Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0E017505.711ON66566534300.0
TDEL0B020905.711ON64360022340.0
KLTH0E00836g5.711ON64160122110.0
KLLA0A00418g5.711ON64261822080.0
KAFR0D021705.711ON66064621930.0
SAKL0E15114g5.711ON64963521910.0
Kwal_55.196495.711ON64160121830.0
CAGL0H06699g5.711ON65067021830.0
TPHA0E001505.711ON64659821740.0
NCAS0G001805.711ON65460221600.0
Ecym_40105.711ON64464921370.0
ZYRO0B16522g5.711ON64366321360.0
AFR295W5.711ON63160221090.0
Kpol_1043.775.711ON65766921090.0
NDAI0F002105.711ON65360220850.0
YIL155C (GUT2)5.711ON64960720330.0
Skud_9.135.711ON64960720280.0
Smik_9.145.711ON65260720070.0
Suva_9.325.711ON53854519320.0
KNAG0L021905.711ON64560019100.0
KLLA0D16478g8.327ON28491761.1
TDEL0C039802.263ON690155752.3
Skud_8.2315.71ON261162723.4
TDEL0G043806.31ON72246708.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0E01750
         (665 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0E01750 Chr5 (427657..429654) [1998 bp, 665 aa] {ON} Anc_5.7...  1325   0.0  
TDEL0B02090 Chr2 complement(372755..374686) [1932 bp, 643 aa] {O...   865   0.0  
KLTH0E00836g Chr5 complement(83201..85126) [1926 bp, 641 aa] {ON...   856   0.0  
KLLA0A00418g Chr1 complement(33084..35012) [1929 bp, 642 aa] {ON...   855   0.0  
KAFR0D02170 Chr4 complement(435640..437622) [1983 bp, 660 aa] {O...   849   0.0  
SAKL0E15114g Chr5 (1256624..1258573) [1950 bp, 649 aa] {ON} high...   848   0.0  
Kwal_55.19649 s55 complement(65706..67631) [1926 bp, 641 aa] {ON...   845   0.0  
CAGL0H06699g Chr8 (665295..667247) [1953 bp, 650 aa] {ON} simila...   845   0.0  
TPHA0E00150 Chr5 complement(11922..13862) [1941 bp, 646 aa] {ON}...   842   0.0  
NCAS0G00180 Chr7 complement(25495..27459) [1965 bp, 654 aa] {ON}...   836   0.0  
Ecym_4010 Chr4 complement(24630..26564) [1935 bp, 644 aa] {ON} s...   827   0.0  
ZYRO0B16522g Chr2 (1340223..1342154) [1932 bp, 643 aa] {ON} high...   827   0.0  
AFR295W Chr6 (970178..972073) [1896 bp, 631 aa] {ON} Syntenic ho...   816   0.0  
Kpol_1043.77 s1043 (168788..170761) [1974 bp, 657 aa] {ON} (1687...   816   0.0  
NDAI0F00210 Chr6 complement(39658..41619) [1962 bp, 653 aa] {ON}...   807   0.0  
YIL155C Chr9 complement(51759..53708) [1950 bp, 649 aa] {ON}  GU...   787   0.0  
Skud_9.13 Chr9 complement(28747..30696) [1950 bp, 649 aa] {ON} Y...   785   0.0  
Smik_9.14 Chr9 complement(29383..31341) [1959 bp, 652 aa] {ON} Y...   777   0.0  
Suva_9.32 Chr9 complement(46397..48013) [1617 bp, 538 aa] {ON} Y...   748   0.0  
KNAG0L02190 Chr12 (391987..393924) [1938 bp, 645 aa] {ON} Anc_5....   740   0.0  
KLLA0D16478g Chr4 complement(1391173..1392027) [855 bp, 284 aa] ...    34   1.1  
TDEL0C03980 Chr3 complement(697431..699503) [2073 bp, 690 aa] {O...    33   2.3  
Skud_8.231 Chr8 (410736..411521) [786 bp, 261 aa] {ON} YHR167W (...    32   3.4  
TDEL0G04380 Chr7 (792278..794446) [2169 bp, 722 aa] {ON} Anc_6.3...    32   8.6  

>TBLA0E01750 Chr5 (427657..429654) [1998 bp, 665 aa] {ON} Anc_5.711
           YIL155C
          Length = 665

 Score = 1325 bits (3430), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 643/665 (96%), Positives = 643/665 (96%)

Query: 1   MYSRLSRVSRPLKTTLAILTVASGSLLTYNHFYLNQSSLLYSDTKPLKTSLNSEEDLQKI 60
           MYSRLSRVSRPLKTTLAILTVASGSLLTYNHFYLNQSSLLYSDTKPLKTSLNSEEDLQKI
Sbjct: 1   MYSRLSRVSRPLKTTLAILTVASGSLLTYNHFYLNQSSLLYSDTKPLKTSLNSEEDLQKI 60

Query: 61  ANGSYKPPSRSELLSNLEKTKKFDVLXXXXXXXXXXXXVDASTRGLNVALMEMNDFXXXX 120
           ANGSYKPPSRSELLSNLEKTKKFDVL            VDASTRGLNVALMEMNDF    
Sbjct: 61  ANGSYKPPSRSELLSNLEKTKKFDVLIIGGGATGTGCAVDASTRGLNVALMEMNDFASAT 120

Query: 121 XXXXXXMAHGGVRYLEKAVFQLSKAQLDLVIEALNERKHMLQTAPHLCKILPIMIPVYNY 180
                 MAHGGVRYLEKAVFQLSKAQLDLVIEALNERKHMLQTAPHLCKILPIMIPVYNY
Sbjct: 121 SSKSTKMAHGGVRYLEKAVFQLSKAQLDLVIEALNERKHMLQTAPHLCKILPIMIPVYNY 180

Query: 181 WEVPYFYAGCKMYDFFAGSQNLKSAYLLSKTSAGQIAPMLDVPKLKAALVYHDGSFNDAR 240
           WEVPYFYAGCKMYDFFAGSQNLKSAYLLSKTSAGQIAPMLDVPKLKAALVYHDGSFNDAR
Sbjct: 181 WEVPYFYAGCKMYDFFAGSQNLKSAYLLSKTSAGQIAPMLDVPKLKAALVYHDGSFNDAR 240

Query: 241 MNVSLAVTAIENGATVLNYMEVEKLIKDPKTGKIQGATVRDRETDKKYDVMAKVVVNSTG 300
           MNVSLAVTAIENGATVLNYMEVEKLIKDPKTGKIQGATVRDRETDKKYDVMAKVVVNSTG
Sbjct: 241 MNVSLAVTAIENGATVLNYMEVEKLIKDPKTGKIQGATVRDRETDKKYDVMAKVVVNSTG 300

Query: 301 PFSDNILQMDRNKSGYPDIFDKANIDTSKLPSIDHDNLSRIAVDNPKMVVPSAGVHIILP 360
           PFSDNILQMDRNKSGYPDIFDKANIDTSKLPSIDHDNLSRIAVDNPKMVVPSAGVHIILP
Sbjct: 301 PFSDNILQMDRNKSGYPDIFDKANIDTSKLPSIDHDNLSRIAVDNPKMVVPSAGVHIILP 360

Query: 361 SYYCPKDMGILDVKTADGRVMFFLPWQDKVLAGTTDIPMKKVPENPVATEADIEDILSEL 420
           SYYCPKDMGILDVKTADGRVMFFLPWQDKVLAGTTDIPMKKVPENPVATEADIEDILSEL
Sbjct: 361 SYYCPKDMGILDVKTADGRVMFFLPWQDKVLAGTTDIPMKKVPENPVATEADIEDILSEL 420

Query: 421 QHYCKFPVKREDVLSAWAGIRPLVRDPRKLSPNSKGDDSTQGLVRSHFIFTSENNLVTIA 480
           QHYCKFPVKREDVLSAWAGIRPLVRDPRKLSPNSKGDDSTQGLVRSHFIFTSENNLVTIA
Sbjct: 421 QHYCKFPVKREDVLSAWAGIRPLVRDPRKLSPNSKGDDSTQGLVRSHFIFTSENNLVTIA 480

Query: 481 GGKWTTYRRMAEETIDEAIKVGQLPNKPSVTKDLILSGGENWTPNTAALLSQKYHIPSSL 540
           GGKWTTYRRMAEETIDEAIKVGQLPNKPSVTKDLILSGGENWTPNTAALLSQKYHIPSSL
Sbjct: 481 GGKWTTYRRMAEETIDEAIKVGQLPNKPSVTKDLILSGGENWTPNTAALLSQKYHIPSSL 540

Query: 541 SKYLSENYGTRAPIICELLKKDKKNELPVTLAGKEHNEILGNVDFQALRYPYTVAEVKYC 600
           SKYLSENYGTRAPIICELLKKDKKNELPVTLAGKEHNEILGNVDFQALRYPYTVAEVKYC
Sbjct: 541 SKYLSENYGTRAPIICELLKKDKKNELPVTLAGKEHNEILGNVDFQALRYPYTVAEVKYC 600

Query: 601 IDNEYSRTALDFLLRRTRFGFLDAKEAMNAVEGTVSIMGDELNWDSEKRSLEIKKSKEYI 660
           IDNEYSRTALDFLLRRTRFGFLDAKEAMNAVEGTVSIMGDELNWDSEKRSLEIKKSKEYI
Sbjct: 601 IDNEYSRTALDFLLRRTRFGFLDAKEAMNAVEGTVSIMGDELNWDSEKRSLEIKKSKEYI 660

Query: 661 KTLGV 665
           KTLGV
Sbjct: 661 KTLGV 665

>TDEL0B02090 Chr2 complement(372755..374686) [1932 bp, 643 aa] {ON}
           Anc_5.711 YIL155C
          Length = 643

 Score =  865 bits (2234), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 405/600 (67%), Positives = 485/600 (80%), Gaps = 11/600 (1%)

Query: 66  KPPSRSELLSNLEKTKKFDVLXXXXXXXXXXXXVDASTRGLNVALMEMNDFXXXXXXXXX 125
           K PSR +LLS L KT +FDVL            VDA+TRGLNVAL+EM+DF         
Sbjct: 55  KLPSREDLLSKLSKTDQFDVLVIGGGATGTGCAVDAATRGLNVALVEMHDFASGTSSKST 114

Query: 126 XMAHGGVRYLEKAVFQLSKAQLDLVIEALNERKHMLQTAPHLCKILPIMIPVYNYWEVPY 185
            MAHGGVRYLEKAVFQLSKAQLDLVIEALNER HML TAPHLCKILPIMIPVY YW++PY
Sbjct: 115 KMAHGGVRYLEKAVFQLSKAQLDLVIEALNERGHMLNTAPHLCKILPIMIPVYTYWQIPY 174

Query: 186 FYAGCKMYDFFAGSQNLKSAYLLSKTSAGQIAPMLDVPKLKAALVYHDGSFNDARMNVSL 245
           FY GCKMYD FAGSQNLK++YLL+K  A  IAPMLD   LKA LVYHDGSFND+RMN +L
Sbjct: 175 FYVGCKMYDLFAGSQNLKNSYLLTKRQAADIAPMLDPTTLKAGLVYHDGSFNDSRMNTAL 234

Query: 246 AVTAIENGATVLNYMEVEKLIKDPKTGKIQGATVRDRETDKKYDVMAKVVVNSTGPFSDN 305
           AVTAIENGATVLNYMEV++LIKD +TGK+QGA V +RET +++ V AKV VN+TGP+SD 
Sbjct: 235 AVTAIENGATVLNYMEVKQLIKDKETGKVQGALVTNRETGEQFTVKAKVTVNATGPYSDK 294

Query: 306 ILQMDRNKSGYPDIFDKANIDTSKLPSIDHDNLSRIAVDNPKMVVPSAGVHIILPSYYCP 365
           +LQMD NK G PD        T  LP+      +++AV+NPKMVVPSAGVHIILPS+YCP
Sbjct: 295 LLQMDENKDGKPD-------PTKPLPNATIS--TKVAVENPKMVVPSAGVHIILPSFYCP 345

Query: 366 KDMGILDVKTADGRVMFFLPWQDKVLAGTTDIPMKKVPENPVATEADIEDILSELQHYCK 425
           ++MG+LDVKT+DGRVMFFLPWQ KVLAGTTDIPMK+VP+ P A E+DI+DIL ELQHY K
Sbjct: 346 REMGLLDVKTSDGRVMFFLPWQGKVLAGTTDIPMKQVPQTPTAAESDIQDILQELQHYIK 405

Query: 426 FPVKREDVLSAWAGIRPLVRDPRKLSPNSKGDDSTQGLVRSHFIFTSENNLVTIAGGKWT 485
           FPVKREDVLSAWAGIRPLV DPRK   N+ G  STQGLVRSH  FT++N +VTIAGGKWT
Sbjct: 406 FPVKREDVLSAWAGIRPLVIDPRKSQGNTGG--STQGLVRSHLCFTTDNGMVTIAGGKWT 463

Query: 486 TYRRMAEETIDEAIKVGQLPNKPSVTKDLILSGGENWTPNTAALLSQKYHIPSSLSKYLS 545
           TYR MAEETI+E +KVG+   KP +T+ L LSG ENW PN AALL+QKYH+  ++S +LS
Sbjct: 464 TYREMAEETINEVVKVGKFNVKPCITRKLKLSGAENWNPNLAALLAQKYHLSGAMSNHLS 523

