: 960 KRLKLERQTEEYKRLQDEAQKLIQ 983

>Kpol_344.8 s344 complement(20765..21919) [1155 bp, 384 aa] {ON}
           complement(20765..21919) [1155 nt, 385 aa]
          Length = 384

 Score = 38.9 bits (89), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 46/181 (25%), Positives = 77/181 (42%), Gaps = 30/181 (16%)

Query: 7   RSTKNMFKGYSPTQVLVRDATANNDSGTSIDVLDQLGEMSYDTHEFRDIFSVLDR---RI 63
           R  +NM   Y P Q+ +R AT  +  G +   L ++    Y    +     VL R    +
Sbjct: 21  RFMQNMIVQYEPYQIDIRRATNTDAWGPTTKHLQKVIRNKYSVPLYLMTEYVLKRIVDHL 80

Query: 64  SDKPK---------------YWRHVAKSLTVVDYLVRFGSE----ACVQWARDNARQL-- 102
           + +PK                WR + K L V++YL+   SE      V+   +N +Q+  
Sbjct: 81  AKRPKNLYEKARKEYVNYGSEWRIILKCLIVIEYLLLNVSEPEELNQVKSCLENHKQIFN 140

Query: 103 -EIL--RDFYYSDSAGIDQGQLIRVKAAELIDLLRDPERLATERGMNMRGRRNALPPRRM 159
             IL  +  + +D       + I+ K   +I+L+ DPE L  ER  N   ++N +  +R 
Sbjct: 141 SNILNYKIEFCNDGKMEVHERGIQKKCEVIINLVDDPEFLREERSKN---KKNMMKIQRS 197

Query: 160 G 160
           G
Sbjct: 198 G 198

>Skud_15.9 Chr15 complement(14799..18050) [3252 bp, 1083 aa] {ON}
           YOL145C (REAL)
          Length = 1083

 Score = 39.3 bits (90), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 47/83 (56%), Gaps = 4/83 (4%)

Query: 150 RRNALPPRRMGPHRRPSMPRRPEDEEDVDRALEESKKTAEEDEARRRKDQEREKQDLK-E 208
           +R  L    M      S+  + E E++    ++E++KT EE+E    K+QER KQ+ + +
Sbjct: 880 QRIQLGETTMKSALERSLNEQEEYEKEQSAKIDEARKTLEENEV---KEQERIKQEEETK 936

Query: 209 AVKLSKEEDELKRLQDEANNKPQ 231
            +KL K+ +E KRLQDEA    Q
Sbjct: 937 RLKLEKQAEEYKRLQDEAQKLIQ 959

>NDAI0J00930 Chr10 (209579..210835) [1257 bp, 418 aa] {ON} Anc_8.335
           YDR153C
          Length = 418

 Score = 38.9 bits (89), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 46/180 (25%), Positives = 75/180 (41%), Gaps = 30/180 (16%)

Query: 6   VRSTKNMFKGYSPTQVLVRDATANNDSGTSIDVLDQLGEMSYDTHEFRDIFSVLDR---R 62
            R  +N+   Y P QV +R AT  +  G +   L ++    Y    +  +   L R    
Sbjct: 20  ARFAQNVIVQYEPYQVDIRRATNTDAWGPTPKHLQKVLRNRYQVPLYLMVEYTLKRLVDH 79

Query: 63  ISDKPK---------------YWRHVAKSLTVVDYL---VRFGSEA-----CVQWARDN- 98
           I+ KPK                WR V K LTVV+YL   V  G E      C+   +   
Sbjct: 80  IAVKPKNFYERARKEYVNYGAEWRVVLKCLTVVEYLMLNVDDGDELNQVVRCLDTHKHIL 139

Query: 99  ARQLEILRDFYYSDSAGIDQGQLIRVKAAELIDLLRDPERLATERGMNMRGRRNALPPRR 158
            R++ + +  + +D       + IR K  +++  L DP  L  ER   ++ ++NA+  R+
Sbjct: 140 TREIPMYKVGFSNDGKMEIHERGIRKKGEDILQYLEDPSFLKQER---LKNKKNAMKIRQ 196