Query: 546 ENYGTRAPIICELLKKDKKNELPVTLAGKEHNEILGNVDFQALRYPYTVAEVKYCIDNEY 605
           ENYGTRAP+ICE+ ++D++N+LPVT  G+E+  + GNV+F + RYP+T+ E+ Y +D EY
Sbjct: 524 ENYGTRAPLICEMFQEDERNQLPVTFGGRENVTVYGNVNFDSFRYPFTIGELNYSVDYEY 583

Query: 606 SRTALDFLLRRTRFGFLDAKEAMNAVEGTVSIMGDELNWDSEKRSLEIKKSKEYIKTLGV 665
           +RTALDFL+RRTRF FLDA++A++AVEGTV++MGD+LNWDS +R  EI+KSKE+I+T GV
Sbjct: 584 TRTALDFLMRRTRFAFLDARQALDAVEGTVTVMGDKLNWDSTRRKHEIEKSKEFIRTFGV 643

>KLTH0E00836g Chr5 complement(83201..85126) [1926 bp, 641 aa] {ON}
           similar to uniprot|P32191 Saccharomyces cerevisiae
           YIL155C GUT2 Mitochondrial glycerol-3-phosphate
           dehydrogenase expression is repressed by both glucose
           and cAMP and derepressed by non-fermentable carbon
           sources in a Snf1p Rsf1p Hap2/3/4/5 complex dependent
           manner
          Length = 641

 Score =  856 bits (2211), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/601 (66%), Positives = 479/601 (79%), Gaps = 12/601 (1%)

Query: 68  PSRSELLSNLEKTKKFDVLXXXXXXXXXXXXVDASTRGLNVALMEMNDFXXXXXXXXXXM 127
           PSRSELL  + KT +FDVL            VD +TRGLNVAL+EMNDF          M
Sbjct: 50  PSRSELLDKMAKTDQFDVLVIGGGATGTGCAVDGATRGLNVALVEMNDFASGTSSKSTKM 109

Query: 128 AHGGVRYLEKAVFQLSKAQLDLVIEALNERKHMLQTAPHLCKILPIMIPVYNYWEVPYFY 187
           AHGGVRYLEKA ++LSKAQLDLVIEALNER HML TAPHLCK+LPIMIPVYNYW+VPYFY
Sbjct: 110 AHGGVRYLEKAFWELSKAQLDLVIEALNERGHMLNTAPHLCKVLPIMIPVYNYWQVPYFY 169

Query: 188 AGCKMYDFFAGSQNLKSAYLLSKTSAGQIAPMLDVPKLKAALVYHDGSFNDARMNVSLAV 247
            GCKMYD FAGSQNLKS+Y+++   A ++APMLD   LKA LVYHDGSFND+RMN +LAV
Sbjct: 170 VGCKMYDLFAGSQNLKSSYMMTARRASEVAPMLDASILKAGLVYHDGSFNDSRMNAALAV 229

Query: 248 TAIENGATVLNYMEVEKLIKDPKTGKIQGATVRDRETDKKYDVMAKVVVNSTGPFSDNIL 307
           TAIE GATVLNYMEV +L+K+ KTG+++GA  RDRET K++ + AKVVVNSTGPFSD IL
Sbjct: 230 TAIERGATVLNYMEVTRLLKNEKTGRVEGAMARDRETGKEFRINAKVVVNSTGPFSDRIL 289

Query: 308 QMDRNKSGYPDIFDKANIDTSKLPSIDHDNL-SRIAVDNPKMVVPSAGVHIILPSYYCPK 366
           QMD  K G P        D  +  +  HD++ SR+AV NP+MVVPSAGVHI+LP++YCPK
Sbjct: 290 QMDNAKDGLP------RNDLVQFANEGHDSIGSRVAVSNPRMVVPSAGVHIVLPAFYCPK 343

Query: 367 DMGILDVKTADGRVMFFLPWQDKVLAGTTDIPMKKVPENPVATEADIEDILSELQHYCKF 426
            +G+LD KT+DGRVMFFLPWQ KVLAGTTDIPMK+VPENP ATEADI+DIL ELQHY KF
Sbjct: 344 QIGLLDAKTSDGRVMFFLPWQGKVLAGTTDIPMKQVPENPTATEADIQDILKELQHYIKF 403

Query: 427 PVKREDVLSAWAGIRPLVRDPRKLSPNSKGDD--STQGLVRSHFIFTSENNLVTIAGGKW 484
           PVKREDVLSAWAGIRPLVRDPR L    +GDD  STQGLVR+HF+FTS+N LVTIAGGKW
Sbjct: 404 PVKREDVLSAWAGIRPLVRDPRTL---KEGDDVSSTQGLVRNHFLFTSDNGLVTIAGGKW 460

Query: 485 TTYRRMAEETIDEAIKVGQLPNKPSVTKDLILSGGENWTPNTAALLSQKYHIPSSLSKYL 544
           TTYR MAEETIDE +K G    KP +TK + L+G E W PN  A+L+Q+YH+ S ++++L
Sbjct: 461 TTYREMAEETIDEVVKQGHFQAKPCITKKIKLAGAEGWDPNFVAMLAQEYHLSSKMAEHL 520

Query: 545 SENYGTRAPIICELLKKDKKNELPVTLAGKEHNEILGNVDFQALRYPYTVAEVKYCIDNE 604
           + NYGTR+PIICE+ ++D+KN+LPVT  G+E+  +  NV+F + RYP+T+AE+KY +  E
Sbjct: 521 ANNYGTRSPIICEMFRRDEKNQLPVTFGGRENVTVYKNVNFDSFRYPFTIAELKYSVKYE 580

Query: 605 YSRTALDFLLRRTRFGFLDAKEAMNAVEGTVSIMGDELNWDSEKRSLEIKKSKEYIKTLG 664
           Y+RTALDFL+RRTRFGFLDAK+A+ AV+GTVSIMGDEL WD  KR  EI+++ ++IKT G
Sbjct: 581 YTRTALDFLMRRTRFGFLDAKQALEAVKGTVSIMGDELGWDENKRLSEIQQASDFIKTFG 640

Query: 665 V 665
           V
Sbjct: 641 V 641

>KLLA0A00418g Chr1 complement(33084..35012) [1929 bp, 642 aa] {ON}
           similar to uniprot|P32191 Saccharomyces cerevisiae
           YIL155C GUT2 Mitochondrial glycerol-3-phosphate
           dehydrogenase expression is repressed by both glucose
           and cAMP and derepressed by non-fermentable carbon
           sources in a Snf1p Rsf1p Hap2/3/4/5 complex dependent
           manner
          Length = 642

 Score =  855 bits (2208), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 402/618 (65%), Positives = 488/618 (78%), Gaps = 13/618 (2%)

Query: 50  SLNSEEDLQKIANGSYKPPSRSELLSNLEKTKKFDVLXXXXXXXXXXXXVDASTRGLNVA 109
           +L ++  +  I   +   PSR+ LLS L KT KFDVL            +DASTRGLNVA
Sbjct: 36  TLQNDVSVSTIKKSNVDLPSRANLLSRLSKTDKFDVLIIGGGATGTGCALDASTRGLNVA 95

Query: 110 LMEMNDFXXXXXXXXXXMAHGGVRYLEKAVFQLSKAQLDLVIEALNERKHMLQTAPHLCK 169
           L+EMNDF          MAHGGVRYLEKA ++LSKAQLDLVIEALNER HML TAPHLCK
Sbjct: 96  LVEMNDFASGTSSKSTKMAHGGVRYLEKAFWELSKAQLDLVIEALNERAHMLNTAPHLCK 155

Query: 170 ILPIMIPVYNYWEVPYFYAGCKMYDFFAGSQNLKSAYLLSKTSAGQIAPMLDVPKLKAAL 229
           ILPIMIPVYNYW+VPYFY G KMYD FAGSQNLKS+YLLS + A ++APMLD  KLKA L
Sbjct: 156 ILPIMIPVYNYWQVPYFYVGTKMYDLFAGSQNLKSSYLLSPSRASEVAPMLDASKLKAGL 215

Query: 230 VYHDGSFNDARMNVSLAVTAIENGATVLNYMEVEKLIKDPKTGKIQGATVRDRETDKKYD 289
           VYHDGSFND+RMN SLA+TAIE GATVLNY+++++L+K+ +TGK++GA   DRET  +Y 
Sbjct: 216 VYHDGSFNDSRMNSSLAITAIEKGATVLNYVQIKQLVKNKETGKVEGAIAVDRETGDEYQ 275

Query: 290 VMAKVVVNSTGPFSDNILQMDRNKSGYPD--IFDKANIDTSKLPSIDHDNLSRIAVDNPK 347
           + AKVVVN+TGP+SD +LQMD++ +G PD  +  K N + +          ++IAV NPK
Sbjct: 276 IKAKVVVNATGPYSDRLLQMDQSPTGLPDDSVLQKINENATV--------STKIAVPNPK 327

Query: 348 MVVPSAGVHIILPSYYCPKDMGILDVKTADGRVMFFLPWQDKVLAGTTDIPMKKVPENPV 407
           MVVPSAGVHI+LPS+YCPK++G+LD +T+DGRVMFFLPWQ KVLAGTTDIPMK++PENP 
Sbjct: 328 MVVPSAGVHIVLPSFYCPKEIGLLDAQTSDGRVMFFLPWQGKVLAGTTDIPMKQIPENPT 387

Query: 408 ATEADIEDILSELQHYCKFPVKREDVLSAWAGIRPLVRDPRKLSPNSKGDDSTQGLVRSH 467
           ATEADI+DIL ELQHY  FPVKREDVLSAWAGIRPLV+DPRK      G  STQ LVRSH
Sbjct: 388 ATEADIQDILKELQHYINFPVKREDVLSAWAGIRPLVKDPRKA---DSGSGSTQQLVRSH 444

Query: 468 FIFTSENNLVTIAGGKWTTYRRMAEETIDEAIKVGQLPNKPSVTKDLILSGGENWTPNTA 527
           F+FTS +NLVTI+GGKWTTYR MAEETIDE +KVGQ  +KP VTK L L GGENW PN +
Sbjct: 445 FLFTSPSNLVTISGGKWTTYREMAEETIDEVVKVGQFNSKPCVTKKLKLVGGENWNPNLS 504

Query: 528 ALLSQKYHIPSSLSKYLSENYGTRAPIICELLKKDKKNELPVTLAGKEHNEILGNVDFQA 587
           ALLSQKYH+ S++S++L+ NYGTRAP+ICEL  +D +N+LPV LAG+E+  + G+VD+ +
Sbjct: 505 ALLSQKYHLSSAMSEHLANNYGTRAPLICELFNEDPRNKLPVALAGQENVSVFGHVDYDS 564

Query: 588 LRYPYTVAEVKYCIDNEYSRTALDFLLRRTRFGFLDAKEAMNAVEGTVSIMGDELNWDSE 647
            RYPYT+ E+KY +  EY+R  LDFL+RRTR+ FLDAK+A+NAVEGTV +MGDEL WDS+
Sbjct: 565 FRYPYTIGELKYSLKYEYARNCLDFLMRRTRYAFLDAKQALNAVEGTVKVMGDELGWDSK 624

Query: 648 KRSLEIKKSKEYIKTLGV 665
           KR  EI+++ EYIKT GV
Sbjct: 625 KRQDEIQQATEYIKTFGV 642

>KAFR0D02170 Chr4 complement(435640..437622) [1983 bp, 660 aa] {ON}
           Anc_5.711 YIL155C
          Length = 660

 Score =  849 bits (2193), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 410/646 (63%), Positives = 504/646 (78%), Gaps = 26/646 (4%)

Query: 37  SSLLYSDTKPLKTSLNSEEDLQKIA---NGSYKPPSRSELLSNLEKTKKFDVLXXXXXXX 93
             ++Y+   P   + + +ED + I+     S   P+R++L+S L KT +FDVL       
Sbjct: 24  GGIIYAKKGPRIHAPSYQEDGKLISPLDKRSVNLPTRNDLISKLNKTNQFDVLVIGGGAT 83

Query: 94  XXXXXVDASTRGLNVALMEMNDFXXXXXXXXXXMAHGGVRYLEKAVFQLSKAQLDLVIEA 153
                +DA+TRGLNVAL+E  DF          MAHGGVRYLEKA ++LSKAQLDLVIEA
Sbjct: 84  GAGCALDATTRGLNVALVEKYDFASGTSSKSTKMAHGGVRYLEKAFWELSKAQLDLVIEA 143

Query: 154 LNERKHMLQTAPHLCKILPIMIPVYNYWEVPYFYAGCKMYDFFAGSQNLKSAYLLSKTSA 213
           LNER H+L TAPHLCKILPIMIPVYNYW++PYFYAGCKMYD FAGSQNLKS+YLLSK SA
Sbjct: 144 LNERAHLLNTAPHLCKILPIMIPVYNYWQIPYFYAGCKMYDLFAGSQNLKSSYLLSKRSA 203

Query: 214 GQIAPMLDVPKLKAALVYHDGSFNDARMNVSLAVTAIENGATVLNYMEVEKLIKDPKTGK 273
             +APMLD  KLKA LVYHDG+FND+RMN +LAVTAIENG+TVLNYMEV++L+K+  +GK
Sbjct: 204 ADVAPMLDTTKLKAGLVYHDGTFNDSRMNSTLAVTAIENGSTVLNYMEVKQLLKEKGSGK 263