>KNAG0K02630 Chr11 (523259..526489) [3231 bp, 1076 aa] {ON} Anc_3.5
           YOL145C
          Length = 1076

 Score = 38.5 bits (88), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 43/72 (59%), Gaps = 6/72 (8%)

Query: 164 RPSMPRRPEDEEDVDR----ALEESKKTAEEDEARRRKDQEREKQDLKEAVKLSKEEDEL 219
           R S+ R   ++E  +R     L+E++K  E  E + R  + R K+D+++  KL+++++E 
Sbjct: 901 RTSLDRCITEQEAFEREQNSKLDEARKILEMKEQQER--ETRAKEDMEKLTKLARQKEEY 958

Query: 220 KRLQDEANNKPQ 231
           +RLQDEA    Q
Sbjct: 959 QRLQDEAQKLIQ 970

>NCAS0B03660 Chr2 complement(653627..654877) [1251 bp, 416 aa] {ON}
           Anc_8.335 YDR153C
          Length = 416

 Score = 37.7 bits (86), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 43/180 (23%), Positives = 72/180 (40%), Gaps = 30/180 (16%)

Query: 6   VRSTKNMFKGYSPTQVLVRDATANNDSGTSIDVLDQLGEMSYDTHEFRDIFSVLDR---R 62
            R  +N+   Y P QV +R AT  +  G +   L ++    Y    +  +   L R    
Sbjct: 20  ARFAQNVIVQYEPYQVDIRRATNTDAWGPTPKHLSKVLRNRYQVPLYLMVEYTLKRLVDH 79

Query: 63  ISDKPK---------------YWRHVAKSLTVVDYLVRFGSE--------ACVQWARDN- 98
           I+ +PK                WR V K L V+D+L+   SE        +C+   +   
Sbjct: 80  IASRPKNFYEKARKEYVNYGAEWRVVLKCLVVIDFLILNVSEGDELNQVLSCLTTHKHIL 139

Query: 99  ARQLEILRDFYYSDSAGIDQGQLIRVKAAELIDLLRDPERLATERGMNMRGRRNALPPRR 158
            R++   +  + +D       + IR K  +++  + DP  L  ER  N   R+NA   R+
Sbjct: 140 TREIPNFKVKFSNDGKMEIHERGIRKKGEDILQYMEDPHFLKKERSKN---RKNAAKIRQ 196

>ZYRO0F13508g Chr6 complement(1114200..1116263) [2064 bp, 687 aa]
           {ON} weakly similar to uniprot|P53309 Saccharomyces
           cerevisiae YGR241C YAP1802 Yeast Assembly Polypeptide,
           member of AP180 protein family, binds Pan1p and
           clathrin; member of clathrin assembly polypeptide AP180
           family and weakly similar to uniprot|P38856
           Saccharomyces cerevisiae YHR161C YAP1801 Yeast Assembly
           Polypeptide member of AP180 protein family binds Pan1p
           and clathrin clathrin assembly protein
          Length = 687

 Score = 37.7 bits (86), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 32/76 (42%), Gaps = 22/76 (28%)

Query: 48  DTHEFRDIFSVLDRRISDKPKYWRHVAKSLTVVDYLVRFGSE------------------ 89
           D H+F +I   LD RISD    W  V KSL ++  ++R G +                  
Sbjct: 33  DPHDFSEIAKALDERISDTA--WTIVYKSLMLLHLMIREGEKNVALKYYGGHTSFFDLNE 90

Query: 90  --ACVQWARDNARQLE 103
              C +W+  + R LE
Sbjct: 91  ISKCAKWSSADIRALE 106

>Smik_15.9 Chr15 complement(17702..20935) [3234 bp, 1077 aa] {ON}
           YOL145C (REAL)
          Length = 1077

 Score = 37.7 bits (86), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 44/73 (60%), Gaps = 8/73 (10%)

Query: 164 RPSMPRRPEDEEDVDR----ALEESKKTAEEDEARRRKDQEREKQD-LKEAVKLSKEEDE 218
           + ++ R   ++ED ++     ++E++K  EE+E    K+QER KQ+ +   +KL K+ +E
Sbjct: 889 KSALERSLNEQEDFEKEQNAKIDEARKILEENEL---KEQERMKQEEVARRLKLEKQAEE 945

Query: 219 LKRLQDEANNKPQ 231
            +RLQDEA    Q
Sbjct: 946 YRRLQDEAQKLIQ 958

>Smik_8.245 Chr8 complement(397342..399225) [1884 bp, 627 aa] {ON}
           YHR161C (REAL)
          Length = 627

 Score = 36.6 bits (83), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 23/40 (57%), Gaps = 8/40 (20%)

Query: 380 SRPESGSNNPFAL--------EKEEQDSGSNNPFSLTNYN 411
           S+P +GSNNPFAL        EK   D   NNPFS  N+N
Sbjct: 449 SQPPTGSNNPFALHNAATIATEKPALDPALNNPFSRPNFN 488

>TDEL0G01080 Chr7 (220997..222544) [1548 bp, 515 aa] {ON} Anc_5.84
          YGR241C
          Length = 515

 Score = 36.2 bits (82), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 22/40 (55%), Gaps = 2/40 (5%)

Query: 48 DTHEFRDIFSVLDRRISDKPKYWRHVAKSLTVVDYLVRFG 87
          D  EFR+I   LD RISD    W  V KSL VV  + R G
Sbjct: 33 DPAEFREIVRALDTRISDTA--WTIVYKSLIVVHLMFRDG 70

>TPHA0A05210 Chr1 complement(1173573..1175471) [1899 bp, 632 aa]
          {ON} Anc_5.84 YGR241C
          Length = 632

 Score = 36.2 bits (82), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 29/52 (55%), Gaps = 3/52 (5%)

Query: 48 DTHEFRDIFSVLDRRISDKPKYWRHVAKSLTVVDYLVRFGS-EACVQWARDN 98
          D H+FR+I   L  R++D    W  V KSL V+  L+R G  +  +++  +N
Sbjct: 33 DPHDFREIVKALHSRVNDSA--WTVVYKSLIVIHVLMREGDRDVAIKYFSNN 82

>NDAI0C03280 Chr3 complement(745118..747277) [2160 bp, 719 aa]
          {ON} Anc_5.84 YGR241C
          Length = 719

 Score = 35.4 bits (80), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 34/66 (51%), Gaps = 2/66 (3%)

Query: 22 LVRDATANNDSGTSIDVLDQLGEMSYDTHEFRDIFSVLDRRISDKPKYWRHVAKSLTVVD 81
          LV+ AT    +   +  ++ +   S D ++FR+I   L+ RISD    W    KS+ +V 
Sbjct: 7  LVKGATKIKLAPPKLKYIEPILLGSADPNDFREIIRALEARISDSA--WTIAYKSVIMVH 64

Query: 82 YLVRFG 87
           L+R G
Sbjct: 65 LLIREG 70

>TDEL0A00240 Chr1 complement(39383..42562) [3180 bp, 1059 aa] {ON}
           Anc_3.5 YOL145C
          Length = 1059

 Score = 35.0 bits (79), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 48/72 (66%), Gaps = 6/72 (8%)

Query: 164 RPSMPRRPEDEEDVD----RALEESKKTAEEDEARRRKDQEREKQDLKEAVKLSKEEDEL 219
           + ++ R  +++E+ +      L+E++K  EE+E  R++ Q++E +++++ +KL K+++E 
Sbjct: 888 KSALERIAKEQEEFELEQSNKLDEARKILEENEIERQEKQKKE-EEIRQ-MKLEKQKEEY 945

Query: 220 KRLQDEANNKPQ 231
           ++LQDEA    Q
Sbjct: 946 RKLQDEAQRLIQ 957

>YHR161C Chr8 complement(420373..422286) [1914 bp, 637 aa] {ON}
           YAP1801Protein involved in clathrin cage assembly; binds
           Pan1p and clathrin; homologous to Yap1802p, member of
           the AP180 protein family
          Length = 637

 Score = 34.7 bits (78), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 39/84 (46%), Gaps = 4/84 (4%)