Query: 274 IQGATVRDRETDKKYDVMAKVVVNSTGPFSDNILQMDRNKSGYPDIFDKANIDTSKLPSI 333
           I+GA V D ET K+Y++ AKVV+N+TGP+SD ILQMD+N +G PD  +  N+ T      
Sbjct: 264 IEGAIVEDLETGKQYNIKAKVVINATGPYSDAILQMDQNPTGLPDPLN-VNLKT------ 316

Query: 334 DHDNLSRIAVDNPKMVVPSAGVHIILPSYYCPKDMGILDVKTADGRVMFFLPWQDKVLAG 393
           ++D  ++++V NPKMVVPSAGVHIILPS+YCPKD+G+LD KT+DGRVMFFLPWQ KVLAG
Sbjct: 317 NNDIATKVSVSNPKMVVPSAGVHIILPSFYCPKDIGLLDAKTSDGRVMFFLPWQGKVLAG 376

Query: 394 TTDIPMKKVPENPVATEADIEDILSELQHYCKFPVKREDVLSAWAGIRPLVRDPRKLSPN 453
           TTD+PMK++PENP ATEADI+DIL ELQHY +FPVKREDVLSAWAGIRPLV+DPR L  N
Sbjct: 377 TTDVPMKQIPENPTATEADIQDILKELQHYIRFPVKREDVLSAWAGIRPLVKDPRTLDKN 436

Query: 454 SKGDDSTQGLVRSHFIFTSENNLVTIAGGKWTTYRRMAEETIDEAIKVGQLPN-KPSVTK 512
             GD STQGLVRSHFIFTS++ LVTIAGGKWTTYR MAEET+DEAIKVG+  N KP +T+
Sbjct: 437 --GDGSTQGLVRSHFIFTSDHGLVTIAGGKWTTYRAMAEETVDEAIKVGKFANVKPCITR 494

Query: 513 DLILSGGENWTPNTAALLSQKYHIPSSLSKYLSENYGTRAPIICELLKKDKKNELPVTLA 572
           D+ L+GGENW PN  ALL+Q+YH+ S LS++L++NYGTRAPIICE+  KD+KN+LP+ LA
Sbjct: 495 DIKLAGGENWNPNLQALLAQRYHLSSKLSQHLADNYGTRAPIICEMYAKDRKNKLPIALA 554

Query: 573 G--KEHNEILGNVD-----------FQALRYPYTVAEVKYCIDNEYSRTALDFLLRRTRF 619
               EH + + N +           F+  RYP+TV EVKY ++ EY+ TALDFL+RR+RF
Sbjct: 555 ANYNEHEDEIENANDLIYNNERGDVFECFRYPFTVGEVKYSVNYEYAITALDFLMRRSRF 614

Query: 620 GFLDAKEAMNAVEGTVSIMGDELNWDSEKRSLEIKKSKEYIKTLGV 665
            FLDAKEA++AVEGTV IMGDELNWD  +R  EI+ + +YIKT GV
Sbjct: 615 AFLDAKEAVHAVEGTVKIMGDELNWDESRRHKEIENTIKYIKTFGV 660

>SAKL0E15114g Chr5 (1256624..1258573) [1950 bp, 649 aa] {ON} highly
           similar to gnl|GLV|KLLA0A00418g Kluyveromyces lactis
           KLLA0A00418g and similar to YIL155C uniprot|P32191
           Saccharomyces cerevisiae YIL155C GUT2 Mitochondrial
           glycerol-3-phosphate dehydrogenase expression is
           repressed by both glucose and cAMP and derepressed by
           non-fermentable carbon sources in a Snf1p Rsf1p
           Hap2/3/4/5 complex dependent manner
          Length = 649

 Score =  848 bits (2191), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 394/635 (62%), Positives = 496/635 (78%), Gaps = 14/635 (2%)

Query: 37  SSLLYSDTKPLKTSLNSEEDLQK-IANGSYKPPSRSELLSNLEKTKKFDVLXXXXXXXXX 95
           +++L+   +  K+ +N++  +   +       P+R +LLS L KT +FDVL         
Sbjct: 23  ATILWHQQQQQKSVINNDVTVTNPVQKSKINLPTRQDLLSKLSKTNQFDVLIIGGGATGT 82

Query: 96  XXXVDASTRGLNVALMEMNDFXXXXXXXXXXMAHGGVRYLEKAVFQLSKAQLDLVIEALN 155
              +DA+TRGLNVAL+EMNDF          MAHGGVRYLEKA ++LSKAQLDLV+EALN
Sbjct: 83  GSALDAATRGLNVALVEMNDFASGTSSKSTKMAHGGVRYLEKAFWELSKAQLDLVVEALN 142

Query: 156 ERKHMLQTAPHLCKILPIMIPVYNYWEVPYFYAGCKMYDFFAGSQNLKSAYLLSKTSAGQ 215
           ER HML TAPHLCKILPIMIPVYNYW+ PYFY GCKMYD FAGSQNLKS+Y+L+ + A +
Sbjct: 143 ERAHMLYTAPHLCKILPIMIPVYNYWQAPYFYVGCKMYDLFAGSQNLKSSYMLTASRAAE 202

Query: 216 IAPMLDVPKLKAALVYHDGSFNDARMNVSLAVTAIENGATVLNYMEVEKLIKDPKTGKIQ 275
           +APMLD  KLKA LVYHDGSFND+RMN +LAVTA+E GATVLNYMEV++LIK+ +TGK++
Sbjct: 203 VAPMLDASKLKAGLVYHDGSFNDSRMNATLAVTAVEKGATVLNYMEVKQLIKNEQTGKVE 262

Query: 276 GATVRDRETDKKYDVMAKVVVNSTGPFSDNILQMDRNKSGYPD--IFDKANIDTSKLPSI 333
           GA  +DRET + + + AKVVVN+TGPFSD ILQMD +  G PD  +   +NI+ +     
Sbjct: 263 GAVAQDRETGETFRIKAKVVVNATGPFSDRILQMDEDSKGLPDDRLLQSSNINATI---- 318

Query: 334 DHDNLSRIAVDNPKMVVPSAGVHIILPSYYCPKDMGILDVKTADGRVMFFLPWQDKVLAG 393
                S++AV NP+MVVPSAGVHI+LPS+YCPK++G+LD KT+DGRVMFFLPWQ KVLAG
Sbjct: 319 ----SSKVAVANPQMVVPSAGVHIVLPSFYCPKEIGLLDAKTSDGRVMFFLPWQGKVLAG 374

Query: 394 TTDIPMKKVPENPVATEADIEDILSELQHYCKFPVKREDVLSAWAGIRPLVRDPRKL--- 450
           TTDIPMK++PENP ATEADI+DIL ELQHY KFPVKREDVLSAWAGIRPLV+DPRK    
Sbjct: 375 TTDIPMKQIPENPTATEADIQDILKELQHYIKFPVKREDVLSAWAGIRPLVKDPRKRIGE 434

Query: 451 SPNSKGDDSTQGLVRSHFIFTSENNLVTIAGGKWTTYRRMAEETIDEAIKVGQLPNKPSV 510
           +P+     STQ LVRSHF+FTS+N+LVTIAGGKWTTYR M+EETI+E +KVG+   KP +
Sbjct: 435 NPHRVAASSTQELVRSHFLFTSDNDLVTIAGGKWTTYREMSEETINEVVKVGKFNAKPCI 494

Query: 511 TKDLILSGGENWTPNTAALLSQKYHIPSSLSKYLSENYGTRAPIICELLKKDKKNELPVT 570
           T+ L L+G EN+ PN  A+L+Q+YH+ S +++YL+ NYGTRAP+ICEL K D KN+LP+ 
Sbjct: 495 TRKLKLAGAENYDPNLPAMLAQEYHLSSKMAEYLANNYGTRAPLICELFKDDDKNKLPMA 554

Query: 571 LAGKEHNEILGNVDFQALRYPYTVAEVKYCIDNEYSRTALDFLLRRTRFGFLDAKEAMNA 630
             GKE+  + GNVDF + RYP+T+ E+KY I+NEY+RTALDFL+RRTR+ FLDAK+A+ A
Sbjct: 555 FGGKENVTVYGNVDFDSFRYPFTIGELKYSINNEYTRTALDFLMRRTRYAFLDAKQALTA 614

Query: 631 VEGTVSIMGDELNWDSEKRSLEIKKSKEYIKTLGV 665
           V+GTV +MGDEL+WDS +R  E +K+ E+IKT GV
Sbjct: 615 VDGTVKVMGDELSWDSNRRQEEREKATEFIKTFGV 649

>Kwal_55.19649 s55 complement(65706..67631) [1926 bp, 641 aa] {ON}
           YIL155C (GUT2) - glycerol-3-phosphate dehydrogenase,
           mitochondrial [contig 159] FULL
          Length = 641

 Score =  845 bits (2183), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 389/601 (64%), Positives = 481/601 (80%), Gaps = 12/601 (1%)

Query: 68  PSRSELLSNLEKTKKFDVLXXXXXXXXXXXXVDASTRGLNVALMEMNDFXXXXXXXXXXM 127
           P+RSELL  + KT++FDVL            VDA+TRGLNVAL+EMNDF          M
Sbjct: 50  PTRSELLEKMAKTEQFDVLIIGGGATGTGCAVDAATRGLNVALVEMNDFASGTSSKSTKM 109

Query: 128 AHGGVRYLEKAVFQLSKAQLDLVIEALNERKHMLQTAPHLCKILPIMIPVYNYWEVPYFY 187
           AHGGVRYLEKA ++LSKAQLDLVIEALNER HML TAPHLCK+LPIMIPVYNYW+VPYFY
Sbjct: 110 AHGGVRYLEKAFWELSKAQLDLVIEALNERGHMLNTAPHLCKVLPIMIPVYNYWQVPYFY 169

Query: 188 AGCKMYDFFAGSQNLKSAYLLSKTSAGQIAPMLDVPKLKAALVYHDGSFNDARMNVSLAV 247
            GCKMYD FAGSQNLKS+Y++S   A ++APMLD   LKA LVYHDGSFND+RMN +LAV
Sbjct: 170 VGCKMYDLFAGSQNLKSSYMMSAKRASEVAPMLDASILKAGLVYHDGSFNDSRMNAALAV 229

Query: 248 TAIENGATVLNYMEVEKLIKDPKTGKIQGATVRDRETDKKYDVMAKVVVNSTGPFSDNIL 307
           TAIE GATVLNYMEV +L+K+ ++G+I+GA VRDRET +++ + AKVVVNSTGPFSD +L
Sbjct: 230 TAIERGATVLNYMEVTQLVKNDQSGRIEGAMVRDRETGEEFRIKAKVVVNSTGPFSDRLL 289

Query: 308 QMDRNKSGYPDIFDKANIDTSKLPSIDHDNL-SRIAVDNPKMVVPSAGVHIILPSYYCPK 366
           QMD  K G P        D  +  +  HD++ SRIAV NP+MVVPSAGVHI+LP++YCPK
Sbjct: 290 QMDAAKDGKP------RNDLVQFANEGHDSIGSRIAVSNPRMVVPSAGVHIVLPAFYCPK 343

Query: 367 DMGILDVKTADGRVMFFLPWQDKVLAGTTDIPMKKVPENPVATEADIEDILSELQHYCKF 426
           ++G+LD KT+DGRVMFFLPWQ KVLAGTTDIPMK+VPENP ATEADI+DIL ELQHY KF
Sbjct: 344 EIGLLDAKTSDGRVMFFLPWQGKVLAGTTDIPMKQVPENPTATEADIQDILKELQHYIKF 403

Query: 427 PVKREDVLSAWAGIRPLVRDPRKLSPNSKGDD--STQGLVRSHFIFTSENNLVTIAGGKW 484
           PVKR DVLSAWAGIRPL+RDPR +    +GDD  STQGLVR+HF++TS+N LVTIAGGKW
Sbjct: 404 PVKRGDVLSAWAGIRPLIRDPRTI---KEGDDVSSTQGLVRNHFLYTSDNGLVTIAGGKW 460

Query: 485 TTYRRMAEETIDEAIKVGQLPNKPSVTKDLILSGGENWTPNTAALLSQKYHIPSSLSKYL 544
           TTYR MAEETIDE +K G+   KP +TK + L+G E W PN  A+L+Q+YH+ S ++++L
Sbjct: 461 TTYREMAEETIDEVVKQGKFQAKPCITKKIKLAGAEGWDPNFVAMLAQEYHLSSKMAEHL 520

Query: 545 SENYGTRAPIICELLKKDKKNELPVTLAGKEHNEILGNVDFQALRYPYTVAEVKYCIDNE 604
           + NYGTR+PIICE+ K+D+KN+LPVT  G+E+  +  NV+F + RYP+T+ E+KY +  E
Sbjct: 521 ANNYGTRSPIICEMFKRDEKNQLPVTFGGRENVTVYKNVNFDSFRYPFTIGELKYSMQYE 580

Query: 605 YSRTALDFLLRRTRFGFLDAKEAMNAVEGTVSIMGDELNWDSEKRSLEIKKSKEYIKTLG 664
           Y+RTALDFL+RRTRFGFLDA++A+ AV+GTVS+MGDEL W  ++R  E +++ E+IKT G
Sbjct: 581 YTRTALDFLMRRTRFGFLDARQALGAVDGTVSVMGDELGWSDDRRQAERQQASEFIKTFG 640