Query: 22  LVRDATANNDSGTSIDVLDQLGEMSYDTHEFRDIFSVLDRRISDKPKYWRHVAKSLTVVD 81
           LV+ AT    +      LD +   + +  +F +I   LD RI+D    W  V KSL VV 
Sbjct: 7   LVKGATKIKSAPPKQKYLDPILLGTSNEEDFYEIVKGLDSRINDTA--WTIVYKSLLVVH 64

Query: 82  YLVRFGSEACVQWARDNARQLEIL 105
            ++R GS+      R  +R LE  
Sbjct: 65  LMIREGSKDVA--LRYYSRNLEFF 86

>TDEL0E03870 Chr5 complement(726712..728733) [2022 bp, 673 aa] {ON}
           Anc_5.239 YJL034W
          Length = 673

 Score = 34.3 bits (77), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 41/76 (53%), Gaps = 17/76 (22%)

Query: 174 EEDVDRALEESKKTAEEDEARRRKDQEREK-------------QDLKEAVKLSKEEDELK 220
           ++D+DR +EE++K A ED A ++K + R K              DL E  KL +E+ E  
Sbjct: 546 QDDIDRMVEEAEKFASEDAAIKKKIESRNKLENYAHSIKNQVNGDLGE--KLDEEDKE-- 601

Query: 221 RLQDEANNKPQYFDEN 236
            L D AN+  ++ ++N
Sbjct: 602 TLLDAANDTLEWLEDN 617

>TPHA0P01590 Chr16 (328049..331282) [3234 bp, 1077 aa] {ON} Anc_3.5
           YOL145C
          Length = 1077

 Score = 34.3 bits (77), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 44/82 (53%), Gaps = 2/82 (2%)

Query: 150 RRNALPPRRMGPHRRPSMPRRPEDEEDVDRALEESKKTAEEDEARRRKDQEREKQDLKEA 209
           +R  L    M    + S+  + E E      LE+++K  EE+E + +   E+EK+   E 
Sbjct: 886 QRIQLGETTMKNALQRSLKEQEEYELQQTGRLEQARKLIEENELKEKNRIEKEKE--LEQ 943

Query: 210 VKLSKEEDELKRLQDEANNKPQ 231
           +K++K+++E  +LQ+EA    Q
Sbjct: 944 MKIAKQKEEFAKLQEEAQKIIQ 965

>Smik_11.183 Chr11 complement(302731..303354) [624 bp, 207 aa] {ON}
           YKL065C (REAL)
          Length = 207

 Score = 32.7 bits (73), Expect = 2.0,   Method: Composition-based stats.
 Identities = 16/58 (27%), Positives = 29/58 (50%)

Query: 182 EESKKTAEEDEARRRKDQEREKQDLKEAVKLSKEEDELKRLQDEANNKPQYFDENGNP 239
           E+ K+ + +     +K  E+    +K   +L K++  L+ LQ +  N  +YFDE   P
Sbjct: 137 EQKKQKSSKPSQNVKKASEKGTDSVKLEEELKKKQISLEGLQKQVKNLEKYFDEKNQP 194

>Skud_10.188 Chr10 (349263..351311) [2049 bp, 682 aa] {ON} YJL034W
           (REAL)
          Length = 682

 Score = 33.5 bits (75), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 25/74 (33%), Positives = 41/74 (55%), Gaps = 13/74 (17%)

Query: 174 EEDVDRALEESKKTAEEDEARRRKDQEREKQD-----LKEAV------KLSKEEDELKRL 222
           +E++DR +EE++K A ED + + K + R K +     LK  V      KL +E+ E   L
Sbjct: 555 QEEIDRMVEEAEKFASEDASVKAKVESRNKLENYAHSLKNQVNGDLGEKLEEEDKE--TL 612

Query: 223 QDEANNKPQYFDEN 236
            D AN+  ++ D+N
Sbjct: 613 LDAANDVLEWLDDN 626

>ZYRO0F13684g Chr6 complement(1125731..1126954) [1224 bp, 407 aa]
           {ON} highly similar to uniprot|Q6Q5U2 Saccharomyces
           cerevisiae YDR153C ENT5 Protein containing an N-terminal
           epsin-like domain involved in clathrin recruitment and
           traffic between the Golgi and endosomes associates with
           the clathrin adaptor Gga2p clathrin adaptor complex AP-1
           and clathrin
          Length = 407

 Score = 33.1 bits (74), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 31/103 (30%), Positives = 42/103 (40%), Gaps = 21/103 (20%)

Query: 3   HQF---VRSTKNMFKGYSPTQVLVRDATANNDSGTSIDVLDQLGEMSYDTHEFRDIFSVL 59
           H F    R  +NM   Y P QV VR AT  +  G +   L+++    Y    +      L
Sbjct: 14  HDFRNAARFAQNMIVQYEPYQVDVRRATNTDSWGPTPKHLEKVLRNRYQVPMYLITEYTL 73

Query: 60  DR---RISDKPK---------------YWRHVAKSLTVVDYLV 84
            R    I+ +PK                WR V K LTVV+YL+
Sbjct: 74  KRLIDHIATRPKNFYEKARKEYVNYGSEWRVVLKCLTVVEYLL 116

>YJL034W Chr10 (381327..383375) [2049 bp, 682 aa] {ON}  KAR2ATPase
           involved in protein import into the ER, also acts as a
           chaperone to mediate protein folding in the ER and may
           play a role in ER export of soluble proteins; regulates
           the unfolded protein response via interaction with Ire1p
          Length = 682

 Score = 33.5 bits (75), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 25/74 (33%), Positives = 41/74 (55%), Gaps = 13/74 (17%)

Query: 174 EEDVDRALEESKKTAEEDEARRRKDQEREKQD-----LKEAV------KLSKEEDELKRL 222
           +E++DR +EE++K A ED + + K + R K +     LK  V      KL +E+ E   L
Sbjct: 555 QEEIDRMVEEAEKFASEDASIKAKVESRNKLENYAHSLKNQVNGDLGEKLEEEDKE--TL 612

Query: 223 QDEANNKPQYFDEN 236
            D AN+  ++ D+N
Sbjct: 613 LDAANDVLEWLDDN 626

>NDAI0C02310 Chr3 (524786..526843) [2058 bp, 685 aa] {ON} Anc_5.239
          Length = 685

 Score = 33.5 bits (75), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 42/74 (56%), Gaps = 13/74 (17%)

Query: 174 EEDVDRALEESKKTAEEDEARRRKDQEREKQD-----LKEAV------KLSKEEDELKRL 222
           ++D++R +EE++K A ED A + K + R K +     +K  V      KL  EED+ + L
Sbjct: 555 QDDIERMVEEAEKFASEDAAVKAKIESRNKLENYAHSIKNQVNGELGEKL--EEDDKETL 612

Query: 223 QDEANNKPQYFDEN 236
            D AN+  ++ ++N
Sbjct: 613 LDAANDTIEWLEDN 626

>Smik_10.238 Chr10 (377586..379637) [2052 bp, 683 aa] {ON} YJL034W
           (REAL)
          Length = 683

 Score = 33.1 bits (74), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 25/74 (33%), Positives = 41/74 (55%), Gaps = 13/74 (17%)

Query: 174 EEDVDRALEESKKTAEEDEARRRKDQEREKQD-----LKEAV------KLSKEEDELKRL 222
           +E++DR +EE++K A ED + + K + R K +     LK  V      KL +E+ E   L
Sbjct: 555 QEEIDRMVEEAEKFASEDASIKAKVESRNKLENYAHSLKNQVNGDLGEKLEEEDKE--TL 612

Query: 223 QDEANNKPQYFDEN 236
            D AN+  ++ D+N
Sbjct: 613 LDAANDVLEWLDDN 626

>KAFR0J01060 Chr10 (195020..197176) [2157 bp, 718 aa] {ON} Anc_5.239
           YJL034W
          Length = 718

 Score = 33.1 bits (74), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 43/72 (59%), Gaps = 9/72 (12%)