Query: 665 V 665
           +
Sbjct: 641 L 641

>CAGL0H06699g Chr8 (665295..667247) [1953 bp, 650 aa] {ON} similar
           to uniprot|P32191 Saccharomyces cerevisiae YIL155c GUT2
          Length = 650

 Score =  845 bits (2183), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 417/670 (62%), Positives = 498/670 (74%), Gaps = 25/670 (3%)

Query: 1   MYSRLSRVSRPLKTTLAILTVASGSLLTYNHFYLNQSSLLYSDTKPLKTSLNSEEDLQKI 60
           M++R++  +R     LA  TVA+G+ L   + Y N + L+ +D      SL     +  +
Sbjct: 1   MFARVAASTRAHSRLLAG-TVAAGATLAVANHYNNNNKLISNDV-----SL-----ISPV 49

Query: 61  ANGSYKPPSRSELLSNLEKTKKFDVLXXXXXXXXXXXXVDASTRGLNVALMEMNDFXXXX 120
                K P+R ELL  L +T +FDVL            +DA+TRGLNVAL+E NDF    
Sbjct: 50  EKPDVKLPTRDELLDKLSRTNQFDVLIIGGGATGTGCALDAATRGLNVALVEKNDFASGT 109

Query: 121 XXXXXXMAHGGVRYLEKAVFQLSKAQLDLVIEALNERKHMLQTAPHLCKILPIMIPVYNY 180
                 MAHGGVRYLEKA +++SKAQLDLVIEALNER H+L TAPHLCK+LPI+IPVYNY
Sbjct: 110 SSKSTKMAHGGVRYLEKAFWEMSKAQLDLVIEALNERAHLLNTAPHLCKLLPIIIPVYNY 169

Query: 181 WEVPYFYAGCKMYDFFAGSQNLKSAYLLSKTSAGQIAPMLDVPKLKAALVYHDGSFNDAR 240
           W+VPYFYAGCKMYD FAGSQNLK +YL+SK +  ++APMLD   LKA LVYHDGSFND R
Sbjct: 170 WQVPYFYAGCKMYDLFAGSQNLKGSYLMSKNATMEVAPMLDGSNLKAGLVYHDGSFNDTR 229

Query: 241 MNVSLAVTAIENGATVLNYMEVEKLIKDPKTGKIQGATVRDRETDKKYDVMAKVVVNSTG 300
           MN +LAVTAIEN ATVLNYMEV++L+KD K GK+ GA V DRET K Y V AKVVVN+TG
Sbjct: 230 MNATLAVTAIENSATVLNYMEVKQLVKD-KDGKVAGAVVEDRETGKTYSVRAKVVVNATG 288

Query: 301 PFSDNILQMDRNKSGYPDIFDKANIDTSKLPSIDHDN-----LSRIAVDNPKMVVPSAGV 355
           P+SD +LQMD N  G PD      +     P ID +      +S++AV  P MVVPSAGV
Sbjct: 289 PYSDRLLQMDANPDGLPD-----EVVQKTEPIIDGNATVKSIMSQVAVTKPNMVVPSAGV 343

Query: 356 HIILPSYYCPKDMGILDVKTADGRVMFFLPWQDKVLAGTTDIPMKKVPENPVATEADIED 415
           HIILPS+YCPK+MG+LD KT+DGRVMFFLPWQ KVLAGTTDIP+K+VPENP ATEADI+D
Sbjct: 344 HIILPSFYCPKEMGLLDAKTSDGRVMFFLPWQGKVLAGTTDIPLKQVPENPTATEADIQD 403

Query: 416 ILSELQHYCKFPVKREDVLSAWAGIRPLVRDPRKLSPNSKGDDSTQGLVRSHFIFTSENN 475
           IL ELQ Y KFPVKREDVLSAWAGIRPLV DPRK    SK D STQGLVRSHFIFTS++ 
Sbjct: 404 ILKELQPYIKFPVKREDVLSAWAGIRPLVTDPRK---KSKADGSTQGLVRSHFIFTSDHG 460

Query: 476 LVTIAGGKWTTYRRMAEETIDEAIKVGQLPNKPSVTKDLILSGGENWTPNTAALLSQKYH 535
           LVTIAGGKWTTYR MAEETIDE +K G+   KP +T+ L L+G ENW PN  ALL+QKYH
Sbjct: 461 LVTIAGGKWTTYRAMAEETIDEVVKNGKFDAKPCITRKLKLAGAENWDPNLPALLAQKYH 520

Query: 536 IPSSLSKYLSENYGTRAPIICELLKKDKKNELPVTLAGKEHNEILGNVDFQALRYPYTVA 595
           +   +S YL+ENYGTRAP+ICE+  +D +N LP+ LA KE   +LG+VDF + RYP T+A
Sbjct: 521 LSQKMSHYLAENYGTRAPLICEMFHEDPENRLPLLLADKEQTPVLGHVDFDSFRYPITIA 580

Query: 596 EVKYCIDNEYSRTALDFLLRRTRFGFLDAKEAMNAVEGTVSIMGDELNWDSEKRSLEIKK 655
           E+KY I  EY+RTALDFL+RRTRF FLDAK+A+NAVEGTV +MGD L WD ++R  EI+ 
Sbjct: 581 ELKYAIKYEYARTALDFLMRRTRFAFLDAKQALNAVEGTVRLMGDSLGWDEQRRQDEIRY 640

Query: 656 SKEYIKTLGV 665
           S E+IKT GV
Sbjct: 641 STEFIKTFGV 650

>TPHA0E00150 Chr5 complement(11922..13862) [1941 bp, 646 aa] {ON}
           Anc_5.711 YIL155C
          Length = 646

 Score =  842 bits (2174), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/598 (66%), Positives = 475/598 (79%), Gaps = 13/598 (2%)

Query: 68  PSRSELLSNLEKTKKFDVLXXXXXXXXXXXXVDASTRGLNVALMEMNDFXXXXXXXXXXM 127
           P+RSEL++NL+ T +FDVL            +DA+TRGLNVAL+E +DF          M
Sbjct: 62  PTRSELVNNLKTTDQFDVLIIGGGATGSGSALDAATRGLNVALVEKDDFASGTSSKSTKM 121

Query: 128 AHGGVRYLEKAVFQLSKAQLDLVIEALNERKHMLQTAPHLCKILPIMIPVYNYWEVPYFY 187
           AHGGVRYLEKAVFQLSKAQLDLVIEALNER H+L TAPHLCKILPIMIPVY YW+VPYFY
Sbjct: 122 AHGGVRYLEKAVFQLSKAQLDLVIEALNERAHLLYTAPHLCKILPIMIPVYKYWQVPYFY 181

Query: 188 AGCKMYDFFAGSQNLKSAYLLSKTSAGQIAPMLDVPKLKAALVYHDGSFNDARMNVSLAV 247
           AG KMYD FAGSQNLKS+YL+SK +A +IAPMLD  KLKA LVYHDG+FND+RMN +LA+
Sbjct: 182 AGVKMYDIFAGSQNLKSSYLVSKANACEIAPMLDESKLKAGLVYHDGTFNDSRMNSTLAI 241

Query: 248 TAIENGATVLNYMEVEKLIKDPKTGKIQGATVRDRETDKKYDVMAKVVVNSTGPFSDNIL 307
           TAIENGATVLNYMEV++L+KDP + ++ GA V D ET +K  + AKV+VN+TGP+SD IL
Sbjct: 242 TAIENGATVLNYMEVKQLLKDPSSDQLTGAIVEDIETGEKIQINAKVIVNATGPYSDKIL 301

Query: 308 QMDRNKSGYPDIFDKANIDTSKLPSIDHDNLSRIAVDNPKMVVPSAGVHIILPSYYCPKD 367
           QMD NK+G PD F +         S +    +++AV NP MVVPSAGVHIILPS+YCP++
Sbjct: 302 QMDNNKNGKPDEFTQ---------SAETSIATKVAVQNPHMVVPSAGVHIILPSFYCPRE 352

Query: 368 MGILDVKTADGRVMFFLPWQDKVLAGTTDIPMKKVPENPVATEADIEDILSELQHYCKFP 427
           MG+LD  T+DGRVMFFLPWQ KVLAGTTDIPMK VPENP ATEADI+DIL ELQHY KFP
Sbjct: 353 MGLLDANTSDGRVMFFLPWQGKVLAGTTDIPMKTVPENPTATEADIQDILKELQHYIKFP 412

Query: 428 VKREDVLSAWAGIRPLVRDPRKLSPNSKGDDSTQGLVRSHFIFTSENNLVTIAGGKWTTY 487
           VKREDVLSAWAGIRPLV+DPRK    +  + +TQ LVRSHFIFTS++ LVTIAGGKWTTY
Sbjct: 413 VKREDVLSAWAGIRPLVQDPRK----TPKEGATQELVRSHFIFTSDHGLVTIAGGKWTTY 468

Query: 488 RRMAEETIDEAIKVGQLPNKPSVTKDLILSGGENWTPNTAALLSQKYHIPSSLSKYLSEN 547
           R MAEETID  +K G+   KP  T+ L L+GGEN+ PN AALL+QKYH+PS LS++L+ N
Sbjct: 469 REMAEETIDTVVKNGKFNVKPCSTRKLKLAGGENYDPNLAALLAQKYHLPSKLSEHLANN 528

Query: 548 YGTRAPIICELLKKDKKNELPVTLAGKEHNEILGNVDFQALRYPYTVAEVKYCIDNEYSR 607
           YGTR+P+IC++   D  N LP+ LAGKE N++ G VDF + RYPY++AEVKYC+ +EY+R
Sbjct: 529 YGTRSPLICDMFVADDHNRLPIYLAGKEENKVYGTVDFDSFRYPYSIAEVKYCVHHEYAR 588

Query: 608 TALDFLLRRTRFGFLDAKEAMNAVEGTVSIMGDELNWDSEKRSLEIKKSKEYIKTLGV 665
           T LDFL+RR+RF FLDAK+A+ +VEGTV IMGDELNWD E+R  E   S EYIKT GV
Sbjct: 589 TTLDFLMRRSRFAFLDAKQALKSVEGTVKIMGDELNWDEERRKQETDYSIEYIKTFGV 646

>NCAS0G00180 Chr7 complement(25495..27459) [1965 bp, 654 aa] {ON}
           Anc_5.711 YIL155C
          Length = 654

 Score =  836 bits (2160), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 400/602 (66%), Positives = 476/602 (79%), Gaps = 11/602 (1%)

Query: 68  PSRSELLSNLEKTKKFDVLXXXXXXXXXXXXVDASTRGLNVALMEMNDFXXXXXXXXXXM 127
           P+RS+LL  L++  +FDVL            VDA+TRGL VAL+E NDF          M
Sbjct: 60  PTRSKLLQQLKEKGQFDVLIIGGGATGTGCAVDAATRGLQVALVEQNDFASGTSSKSTKM 119

Query: 128 AHGGVRYLEKAVFQLSKAQLDLVIEALNERKHMLQTAPHLCKILPIMIPVYNYWEVPYFY 187
           AHGGVRYLEKA FQLSK+QLDLVIEALNER H+L TAPHLCKILPI+IPVY YW+VPYFY
Sbjct: 120 AHGGVRYLEKAFFQLSKSQLDLVIEALNERAHLLNTAPHLCKILPILIPVYTYWQVPYFY 179

Query: 188 AGCKMYDFFAGSQNLKSAYLLSKTSAGQIAPMLDVPKLKAALVYHDGSFNDARMNVSLAV 247
           AGCK+YD FAG+QNLK++YLLS+++A ++APML+   LKAALVYHDGSFND+R+N +LA+
Sbjct: 180 AGCKLYDLFAGNQNLKNSYLLSRSNAIELAPMLEATNLKAALVYHDGSFNDSRLNATLAI 239

Query: 248 TAIENGATVLNYMEVEKLIKDPKTGKIQGATVRDRETDKKYDVMAKVVVNSTGPFSDNIL 307
           TAIE GATVLNY+EV+KL+KD +TG I G TVRD ET    DV++KVVVN+TGPFSD IL
Sbjct: 240 TAIERGATVLNYVEVQKLLKDSETGTINGVTVRDIETGDTMDVLSKVVVNATGPFSDKIL 299

Query: 308 QMDRNKSGYPDIFDKANIDTSKLPSI--DHDNLSRIAVDNPKMVVPSAGVHIILPSYYCP 365
           QMD+N +G PD       D +  P +    D  S+IAV NP MVVPS+GVHIILPSYYCP
Sbjct: 300 QMDKNPTGLPD-------DMNLNPKMINPEDISSKIAVKNPNMVVPSSGVHIILPSYYCP 352

Query: 366 KDMGILDVKTADGRVMFFLPWQDKVLAGTTDIPMKKVPENPVATEADIEDILSELQHYCK 425
           K MG+LDV+T+DGRVMFFLPWQ KV+AGTTDIPM +VPE PVA EADI+DIL ELQHY K
Sbjct: 353 KQMGLLDVRTSDGRVMFFLPWQGKVIAGTTDIPMNQVPETPVAKEADIQDILKELQHYIK 412

Query: 426 FPVKREDVLSAWAGIRPLVRDPRKLSPNSKGD-DSTQGLVRSHFIFTSENNLVTIAGGKW 484
           FPVKREDVLSAWAGIRPLVRDPR +SP+ K    STQGLVRSHFIFTS+N LVTIAGGKW
Sbjct: 413 FPVKREDVLSAWAGIRPLVRDPRLVSPDEKKVLGSTQGLVRSHFIFTSDNGLVTIAGGKW 472

Query: 485 TTYRRMAEETIDEAIKVGQLPN-KPSVTKDLILSGGENWTPNTAALLSQKYHIPSSLSKY 543
           TTYR MAEETIDE +K G   + KP +T++L L+G E W PN +ALLSQKY++PS ++ Y
Sbjct: 473 TTYREMAEETIDEVVKNGAFVDAKPCITRELKLAGAEFWDPNISALLSQKYNLPSMMANY 532

Query: 544 LSENYGTRAPIICELLKKDKKNELPVTLAGKEHNEILGNVDFQALRYPYTVAEVKYCIDN 603
           LS+NYGTR+PIICEL   D+ N+LPV LAG+E  +ILGN DF   RYP T+ E+KY +  
Sbjct: 533 LSDNYGTRSPIICELFLNDEINKLPVLLAGEEKEQILGNTDFNTFRYPITIGELKYSMRY 592

Query: 604 EYSRTALDFLLRRTRFGFLDAKEAMNAVEGTVSIMGDELNWDSEKRSLEIKKSKEYIKTL 663
           EY+RTALDFL+RRTRF FLDAKEA+ AV GTV IMGDE NW SE+R  E +K+ ++IK+ 
Sbjct: 593 EYARTALDFLMRRTRFAFLDAKEALRAVSGTVKIMGDEFNWSSERRQEEKEKTIQFIKSF 652

Query: 664 GV 665
           GV
Sbjct: 653 GV 654

>Ecym_4010 Chr4 complement(24630..26564) [1935 bp, 644 aa] {ON}
           similar to Ashbya gossypii AFR295W
          Length = 644

 Score =  827 bits (2137), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 407/649 (62%), Positives = 493/649 (75%), Gaps = 26/649 (4%)

Query: 20  TVASGSLLTYNHFYLNQSSLLYSDTKPLKTSLNSEEDLQKIANGSYKPPSRSELLSNLEK 79
           TV   S++++  F   Q ++  S+T  +   L +E  L+K A     PPSR++LL  L+K
Sbjct: 19  TVTGASVVSW-QFVSQQHAI--SNTGFVANELPAELKLEKHAPA---PPSRAQLLEKLQK 72

Query: 80  TKKFDVLXXXXXXXXXXXXVDASTRGLNVALMEMNDFXXXXXXXXXXMAHGGVRYLEKAV 139
           T +FDVL            +DA+TRGLNVAL+EMND+          MAHGGVRYLEKA 
Sbjct: 73  TDQFDVLVIGGGASGTGSALDAATRGLNVALLEMNDYASGTSSKSTKMAHGGVRYLEKAF 132

Query: 140 FQLSKAQLDLVIEALNERKHMLQTAPHLCKILPIMIPVYNYWEVPYFYAGCKMYDFFAGS 199
           ++LSKAQLDLVIEALNER HML TAPHLCKILPIMIPVY +W+VPYFY G KMYDFFAG 
Sbjct: 133 WELSKAQLDLVIEALNERAHMLHTAPHLCKILPIMIPVYKWWQVPYFYVGTKMYDFFAGK 192

Query: 200 QNLKSAYLLSKTSAGQIAPMLDVPKLKAALVYHDGSFNDARMNVSLAVTAIENGATVLNY 259
           QNLKS+YLLS T A Q+APMLD  KLKA LVYHDGSFND+RMN +LAVTAIENGAT+LNY
Sbjct: 193 QNLKSSYLLSATGASQVAPMLDASKLKAGLVYHDGSFNDSRMNSTLAVTAIENGATLLNY 252

Query: 260 MEVEKLIKDPKTGKIQGATVRDRETDKKYDVMAKVVVNSTGPFSDNILQMDRNKSGYPD- 318
           MEV++L+K+P+TGK++GA   DRET K+Y V AKVVV++TGPFSD ILQM+ +  G PD 
Sbjct: 253 MEVKQLLKNPETGKVEGAIAVDRETGKQYSVKAKVVVSATGPFSDRILQMENHPKGLPDD 312

Query: 319 -IFDKANIDTSKLPSIDHDNLSRIAVDNPKMVVPSAGVHIILPSYYCPKDMGILDVKTAD 377
               KAN   +          +++AV +PKMVVPS+GVHIILPS+YCPKDMG+LD +T+D
Sbjct: 313 LSLSKANEGATI--------TTKVAVADPKMVVPSSGVHIILPSFYCPKDMGLLDAETSD 364

Query: 378 GRVMFFLPWQDKVLAGTTDIPMKKVPENPVATEADIEDILSELQHYCKFPVKREDVLSAW 437
           GRVMFFLPWQ KVLAGTTDIPMK+VPENP ATEADI+DIL ELQHY KFPVKREDV SAW
Sbjct: 365 GRVMFFLPWQGKVLAGTTDIPMKQVPENPTATEADIQDILKELQHYIKFPVKREDVQSAW 424

Query: 438 AGIRPLVRDPRKLSPNSKGDDSTQGLVRSHFIFTSENNLVTIAGGKWTTYRRMAEETIDE 497
           AGIRPLV+DPR      K +  TQ LVRSHF+FTS++ LVTI+GGKWTTYR MA+ETIDE
Sbjct: 425 AGIRPLVKDPR------KDNSDTQDLVRSHFLFTSDSGLVTISGGKWTTYREMAQETIDE 478

Query: 498 AIKVGQLPN-KPSVTKDLILSGGENWTPNTAALLSQKYHIPSSLSKYLSENYGTRAPIIC 556
            +KVG   N KP +T+ + L G ENW PN  A+LSQ+Y++P  LS+YLSENYGT+A  IC
Sbjct: 479 VVKVGNFVNAKPCITRKIKLVGSENWDPNLPAILSQQYNLPPVLSEYLSENYGTKAAAIC 538

Query: 557 ELLKKDKKNELPVTLAGKEHNEILGNVDFQALRYPYTVAEVKYCIDNEYSRTALDFLLRR 616
           E+ + DK+N+LPV+LA +   +   NVD+ A RYP+TV E+KY I NEY+R  LDFL+RR
Sbjct: 539 EIFQSDKRNQLPVSLAAE---KAAANVDYDAFRYPFTVGELKYNIRNEYARKPLDFLMRR 595

Query: 617 TRFGFLDAKEAMNAVEGTVSIMGDELNWDSEKRSLEIKKSKEYIKTLGV 665
           TR+ FLDAK+A+ AV GTV IMGDEL WDS KR +E K + E+IKT GV
Sbjct: 596 TRYAFLDAKQAVAAVPGTVKIMGDELGWDSAKREMETKYAIEFIKTFGV 644

>ZYRO0B16522g Chr2 (1340223..1342154) [1932 bp, 643 aa] {ON} highly
           similar to gnl|GLV|KLLA0A00418g Kluyveromyces lactis
           KLLA0A00418g and similar to YIL155C uniprot|P32191
           Saccharomyces cerevisiae YIL155C GUT2 Mitochondrial
           glycerol-3-phosphate dehydrogenase expression is
           repressed by both glucose and cAMP and derepressed by
           non-fermentable carbon sources in a Snf1p Rsf1p
           Hap2/3/4/5 complex dependent manner
          Length = 643

 Score =  827 bits (2136), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/663 (60%), Positives = 492/663 (74%), Gaps = 23/663 (3%)

Query: 5   LSRVSRPLKTTLAILTVASGSLLTYNHFYLNQSSLLYSDTKPLKTSLNSEEDLQKIANGS 64
            +R  +     LA+     G+L  + +    + S   S+  P+ + ++           S
Sbjct: 2   FARGGKLFPKALALTGTVGGALAVHQYMDSRRQSSALSNEVPVVSPIDPRP--------S 53

Query: 65  YKPPSRSELLSNLEKTKKFDVLXXXXXXXXXXXXVDASTRGLNVALMEMNDFXXXXXXXX 124
              PSR +LLSNL+KT KFDVL            +DA+TRGLNVA +E NDF        
Sbjct: 54  VNLPSREDLLSNLQKTDKFDVLIIGGGASGAGSALDAATRGLNVACVEANDFASGTSSKS 113

Query: 125 XXMAHGGVRYLEKAVFQLSKAQLDLVIEALNERKHMLQTAPHLCKILPIMIPVYNYWEVP 184
             MAHGGVRYLEKAVF+LS+AQLDLVIEALNER HML+TAPHLCKILPIMIPVY+YW+VP
Sbjct: 114 TKMAHGGVRYLEKAVFELSRAQLDLVIEALNERGHMLETAPHLCKILPIMIPVYSYWQVP 173

Query: 185 YFYAGCKMYDFFAGSQNLKSAYLLSKTSAGQIAPMLDVPKLKAALVYHDGSFNDARMNVS 244
           YF+AGCK+YD+FAG QNL+S+YLLSKT A ++APMLD  KLKA LVYHDGSFND+RMN +
Sbjct: 174 YFFAGCKLYDWFAGKQNLRSSYLLSKTYASELAPMLDESKLKAGLVYHDGSFNDSRMNST 233

Query: 245 LAVTAIENGATVLNYMEVEKLIKDPKTGKIQGATVRDRETDKKYDVMAKVVVNSTGPFSD 304
           LA++AIE+GATVLNY++V +L+KD  T K++GA V D+ET K+Y V AKV VN+TGP+SD
Sbjct: 234 LAISAIEHGATVLNYVKVTQLLKDSSTNKVEGAIVEDQETGKQYQVKAKVTVNATGPYSD 293

Query: 305 NILQMDRNKSGYPDIF--DKANIDTSKLPSIDHDNLSRIAVDNPKMVVPSAGVHIILPSY 362
            ILQMD+NK+G PD      AN+  +          + +AV+ P MVVPSAGVHIILPSY
Sbjct: 294 LILQMDKNKNGLPDPQPPQPANVSIA----------TEVAVNKPNMVVPSAGVHIILPSY 343

Query: 363 YCPKDMGILDVKTADGRVMFFLPWQDKVLAGTTDIPMKKVPENPVATEADIEDILSELQH 422
           YCPK +G+LDVKTADGRVMFFLPWQ KVLAGTTDIPMK VP+NP ATEADI+DIL ELQH
Sbjct: 344 YCPKTVGLLDVKTADGRVMFFLPWQGKVLAGTTDIPMKTVPQNPTATEADIQDILRELQH 403

Query: 423 YCKFPVKREDVLSAWAGIRPLVRDPRKLSPNSKGDDSTQGLVRSHFIFTSENNLVTIAGG 482
           Y KFPV+REDVLSAWAGIRPLV DPRK         ST+GLVR+H IFTSE  L+T+AGG
Sbjct: 404 YIKFPVRREDVLSAWAGIRPLVMDPRK---RKDTGGSTEGLVRNHLIFTSETGLITLAGG 460

Query: 483 KWTTYRRMAEETIDEAIKVGQLPNKPSVTKDLILSGGENWTPNTAALLSQKYHIPSSLSK 542
           KWTTYR MAE+TIDE +K G    KP +T+ + L+GGENWTPN +ALL+Q Y +  ++S+
Sbjct: 461 KWTTYREMAEQTIDEVVKEGGFSVKPCITRKIKLAGGENWTPNLSALLAQHYKLSQAMSQ 520

Query: 543 YLSENYGTRAPIICELLKKDKKNELPVTLAGKEHNEILGNVDFQALRYPYTVAEVKYCID 602
           +LS NYGTRAPIICEL K+D++N+LPV   G+E+  +L +V+F + RYP+T+ E  Y I 
Sbjct: 521 HLSNNYGTRAPIICELFKEDERNQLPVAFGGRENVTVLHHVNFDSFRYPFTIGEFLYSIR 580

Query: 603 NEYSRTALDFLLRRTRFGFLDAKEAMNAVEGTVSIMGDELNWDSEKRSLEIKKSKEYIKT 662
           +EYSR A DFL+RRTR+ FLDA  A+ AVEGTV +MGDELNWDS +R  EI++  E+IKT
Sbjct: 581 HEYSRKATDFLMRRTRYAFLDAANALTAVEGTVKVMGDELNWDSARRQREIEECTEFIKT 640

Query: 663 LGV 665
            GV
Sbjct: 641 FGV 643

>AFR295W Chr6 (970178..972073) [1896 bp, 631 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL155C (GUT2)
          Length = 631

 Score =  816 bits (2109), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 392/602 (65%), Positives = 469/602 (77%), Gaps = 21/602 (3%)

Query: 67  PPSRSELLSNLEKTKKFDVLXXXXXXXXXXXXVDASTRGLNVALMEMNDFXXXXXXXXXX 126
           PPSRSELL  L+KT +FDVL            +DASTRGLNVAL+EMNDF          
Sbjct: 48  PPSRSELLEKLQKTNQFDVLVIGGGASGAGSALDASTRGLNVALLEMNDFASGTSSKSTK 107

Query: 127 MAHGGVRYLEKAVFQLSKAQLDLVIEALNERKHMLQTAPHLCKILPIMIPVYNYWEVPYF 186
           MAHGGVRYLEKAV++LSKAQLDLVIEALNER H+L TAPHLCK+LPIMIPVY +W+VPYF
Sbjct: 108 MAHGGVRYLEKAVWELSKAQLDLVIEALNERAHLLYTAPHLCKVLPIMIPVYKWWQVPYF 167