Query: 174 EEDVDRALEESKKTAEEDEARRRKDQEREK-QDLKEAVK------LSK--EEDELKRLQD 224
           ++D+DR +EE++K A ED A + K + R K ++   ++K      LS   EE++ + L D
Sbjct: 591 QDDIDRMVEEAEKYASEDAAFKNKIEARNKLENYAHSIKNQVNGDLSDKLEEEDKEALSD 650

Query: 225 EANNKPQYFDEN 236
            AN+  ++ ++N
Sbjct: 651 AANDTLEWLEDN 662

>KAFR0B05800 Chr2 complement(1200666..1201814) [1149 bp, 382 aa]
           {ON} Anc_8.335 YDR153C
          Length = 382

 Score = 32.7 bits (73), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 26/96 (27%), Positives = 41/96 (42%), Gaps = 18/96 (18%)

Query: 7   RSTKNMFKGYSPTQVLVRDATANNDSGTSIDVLDQLGEMSYDTHEFRDIFSVLDR---RI 63
           R  +N+   Y P Q+ VR AT  +  G +   L+++    +    +     +L R    I
Sbjct: 21  RFAQNVIVQYEPYQIDVRRATNTDAWGPTTKHLEKVMRNRFQVPMYLVTEYILKRLIDHI 80

Query: 64  SDKPK---------------YWRHVAKSLTVVDYLV 84
           + KPK                WR V K LTV++YL+
Sbjct: 81  ATKPKNLYEKARKEYVNYGSEWRVVLKCLTVIEYLL 116

>Skud_11.164 Chr11 complement(296221..296844) [624 bp, 207 aa] {ON}
           YKL065C (REAL)
          Length = 207

 Score = 32.0 bits (71), Expect = 3.4,   Method: Composition-based stats.
 Identities = 17/58 (29%), Positives = 29/58 (50%), Gaps = 7/58 (12%)

Query: 189 EEDEARRRKDQEREKQDLKEAVKLSKEEDELKR-------LQDEANNKPQYFDENGNP 239
           E+ + +  K   + ++  KEA   +K ++ELK+       LQ +  N  +YFDE   P
Sbjct: 137 EQKKQKLTKTSSKAEKASKEAANYAKLQEELKKKQISLEGLQKQVKNLEKYFDEKNQP 194

>Kpol_1036.76 s1036 complement(205197..206303) [1107 bp, 368 aa]
           {ON} complement(205197..206303) [1107 nt, 369 aa]
          Length = 368

 Score = 32.7 bits (73), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 39/179 (21%), Positives = 72/179 (40%), Gaps = 30/179 (16%)

Query: 7   RSTKNMFKGYSPTQVLVRDATANNDSGTSIDVLDQLGEMSYDTHEFRDIFSVLDR---RI 63
           R  +NM   Y P Q+ +R AT  +  G +   L ++    Y    +     +L R    I
Sbjct: 21  RFAQNMIVQYEPYQIDIRTATNTDSWGPTSKHLQKVIRHKYHVPVYLMTEYILKRLIDHI 80

Query: 64  SDKPK---------------YWRHVAKSLTVVDYLVRFGSEA--------CV-QWARDNA 99
           + KPK                WR V K L ++++L+   S+         C+ +     +
Sbjct: 81  ASKPKNFYEKARKEYVNYGNEWRVVMKCLILIEFLLMNVSDGDELHQVLTCLKKHIHILS 140

Query: 100 RQLEILRDFYYSDSAGIDQGQLIRVKAAELIDLLRDPERLATERGMNMRGRRNALPPRR 158
           R+    R  + +D       + I  K+  ++ L+ DP+ L  +R  ++   +N L  R+
Sbjct: 141 RETTTYRIPFSNDGKMEIHERGIHKKSELIVQLIEDPDFLNQQRSTHI---KNTLKIRK 196

>Suva_11.160 Chr11 complement(299168..299791) [624 bp, 207 aa] {ON}
           YKL065C (REAL)
          Length = 207

 Score = 32.0 bits (71), Expect = 4.0,   Method: Composition-based stats.
 Identities = 17/58 (29%), Positives = 31/58 (53%), Gaps = 2/58 (3%)