Query: 187 YAGCKMYDFFAGSQNLKSAYLLSKTSAGQIAPMLDVPKLKAALVYHDGSFNDARMNVSLA 246
           Y G KMYDFFAGSQNLKS+YLLS ++AG++APMLD  KLKA LVYHDGSFND+RMN ++A
Sbjct: 168 YVGTKMYDFFAGSQNLKSSYLLSASAAGEVAPMLDASKLKAGLVYHDGSFNDSRMNATIA 227

Query: 247 VTAIENGATVLNYMEVEKLIKDPKTGKIQGATVRDRETDKKYDVMAKVVVNSTGPFSDNI 306
           VTAIENGATVLNYMEV++LIK+P+ GK++GA   DRET K+Y V AKVVVN+TGPFSD +
Sbjct: 228 VTAIENGATVLNYMEVKRLIKNPEDGKVEGAVAMDRETGKEYAVRAKVVVNATGPFSDRL 287

Query: 307 LQMDRNKSGYPD--IFDKANIDTSKLPSIDHDNLSRIAVDNPKMVVPSAGVHIILPSYYC 364
           LQMD +  G PD  I D  N D++          + +AV NPKMVVPS+GVHIILPSYYC
Sbjct: 288 LQMDNHPEGLPDDKILDAINKDSTI--------ATEVAVANPKMVVPSSGVHIILPSYYC 339

Query: 365 PKDMGILDVKTADGRVMFFLPWQDKVLAGTTDIPMKKVPENPVATEADIEDILSELQHYC 424
           PK+MG+LD +T+DGRVMFFLPWQ KVLAGTTDIPMK+VP NP ATEADI+DIL ELQHY 
Sbjct: 340 PKNMGLLDAETSDGRVMFFLPWQGKVLAGTTDIPMKQVPANPTATEADIQDILKELQHYI 399

Query: 425 KFPVKREDVLSAWAGIRPLVRDPRKLSPNSKGDDSTQGLVRSHFIFTSENNLVTIAGGKW 484
           KFPVKREDV SAWAGIRPLV+DPR      K    TQGLVRSH +FTS+N +VTI+GGKW
Sbjct: 400 KFPVKREDVQSAWAGIRPLVKDPR------KNLSDTQGLVRSHLVFTSKNGMVTISGGKW 453

Query: 485 TTYRRMAEETIDEAIKVGQLPN-KPSVTKDLILSGGENWTPNTAALLSQKYHIPSSLSKY 543
           TTYR MAEET++E +KVG+  N KP +T+ L LSG E+W  N  ALLS +Y+IP  L+++
Sbjct: 454 TTYREMAEETVNEVVKVGKFVNAKPCITRKLKLSGAEHWDANLPALLSHQYNIPPLLAEH 513

Query: 544 LSENYGTRAPIICELLKKDKKNELPVTLAGKEHNEILGNVDFQALRYPYTVAEVKYCIDN 603
           LS+NYGT+A  +CEL + D+ N LPV+LA  +   I    D+ A RYPYT+ E+K+ + +
Sbjct: 514 LSQNYGTKAAQVCELFEDDRANMLPVSLAADKPTSI----DYNAFRYPYTIGELKFTMTH 569

Query: 604 EYSRTALDFLLRRTRFGFLDAKEAMNAVEGTVSIMGDELNWDSEKRSLEIKKSKEYIKTL 663
           EY+RT LDFL+RRTR+ FLDAK+A+ AV+GTV +MGD L WDS KR  E K + EYIKT 
Sbjct: 570 EYARTPLDFLMRRTRYAFLDAKQALKAVDGTVKVMGDALGWDSAKRVAETKYAIEYIKTF 629

Query: 664 GV 665
           GV
Sbjct: 630 GV 631

>Kpol_1043.77 s1043 (168788..170761) [1974 bp, 657 aa] {ON}
           (168788..170761) [1974 nt, 658 aa]
          Length = 657

 Score =  816 bits (2109), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 417/669 (62%), Positives = 510/669 (76%), Gaps = 25/669 (3%)

Query: 3   SRLSRVSRPLKTTLAILTVASGSLLTYNHFYLNQSSLLYSDTKPLKTSLNSEEDLQKIAN 62
           S+L+   + L + LA+ T  + S L  N+   + ++ +Y+D  P K S     D+     
Sbjct: 8   SKLTTSKKLLYSALAVGTGLTASTLLTNN---SSNNAVYND--PSKPSPVDTTDV----- 57

Query: 63  GSYKPPSRSELLSNLEKTKKFDVLXXXXXXXXXXXXVDASTRGLNVALMEMNDFXXXXXX 122
              + PSR++LLS L+KT +FDVL            +DA+TRGLNVAL+E ND+      
Sbjct: 58  ---RLPSRTDLLSKLKKTYQFDVLIIGGGATGTGCAIDAATRGLNVALVEKNDYASGTSS 114

Query: 123 XXXXMAHGGVRYLEKAVFQLSKAQLDLVIEALNERKHMLQTAPHLCKILPIMIPVYNYWE 182
               MAHGGVRYLEKAVFQLSKAQLDLVIEALNER H+L TAPHLCKILPIMIPVY YW+
Sbjct: 115 KSTKMAHGGVRYLEKAVFQLSKAQLDLVIEALNERAHLLYTAPHLCKILPIMIPVYQYWQ 174

Query: 183 VPYFYAGCKMYDFFAGSQNLKSAYLLSKTSAGQIAPMLDVPKLKAALVYHDGSFNDARMN 242
           VPYFY G KMYD FAGSQNLKS+YLLSK+SA +IAPMLD  KLKA LVYHDGSFND+RMN
Sbjct: 175 VPYFYVGTKMYDLFAGSQNLKSSYLLSKSSACEIAPMLDSSKLKAGLVYHDGSFNDSRMN 234

Query: 243 VSLAVTAIENGATVLNYMEVEKLIKDPKTGKIQGATVRDRETDKKYDVMAKVVVNSTGPF 302
            +LA++AIE GATVLNYMEV++L+KD KT K+ GA V D ET + Y + AKV+VN+TGP+
Sbjct: 235 ATLAISAIEKGATVLNYMEVKQLVKDEKTQKLTGAIVEDTETGETYQIKAKVIVNATGPY 294

Query: 303 SDNILQMDRNKSGYPDIFDKANIDTSKLPS----IDHDNLSR-IAVDNPKMVVPSAGVHI 357
           SD ILQMD NK+G PD+F K  I+T  L +    I  +++S+ +AV NP MVVPSAGVHI
Sbjct: 295 SDTILQMDNNKNGLPDMFKK-EIETGNLKTPLNVITPESISKEVAVQNPNMVVPSAGVHI 353

Query: 358 ILPSYYCPKDMGILDVKTADGRVMFFLPWQDKVLAGTTDIPMKKVPENPVATEADIEDIL 417
           ILPSYYCP +MG+LD  TADGRVMFFLPWQ KVLAGTTDIPMK VPENP ATEADI+DIL
Sbjct: 354 ILPSYYCPSEMGLLDANTADGRVMFFLPWQGKVLAGTTDIPMKTVPENPTATEADIQDIL 413

Query: 418 SELQHYCKFPVKREDVLSAWAGIRPLVRDPRKLSPNSKGDDSTQGLVRSHFIFTSENNLV 477
            ELQHY KFPVKREDVLSAWAGIRPLV+DPR      KG  +TQ +VRSHFIFTS+N LV
Sbjct: 414 KELQHYIKFPVKREDVLSAWAGIRPLVQDPRV----QKG-GATQEVVRSHFIFTSDNGLV 468

Query: 478 TIAGGKWTTYRRMAEETIDEAIKVGQLPNKPSVTKDLILSGGENWTPNTAALLSQKYHIP 537
           TIAGGKWTTYR MAEETIDE +K G+   KP +T+ L L+G ENW  N AALLSQKY++ 
Sbjct: 469 TIAGGKWTTYREMAEETIDEVVKQGKFNAKPCITRKLKLAGAENWDANLAALLSQKYNVS 528

Query: 538 SSLSKYLSENYGTRAPIICELLKKDKKNELPVTLAGKEHNEIL-GNVDFQALRYPYTVAE 596
           + ++++L+ NYGTR+PIICE++K+  +N+LPV LAG+E+  I   +V + + RYPYT+AE
Sbjct: 529 TPMAEHLANNYGTRSPIICEMMKESDENKLPVNLAGRENESISNAHVGYDSFRYPYTIAE 588

Query: 597 VKYCIDNEYSRTALDFLLRRTRFGFLDAKEAMNAVEGTVSIMGDELNWDSEKRSLEIKKS 656
           +KY +D EY+RTALDFL+RRTR+ FLDAKEA++AV GTV IMGD LNWD+++R  E   +
Sbjct: 589 LKYSMDYEYTRTALDFLMRRTRYAFLDAKEALDAVNGTVKIMGDHLNWDNDRREREKVYA 648

Query: 657 KEYIKTLGV 665
            +YIKT GV
Sbjct: 649 TDYIKTFGV 657

>NDAI0F00210 Chr6 complement(39658..41619) [1962 bp, 653 aa] {ON}
           Anc_5.711 YIL155C
          Length = 653

 Score =  807 bits (2085), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 388/602 (64%), Positives = 469/602 (77%), Gaps = 9/602 (1%)

Query: 68  PSRSELLSNLE-KTKKFDVLXXXXXXXXXXXXVDASTRGLNVALMEMNDFXXXXXXXXXX 126
           PSRS+L + L  K  +FD+L            +DA+TRGLNVAL+E +DF          
Sbjct: 57  PSRSQLWNQLTTKDHQFDLLIIGGGATGTGCALDAATRGLNVALVERDDFASGTSSKSTK 116

Query: 127 MAHGGVRYLEKAVFQLSKAQLDLVIEALNERKHMLQTAPHLCKILPIMIPVYNYWEVPYF 186
           MAHGGVRYLEKA  Q SK+QLDLVIEALNER H+L TAPHLCKILPI+IPVYNYW++PYF
Sbjct: 117 MAHGGVRYLEKAFLQFSKSQLDLVIEALNERAHLLNTAPHLCKILPILIPVYNYWQLPYF 176

Query: 187 YAGCKMYDFFAGSQNLKSAYLLSKTSAGQIAPMLDVPKLKAALVYHDGSFNDARMNVSLA 246
           YAGCK YDFFAG QNLKS+YL+S+ +A +IAPMLD   LKAALVYHDGSFND+R+N S+A
Sbjct: 177 YAGCKFYDFFAGDQNLKSSYLISRKNAIEIAPMLDAANLKAALVYHDGSFNDSRLNSSIA 236

Query: 247 VTAIENGATVLNYMEVEKLIKDPKTGKIQGATVRDRETDKKYDVMAKVVVNSTGPFSDNI 306
           +TAIENGATVLNY+EV KL+KDP + KI G TV+D+ET +  +V +KV+VN+TGP+SD I
Sbjct: 237 ITAIENGATVLNYVEVRKLLKDPNSNKIIGVTVQDKETGEISNVKSKVIVNATGPYSDTI 296

Query: 307 LQMDRNKSGYPDIFDKANIDTSKLPSIDHDNLSRIAVDNPKMVVPSAGVHIILPSYYCPK 366
           LQMD+N SG PD+   ANID        +D  S+IAV NPKMVVPS+GVHIILPSYYCPK
Sbjct: 297 LQMDKNLSGLPDL---ANIDPKMYDP--NDISSKIAVSNPKMVVPSSGVHIILPSYYCPK 351

Query: 367 DMGILDVKTADGRVMFFLPWQDKVLAGTTDIPMKKVPENPVATEADIEDILSELQHYCKF 426
            MG+LD +T DGRVMFFLPWQ KV+AGTTDIPM +VP+ PVA E DI+DIL ELQHY KF
Sbjct: 352 QMGLLDARTTDGRVMFFLPWQGKVIAGTTDIPMSQVPDTPVAKETDIQDILKELQHYIKF 411

Query: 427 PVKREDVLSAWAGIRPLVRDPRKLSPNSKGD-DSTQGLVRSHFIFTSENNLVTIAGGKWT 485
           PV+REDVLSAWAGIRPLVRDPR +  ++     +TQGLVRSHF+FTS+N L+TIAGGKWT
Sbjct: 412 PVRREDVLSAWAGIRPLVRDPRLIMDDATQKLGTTQGLVRSHFLFTSDNGLITIAGGKWT 471

Query: 486 TYRRMAEETIDEAIKVGQLPN--KPSVTKDLILSGGENWTPNTAALLSQKYHIPSSLSKY 543
           TYR MAEETIDE +K G   N  KP  TKDL L G ENW PN  ALLSQK+++ S ++KY
Sbjct: 472 TYREMAEETIDEVVKYGHFANFAKPCKTKDLKLIGAENWDPNLVALLSQKFNLSSMMAKY 531

Query: 544 LSENYGTRAPIICELLKKDKKNELPVTLAGKEHNEILGNVDFQALRYPYTVAEVKYCIDN 603
           LSENYGTR+ IIC+L ++++ N+LPV LAG E   ILGNVDF   RYP T+AE+KY +  
Sbjct: 532 LSENYGTRSTIICQLFEREEMNKLPVQLAGIEDKPILGNVDFNTFRYPITIAELKYAMKY 591

Query: 604 EYSRTALDFLLRRTRFGFLDAKEAMNAVEGTVSIMGDELNWDSEKRSLEIKKSKEYIKTL 663
           EY+RT LDFL+RRTRF +LDA +A+ AV+GTV +MGDE  WDS++R  EIK +  +I++ 
Sbjct: 592 EYARTPLDFLMRRTRFAYLDAYQALLAVKGTVKVMGDEFGWDSKRREQEIKNATLFIESF 651