Query: 182 EESKKTAEEDEARRRKDQEREKQDLKEAVKLSKEEDELKRLQDEANNKPQYFDENGNP 239
           E+ K T    ++ +  +++ E   L+E  +L K++  L+ LQ +  N  +YFDE   P
Sbjct: 139 EKQKLTKTSPKSEKISNKKAESTKLQE--QLKKKQISLEGLQKQVKNLEKYFDEKNQP 194

>CAGL0J11572g Chr10 complement(1124993..1126375) [1383 bp, 460 aa]
           {ON} similar to uniprot|P33895 Saccharomyces cerevisiae
           YOL069w NUF2 spindle pole body protein
          Length = 460

 Score = 32.3 bits (72), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 51/119 (42%), Gaps = 22/119 (18%)

Query: 13  FKGYSPTQVLV-----RDATANNDSGTSIDVLD-------QLGEMSYDTHEFRDIFSVLD 60
           F G SP QVL      R  T  ND  TS+D+ D       Q+  ++   ++F +   + D
Sbjct: 53  FMGISPEQVLAEQLSSRQNTEGNDESTSVDMFDGPYRETLQMLTLNKICYKFFENVGIND 112

Query: 61  RRISD--KPKYWRHVAKSLTVVDYLVRFGSEA---CVQWARDNARQLEILR----DFYY 110
             I D  KP+ +R       VV+Y  RF  E    C Q+       L+ L+    DF Y
Sbjct: 113 FNIVDLYKPEAYRTRRLLSAVVNY-ARFREERMFDCNQFIIQMEEMLDELKSKFDDFNY 170

>KAFR0E01650 Chr5 complement(337914..339959) [2046 bp, 681 aa] {ON}
           Anc_5.239 YJL034W
          Length = 681

 Score = 32.7 bits (73), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 43/72 (59%), Gaps = 9/72 (12%)

Query: 174 EEDVDRALEESKKTAEEDEARRRKDQEREK-QDLKEAVK------LSK--EEDELKRLQD 224
           ++D+DR +EE++K A ED A + K + R K ++   ++K      LS   EE++ + L D
Sbjct: 554 QDDIDRMVEEAEKYASEDAAFKNKIEARNKLENYAHSIKNQVNGDLSDKLEEEDKEALLD 613

Query: 225 EANNKPQYFDEN 236
            AN+  ++ ++N
Sbjct: 614 AANDTLEWLEDN 625

>NCAS0A01220 Chr1 (238768..240819) [2052 bp, 683 aa] {ON} Anc_5.239
          Length = 683

 Score = 32.3 bits (72), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 41/74 (55%), Gaps = 13/74 (17%)

Query: 174 EEDVDRALEESKKTAEEDEARRRKDQEREKQD-----LKEAV------KLSKEEDELKRL 222
           ++D++R +EE++K A ED A + K + R K +     LK  V      KL +E+ E   L
Sbjct: 557 QDDIERMVEEAEKFASEDAALKTKIESRNKLENYAHSLKNQVSGDLGDKLEEEDKE--TL 614

Query: 223 QDEANNKPQYFDEN 236
            D AN+  ++ ++N
Sbjct: 615 LDAANDVAEWLEDN 628

>KNAG0F02620 Chr6 complement(491602..493653) [2052 bp, 683 aa] {ON}
           Anc_5.239 YJL034W
          Length = 683

 Score = 32.3 bits (72), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 40/72 (55%), Gaps = 9/72 (12%)

Query: 174 EEDVDRALEESKKTAEEDEARRRKDQEREKQD---------LKEAVKLSKEEDELKRLQD 224
           ++++D+ +EE++K A EDEA + K + R K +         L   +  + EED+ + L D
Sbjct: 556 QDEIDKMVEEAEKYASEDEAFKTKVESRNKLENYAHSLKNQLNAELGDNLEEDDKETLLD 615

Query: 225 EANNKPQYFDEN 236
             N+  ++ ++N
Sbjct: 616 AVNDTLEWLEDN 627

>Kwal_YGOB_27.11261 s27 complement(716644..717033,717035..717859)
           [1215 bp, 404 aa] {ON} ANNOTATED BY YGOB -
          Length = 404