Query: 664 GV 665
           GV
Sbjct: 652 GV 653

>YIL155C Chr9 complement(51759..53708) [1950 bp, 649 aa] {ON}
           GUT2Mitochondrial glycerol-3-phosphate dehydrogenase;
           expression is repressed by both glucose and cAMP and
           derepressed by non-fermentable carbon sources in a
           Snf1p, Rsf1p, Hap2/3/4/5 complex dependent manner
          Length = 649

 Score =  787 bits (2033), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/607 (61%), Positives = 464/607 (76%), Gaps = 15/607 (2%)

Query: 67  PP--SRSELLSNLEKTKKFDVLXXXXXXXXXXXXVDASTRGLNVALMEMNDFXXXXXXXX 124
           PP  SR +LL  L KT +FDVL            +DA+TRGLNVAL+E  DF        
Sbjct: 50  PPQVSRRDLLDRLAKTHQFDVLIIGGGATGTGCALDAATRGLNVALVEKGDFASGTSSKS 109

Query: 125 XXMAHGGVRYLEKAVFQLSKAQLDLVIEALNERKHMLQTAPHLCKILPIMIPVYNYWEVP 184
             M HGGVRYLEKA ++ SKAQLDLVIEALNERKH++ TAPHLC +LPI+IP+Y+ W+VP
Sbjct: 110 TKMIHGGVRYLEKAFWEFSKAQLDLVIEALNERKHLINTAPHLCTVLPILIPIYSTWQVP 169

Query: 185 YFYAGCKMYDFFAGSQNLKSAYLLSKTSAGQIAPMLDVPKLKAALVYHDGSFNDARMNVS 244
           Y Y GCK YDFFAGSQNLK +YLLSK++  + APML    LKA+LVYHDGSFND+R+N +
Sbjct: 170 YIYMGCKFYDFFAGSQNLKKSYLLSKSATVEKAPMLTTDNLKASLVYHDGSFNDSRLNAT 229

Query: 245 LAVTAIENGATVLNYMEVEKLIKDPKTGKIQGATVRDRETDKKYDVMAKVVVNSTGPFSD 304
           LA+TA+ENGATVLNY+EV+KLIKDP +GK+ GA  RD ET++   + AK VVN+TGP+SD
Sbjct: 230 LAITAVENGATVLNYVEVQKLIKDPTSGKVIGAEARDVETNELVRINAKCVVNATGPYSD 289

Query: 305 NILQMDRNKSGYPDIFDKANIDTSKLPSIDHDNLSRIAVDNPKMVVPSAGVHIILPSYYC 364
            ILQMDRN SG PD     N D SK+ S      ++IAV +PKMV+PS GVHI+LPS+YC
Sbjct: 290 AILQMDRNPSGLPD--SPLN-DNSKIKS----TFNQIAVMDPKMVIPSIGVHIVLPSFYC 342

Query: 365 PKDMGILDVKTADGRVMFFLPWQDKVLAGTTDIPMKKVPENPVATEADIEDILSELQHYC 424
           PKDMG+LDV+T+DGRVMFFLPWQ KVLAGTTDIP+K+VPENP+ TEADI+DIL ELQHY 
Sbjct: 343 PKDMGLLDVRTSDGRVMFFLPWQGKVLAGTTDIPLKQVPENPMPTEADIQDILKELQHYI 402

Query: 425 KFPVKREDVLSAWAGIRPLVRDPRKLSPNSKGDDSTQGLVRSHFIFTSENNLVTIAGGKW 484
           +FPVKREDVLSAWAG+RPLVRDPR +  + K   +TQG+VRSHF+FTS+N L+TIAGGKW
Sbjct: 403 EFPVKREDVLSAWAGVRPLVRDPRTIPADGKKGSATQGVVRSHFLFTSDNGLITIAGGKW 462

Query: 485 TTYRRMAEETIDEAIKVGQLPN-KPSVTKDLILSGGENWTPNTAALLSQKYHIPSSLSKY 543
           TTYR+MAEET+D+ ++VG   N KP  T+D+ L+G E WT N  ALL+Q YH+ S +S Y
Sbjct: 463 TTYRQMAEETVDKVVEVGGFHNLKPCHTRDIKLAGAEEWTQNYVALLAQNYHLSSKMSNY 522

Query: 544 LSENYGTRAPIICELLKKDKKNELPVTLAGKEHNEILGN-----VDFQALRYPYTVAEVK 598
           L +NYGTR+ IICE  K+  +N+LP++LA KE+N I  +     V+F   RYP+T+ E+K
Sbjct: 523 LVQNYGTRSSIICEFFKESMENKLPLSLADKENNVIYSSEENNLVNFDTFRYPFTIGELK 582

Query: 599 YCIDNEYSRTALDFLLRRTRFGFLDAKEAMNAVEGTVSIMGDELNWDSEKRSLEIKKSKE 658
           Y +  EY RT LDFLLRRTRF FLDAKEA+NAV  TV +MGDE NW  +KR  E++K+  
Sbjct: 583 YSMQYEYCRTPLDFLLRRTRFAFLDAKEALNAVHATVKVMGDEFNWSEKKRQWELEKTVN 642

Query: 659 YIKTLGV 665
           +IKT GV
Sbjct: 643 FIKTFGV 649

>Skud_9.13 Chr9 complement(28747..30696) [1950 bp, 649 aa] {ON}
           YIL155C (REAL)
          Length = 649

 Score =  785 bits (2028), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/607 (60%), Positives = 461/607 (75%), Gaps = 15/607 (2%)

Query: 67  PP--SRSELLSNLEKTKKFDVLXXXXXXXXXXXXVDASTRGLNVALMEMNDFXXXXXXXX 124
           PP  SR +LL  L KT +FDVL            +DA+TRGLNVAL+E  DF        
Sbjct: 50  PPQVSRRDLLDRLAKTHQFDVLIIGGGATGTGCALDAATRGLNVALVEKGDFASGTSSKS 109

Query: 125 XXMAHGGVRYLEKAVFQLSKAQLDLVIEALNERKHMLQTAPHLCKILPIMIPVYNYWEVP 184
             M HGGVRYLEKA ++ SKAQLDLVIEALNERKH++ TAPHLC +LPI+IP+YN W+VP
Sbjct: 110 TKMIHGGVRYLEKAFWEFSKAQLDLVIEALNERKHLINTAPHLCTVLPILIPIYNTWQVP 169

Query: 185 YFYAGCKMYDFFAGSQNLKSAYLLSKTSAGQIAPMLDVPKLKAALVYHDGSFNDARMNVS 244
           Y Y GCK YDFFAGSQNLK +YLLSK++  + APML    LKA+LVYHDGSFND+R+N +
Sbjct: 170 YIYMGCKFYDFFAGSQNLKKSYLLSKSATVEKAPMLTTDNLKASLVYHDGSFNDSRLNAT 229

Query: 245 LAVTAIENGATVLNYMEVEKLIKDPKTGKIQGATVRDRETDKKYDVMAKVVVNSTGPFSD 304
           LA+TA+ENGATVLNY+EV++LIKDP +GK+ GA  RD ET++   + AK VVN+TGP+SD
Sbjct: 230 LAITAVENGATVLNYVEVQRLIKDPASGKVVGAEARDVETNELVKINAKCVVNATGPYSD 289

Query: 305 NILQMDRNKSGYPDIFDKANIDTSKLPSIDHDNLSRIAVDNPKMVVPSAGVHIILPSYYC 364
            ILQMDRN SG P+     N       S+     ++IAV +PKMV+PS GVHI+LPS+YC
Sbjct: 290 AILQMDRNPSGQPNSPLNDN-------SLIKSTFNQIAVTDPKMVIPSIGVHIVLPSFYC 342

Query: 365 PKDMGILDVKTADGRVMFFLPWQDKVLAGTTDIPMKKVPENPVATEADIEDILSELQHYC 424
           PKDMG+LDV+T+DGRVMFFLPWQ KVLAGTTDIP+K+VPENP+ TEADI+DIL ELQHY 
Sbjct: 343 PKDMGLLDVRTSDGRVMFFLPWQGKVLAGTTDIPLKQVPENPMPTEADIQDILKELQHYI 402

Query: 425 KFPVKREDVLSAWAGIRPLVRDPRKLSPNSKGDDSTQGLVRSHFIFTSENNLVTIAGGKW 484
           +FPVKREDVLSAWAG+RPLVRDPR +  + K   +TQG+VRSHF+FTS+N L+TIAGGKW
Sbjct: 403 EFPVKREDVLSAWAGVRPLVRDPRTIPADGKKGSATQGVVRSHFLFTSDNGLITIAGGKW 462

Query: 485 TTYRRMAEETIDEAIKVGQLPN-KPSVTKDLILSGGENWTPNTAALLSQKYHIPSSLSKY 543
           TTYR+MAEET+D+ ++VG+  N KP  T+D+ L+G E WT N  ALL+Q YH+ S +S Y
Sbjct: 463 TTYRQMAEETVDKVVEVGRFHNLKPCHTRDIKLAGAEEWTQNYVALLAQNYHLSSKMSNY 522

Query: 544 LSENYGTRAPIICELLKKDKKNELPVTLAGKEHNEILGN-----VDFQALRYPYTVAEVK 598
           L +NYGTR+ IICE  K+  +N+LP++LA KE+N I  +     V+F   RYP+T+ E+K
Sbjct: 523 LVQNYGTRSSIICEFFKESMENKLPLSLADKENNVIYSSEENNLVNFDTFRYPFTIGELK 582

Query: 599 YCIDNEYSRTALDFLLRRTRFGFLDAKEAMNAVEGTVSIMGDELNWDSEKRSLEIKKSKE 658
           Y +  EY RT LDFLLRRTRF FLDAKEA+N+   TV +MGDE NW  +KR  E++K+  
Sbjct: 583 YSMQYEYCRTPLDFLLRRTRFAFLDAKEALNSAHATVKVMGDEFNWSEKKRQWELEKTIN 642

Query: 659 YIKTLGV 665
           +IKT GV
Sbjct: 643 FIKTFGV 649

>Smik_9.14 Chr9 complement(29383..31341) [1959 bp, 652 aa] {ON}
           YIL155C (REAL)
          Length = 652

 Score =  777 bits (2007), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 374/607 (61%), Positives = 462/607 (76%), Gaps = 15/607 (2%)

Query: 67  PP--SRSELLSNLEKTKKFDVLXXXXXXXXXXXXVDASTRGLNVALMEMNDFXXXXXXXX 124
           PP  SR +LL  L KT +FDVL            +DA+TRGLNVAL+E  DF        
Sbjct: 53  PPQVSRRDLLERLGKTHQFDVLIIGGGATGTGCALDAATRGLNVALVEKGDFASGTSSKS 112

Query: 125 XXMAHGGVRYLEKAVFQLSKAQLDLVIEALNERKHMLQTAPHLCKILPIMIPVYNYWEVP 184
             M HGGVRYLEKA ++ SKAQLDLVIEALNERKH++ TAPHLC +LPI+IP+Y+  +VP
Sbjct: 113 TKMIHGGVRYLEKAFWEFSKAQLDLVIEALNERKHLINTAPHLCTVLPILIPIYSTLQVP 172

Query: 185 YFYAGCKMYDFFAGSQNLKSAYLLSKTSAGQIAPMLDVPKLKAALVYHDGSFNDARMNVS 244
           Y Y GCK YDFFAGSQNLK +YLLSK++  + APML    LKA+LVYHDGSFND+R+N +
Sbjct: 173 YIYMGCKFYDFFAGSQNLKKSYLLSKSATVEKAPMLTTDNLKASLVYHDGSFNDSRLNAT 232

Query: 245 LAVTAIENGATVLNYMEVEKLIKDPKTGKIQGATVRDRETDKKYDVMAKVVVNSTGPFSD 304
           LA+TA+ENGATVLNY+EV+KLIKDP +GK+ GA  RD ET++   + AK VVN+TGP+SD
Sbjct: 233 LAITAVENGATVLNYVEVQKLIKDPASGKVIGAEARDVETNELIRIKAKCVVNATGPYSD 292

Query: 305 NILQMDRNKSGYPDIFDKANIDTSKLPSIDHDNLSRIAVDNPKMVVPSAGVHIILPSYYC 364
            ILQMDRN SG PD     N D SK  S      ++IAV +PKMV+PS GVHI+LPS+YC
Sbjct: 293 AILQMDRNPSGQPD--SPLN-DNSKAKSA----FNQIAVMDPKMVIPSIGVHIVLPSFYC 345

Query: 365 PKDMGILDVKTADGRVMFFLPWQDKVLAGTTDIPMKKVPENPVATEADIEDILSELQHYC 424
           PKDMG+LDV+T+DGRVMFFLPWQ KVLAGTTDIP+K+VPENP+ TEADI+DIL ELQHY 
Sbjct: 346 PKDMGLLDVRTSDGRVMFFLPWQGKVLAGTTDIPLKQVPENPMPTEADIQDILKELQHYI 405

Query: 425 KFPVKREDVLSAWAGIRPLVRDPRKLSPNSKGDDSTQGLVRSHFIFTSENNLVTIAGGKW 484
           +FPVKREDVLSAWAG+RPLVRDPR +  + K   +TQG+VRSHF+FTS+N+L+TIAGGKW
Sbjct: 406 EFPVKREDVLSAWAGVRPLVRDPRTIPADGKKGSATQGVVRSHFLFTSDNDLITIAGGKW 465