 Score = 31.6 bits (70), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 42/165 (25%), Positives = 64/165 (38%), Gaps = 27/165 (16%)

Query: 7   RSTKNMFKGYSPTQVLVRDATANNDSGTSIDVLDQLGEMSYDT--HEFRD-IFSVLDRRI 63
           R  +N+   Y P QV +R AT  +  G +   L ++    Y    H   +     L   I
Sbjct: 21  RFAQNVIVQYEPYQVDIRRATNTDSWGPTPKHLFKVMRNKYQVPLHLMTEYTLKRLVDHI 80

Query: 64  SDKPK---------------YWRHVAKSLTVVDYL---VRFGSE-----ACV-QWARDNA 99
           + +PK                WR V K L V++YL   V  GSE      C+    R  +
Sbjct: 81  ASRPKNLYEKARKQYVNYGNEWRVVLKCLVVLEYLLLNVDSGSEVDQVIGCLTTHKRILS 140

Query: 100 RQLEILRDFYYSDSAGIDQGQLIRVKAAELIDLLRDPERLATERG 144
           R +   R  + +D       + I+ K  +++  L DP  L  ER 
Sbjct: 141 RDVMQFRVDFSADGKMEVHERGIKKKCEQILQYLEDPSYLKRERA 185

>Kpol_1004.11 s1004 (21688..23745) [2058 bp, 685 aa] {ON}
           (21688..23745) [2058 nt, 686 aa]
          Length = 685

 Score = 32.0 bits (71), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 39/72 (54%), Gaps = 9/72 (12%)

Query: 174 EEDVDRALEESKKTAEEDEARRRKDQEREKQD-----LKEAVK----LSKEEDELKRLQD 224
           ++D++R +E+++K A EDE  + K + R K +     LK  VK       +ED+ + L D
Sbjct: 553 KDDIERMVEDAEKYASEDEMIKAKIESRNKLENYAHSLKNQVKGDLATVLDEDDKETLLD 612

Query: 225 EANNKPQYFDEN 236
             N+   + D+N
Sbjct: 613 AVNDVLDWLDDN 624

>Suva_12.47 Chr12 (64212..66263) [2052 bp, 683 aa] {ON} YJL034W
           (REAL)
          Length = 683

 Score = 31.6 bits (70), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 41/74 (55%), Gaps = 13/74 (17%)

Query: 174 EEDVDRALEESKKTAEEDEARRRKDQEREKQD-----LKEAV------KLSKEEDELKRL 222
           ++++DR +EE++K A ED + + K + R K +     LK  V      KL +E+ E   L
Sbjct: 555 QDEIDRMVEEAEKYASEDASIKAKVESRNKLENYAHSLKNQVNGDLGEKLEEEDKE--TL 612

Query: 223 QDEANNKPQYFDEN 236
            D AN+  ++ D+N
Sbjct: 613 LDAANDVLEWLDDN 626

>Suva_2.687 Chr2 complement(1215095..1218481) [3387 bp, 1128 aa]
           {ON} YCL024W (REAL)
          Length = 1128

 Score = 31.6 bits (70), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 39/54 (72%), Gaps = 2/54 (3%)

Query: 172 EDEEDVDRALEESKKTAEEDEARRRKDQEREK-QDLKEAVKLSKEEDELKRLQD 224
           +++E+++R ++E+K   EE E R+RK +E+E+ + L E  +L ++++ELK+  D
Sbjct: 561 KEKEELERKVKEAK-ALEELERRKRKQEEKERARKLLEKEELKRKQEELKKQID 613

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.310    0.126    0.357 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 62,894,255
Number of extensions: 2833246
Number of successful extensions: 29775
Number of sequences better than 10.0: 939
Number of HSP's gapped: 28117
Number of HSP's successfully gapped: 1660
Length of query: 701
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 584
Effective length of database: 40,065,477
Effective search space: 23398238568
Effective search space used: 23398238568
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 69 (31.2 bits)