Query: 485 TTYRRMAEETIDEAIKVGQLPN-KPSVTKDLILSGGENWTPNTAALLSQKYHIPSSLSKY 543
           TTYR+MAEETID+ ++VG   N  P  T+D+ L+G E WT N  ALL+Q YH+ S +S Y
Sbjct: 466 TTYRQMAEETIDKVVEVGGFHNLTPCHTRDIKLAGAEEWTQNYVALLAQNYHLSSKMSNY 525

Query: 544 LSENYGTRAPIICELLKKDKKNELPVTLAGKEHNEILGN-----VDFQALRYPYTVAEVK 598
           L +NYGTR+ IICE  K+  +N+LP++LA KE+N I  +     V+F   RYP+T+ E+K
Sbjct: 526 LVQNYGTRSSIICEYFKESMENKLPLSLADKENNVIYSSEENNLVNFDTFRYPFTIGELK 585

Query: 599 YCIDNEYSRTALDFLLRRTRFGFLDAKEAMNAVEGTVSIMGDELNWDSEKRSLEIKKSKE 658
           Y +  EY RT LDFLLRRTRF FLDAKEA+N+V  TV +MGDE NW  +KR  E++K+  
Sbjct: 586 YSMQYEYCRTPLDFLLRRTRFAFLDAKEALNSVHATVKVMGDEFNWSEKKRQWELEKTVN 645

Query: 659 YIKTLGV 665
           +IKT GV
Sbjct: 646 FIKTFGV 652

>Suva_9.32 Chr9 complement(46397..48013) [1617 bp, 538 aa] {ON}
           YIL155C (REAL)
          Length = 538

 Score =  748 bits (1932), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/545 (64%), Positives = 432/545 (79%), Gaps = 13/545 (2%)

Query: 127 MAHGGVRYLEKAVFQLSKAQLDLVIEALNERKHMLQTAPHLCKILPIMIPVYNYWEVPYF 186
           M HGGVRYLEKA ++ SKAQLDLVIEALNERKH++ TAPHLC +LPI+IP+YN W+VPY 
Sbjct: 1   MIHGGVRYLEKAFWEFSKAQLDLVIEALNERKHLINTAPHLCTVLPILIPIYNTWQVPYI 60

Query: 187 YAGCKMYDFFAGSQNLKSAYLLSKTSAGQIAPMLDVPKLKAALVYHDGSFNDARMNVSLA 246
           YAGCK YDFFAG QNLKS+YLLSK++  + APML    LKA+LVYHDGSFND+R+N +LA
Sbjct: 61  YAGCKFYDFFAGKQNLKSSYLLSKSATVEKAPMLTTDNLKASLVYHDGSFNDSRLNATLA 120

Query: 247 VTAIENGATVLNYMEVEKLIKDPKTGKIQGATVRDRETDKKYDVMAKVVVNSTGPFSDNI 306
           +TA+ENGATVLNY+EV+KLIKDP +GK+ GA  RD ET++   + AK VVN+TGP+SD I
Sbjct: 121 ITAVENGATVLNYVEVQKLIKDPASGKVVGAEARDVETNELVRINAKCVVNATGPYSDAI 180

Query: 307 LQMDRNKSGYPDIFDKANIDTSKLPSIDHDNLSRIAVDNPKMVVPSAGVHIILPSYYCPK 366
           LQMDRN SG P+     N D SK+ S      +++AV +P+MV+PS GVHI+LPS+YCPK
Sbjct: 181 LQMDRNASGQPN--SPLN-DNSKIKSA----FNQVAVMDPEMVIPSIGVHIVLPSFYCPK 233

Query: 367 DMGILDVKTADGRVMFFLPWQDKVLAGTTDIPMKKVPENPVATEADIEDILSELQHYCKF 426
           D+G+LDV+T+DGRVMFFLPWQ KVLAGTTDIP+K+VPENP+ TEADI+DIL ELQHY +F
Sbjct: 234 DIGLLDVRTSDGRVMFFLPWQGKVLAGTTDIPLKQVPENPMPTEADIQDILKELQHYIEF 293

Query: 427 PVKREDVLSAWAGIRPLVRDPRKLSPNSKGDDSTQGLVRSHFIFTSENNLVTIAGGKWTT 486
           PVKREDVLSAWAG+RPLVRDPR +    K   +TQG+VRSHF+FTS+N L+TIAGGKWTT
Sbjct: 294 PVKREDVLSAWAGVRPLVRDPRSIPAGGKKGSATQGVVRSHFLFTSDNGLITIAGGKWTT 353

Query: 487 YRRMAEETIDEAIKVGQLPN-KPSVTKDLILSGGENWTPNTAALLSQKYHIPSSLSKYLS 545
           YR+MAEETID+ ++VG   N KP  T+D+ L+G E WT N  ALL+Q YH+ S +S YL 
Sbjct: 354 YRQMAEETIDKVVEVGGFHNLKPCHTRDIKLAGAEEWTQNYVALLAQNYHLSSKMSNYLV 413

Query: 546 ENYGTRAPIICELLKKDKKNELPVTLAGKEHNEILGN-----VDFQALRYPYTVAEVKYC 600
           ENYGTR+ IICE  K   +N+LP++LA KE+N I  N     V+F   RYP+T+ E+KY 
Sbjct: 414 ENYGTRSSIICEFFKDSMENKLPLSLADKENNTIYSNEENNLVNFDTFRYPFTIGELKYS 473

Query: 601 IDNEYSRTALDFLLRRTRFGFLDAKEAMNAVEGTVSIMGDELNWDSEKRSLEIKKSKEYI 660
           +  EY RT LDFLLRRTRF FLDAKEA+N+V  TV +MGDE NW  +KR  E++K+  +I
Sbjct: 474 MQYEYCRTPLDFLLRRTRFAFLDAKEALNSVHATVKVMGDEFNWSDKKRQWELEKTVNFI 533

Query: 661 KTLGV 665
           KT GV
Sbjct: 534 KTFGV 538

>KNAG0L02190 Chr12 (391987..393924) [1938 bp, 645 aa] {ON} Anc_5.711
           YIL155C
          Length = 645

 Score =  740 bits (1910), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 365/600 (60%), Positives = 442/600 (73%), Gaps = 15/600 (2%)

Query: 68  PSRSELLSNLEKTKKFDVLXXXXXXXXXXXXVDASTRGLNVALMEMNDFXXXXXXXXXXM 127
           P R+++L  L+ TK FDVL            +DAS RGL VAL+E  DF          +
Sbjct: 59  PDRAKVLQRLQDTK-FDVLVVGGGATGTGVALDASLRGLKVALVEKADFAAGTSSKSTKL 117

Query: 128 AHGGVRYLEKAVFQLSKAQLDLVIEALNERKHMLQTAPHLCKILPIMIPVYNYWEVPYFY 187
           AHGGVRYLEKAVF+LSK QLDLV+EALNER H+L  APHL KILPI+IPVY YW+VPYFY
Sbjct: 118 AHGGVRYLEKAVFELSKPQLDLVVEALNERAHLLYAAPHLTKILPIIIPVYEYWKVPYFY 177

Query: 188 AGCKMYDFFAGSQNLKSAYLLSKTSAGQIAPMLDVPKLKAALVYHDGSFNDARMNVSLAV 247
           AGCKMYDFFAG+QNLKS+YLLS+ +   IAPMLD  KLK  LVYHDG FND+R+  +LA+
Sbjct: 178 AGCKMYDFFAGAQNLKSSYLLSRENLSHIAPMLDQKKLKMGLVYHDGIFNDSRLCATLAI 237

Query: 248 TAIENGATVLNYMEVEKLIKDPKTGKIQGATVRDRETDKKYDVMAKVVVNSTGPFSDNIL 307
           +A+E GATV NY+ VE+LIKD  TG I GA V D+ET   + V AK+VVN+TGP+SD IL
Sbjct: 238 SAVERGATVANYVSVEQLIKDKTTGVITGAKVEDQETGGTFTVNAKIVVNATGPYSDKIL 297

Query: 308 QMDRNKSGYPDIFDKANIDTSKLPSIDHDNLSRIAVDNPKMVVPSAGVHIILPSYYCPKD 367
           QMD N  G P+          K P       + IAV NPKMVVPS GVHI LPS+YCP +
Sbjct: 298 QMDANPQGLPE----------KEPEKATPENALIAVRNPKMVVPSRGVHITLPSFYCPSE 347

Query: 368 MGILDVKTADGRVMFFLPWQDKVLAGTTDIPMKKVPENPVATEADIEDILSELQHYCKFP 427
           MG+LD  T+DGRVMFFLPWQ KV+AGTTDIP+K+VP +P  TEADI+DIL ELQHY +FP
Sbjct: 348 MGLLDASTSDGRVMFFLPWQGKVIAGTTDIPLKQVPRDPSPTEADIQDILQELQHYIQFP 407

Query: 428 VKREDVLSAWAGIRPLVRDPRKLSPNSKGDDSTQGLVRSHFIFTSENNLVTIAGGKWTTY 487
           V+REDVLSAWAGIRPLVRDPR ++  S G   T+GLVRSHFIFTS   LVTIAGGKWTTY
Sbjct: 408 VRREDVLSAWAGIRPLVRDPR-VAEGSAGSGQTEGLVRSHFIFTSPTQLVTIAGGKWTTY 466

Query: 488 RRMAEETIDEAIKVGQLPN-KPSVTKDLILSGGENWTPNTAALLSQKYH-IPSSLSKYLS 545
           R MAEET+DE IKVG+    KP  T+   L G ++W  N  A L Q+Y  +  SL+++L+
Sbjct: 467 REMAEETVDEVIKVGKFQGLKPCTTRKTKLIGAQHWNLNFQAYLQQRYAPLEDSLAEHLA 526

Query: 546 ENYGTRAPIICELLKKDKKNELPVTLAGKEHNEILGNVDFQALRYPYTVAEVKYCIDNEY 605
            NYG RAPIICE+ + DK ++LPV L G   +++  N+D  A  YP+T+AE+KYCI  EY
Sbjct: 527 NNYGDRAPIICEMFEADKSSKLPVGLYGDGDDKV-KNMDANAFDYPFTIAELKYCIRFEY 585

Query: 606 SRTALDFLLRRTRFGFLDAKEAMNAVEGTVSIMGDELNWDSEKRSLEIKKSKEYIKTLGV 665
            RTALDFLLRR+RF FLDA+EA+NAV+ TV+++GDEL WD+EKR+ E  K+K YIKT GV
Sbjct: 586 VRTALDFLLRRSRFAFLDAREALNAVDPTVNLIGDELGWDAEKRAAESAKTKAYIKTFGV 645

>KLLA0D16478g Chr4 complement(1391173..1392027) [855 bp, 284 aa]
           {ON} weakly similar to uniprot|Q12208 Saccharomyces
           cerevisiae YLR132C Protein required for cell viability,
          Length = 284

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 28/91 (30%), Positives = 38/91 (41%), Gaps = 4/91 (4%)

Query: 175 IPVYNYWEVPYFYAG-CKMYDFFAGSQNLKSAYLLSKTSAGQIAPMLDVPKLKAALVYHD 233
           I    Y  +P   AG  ++YD F  S    +  L SK+S  Q+ P+LD  K      YH 
Sbjct: 146 ITTLKYKSIPISLAGNWRLYDNFDSSLTFLTLNL-SKSSVRQLQPILDAIKRNVPPTYHS 204

Query: 234 GSFNDARMNVSLAVTAIENGATVLNYMEVEK 264
              +    ++S  V  I N     N  E EK
Sbjct: 205 KVIDPETAHISFGV--IPNNKQFKNAEEFEK 233

>TDEL0C03980 Chr3 complement(697431..699503) [2073 bp, 690 aa] {ON}
           Anc_2.263 YIL108W
          Length = 690

 Score = 33.5 bits (75), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 40/155 (25%), Positives = 63/155 (40%), Gaps = 22/155 (14%)

Query: 169 KILPIMIPVYNYWEVPYF----YAGCKMYDFFAGSQNLKSAYLLSKTSAGQ---IAPMLD 221
           K+L +  P     + P F    +     Y F  G Q +KS  LL   S GQ   I P +D
Sbjct: 487 KLLSVNAPGLEIGKFPDFLKVTFIPMDQYGFPRGVQGVKSQ-LLGNPSGGQDVGIVP-ID 544

Query: 222 VPKLKAALVYHDGSFNDARMNVSLAVTAIENGATVLNYMEVEKLIKDPKTGKIQGATVRD 281
           + ++ A  +YH G+ +  R   S    +        NY+   KL+K  K      AT  D
Sbjct: 545 IRRVTAVRIYHGGALDGMRFYFSSQTESANPPVPPRNYL--GKLVKSFK------ATSID 596

Query: 282 RETDKKYDVMAKVVVNSTGPFSDNILQMDRNKSGY 316
             + K       +    TG ++D +L+     +G+
Sbjct: 597 NTSGKNV-----LFGYETGSYTDAVLEEGEYITGF 626

>Skud_8.231 Chr8 (410736..411521) [786 bp, 261 aa] {ON} YHR167W
           (REAL)
          Length = 261

 Score = 32.3 bits (72), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 34/162 (20%), Positives = 72/162 (44%), Gaps = 28/162 (17%)

Query: 264 KLIKDPKTGKIQGATVRDRETDKKYDVMAKVVVNSTGPFSDNILQMDRNKSGYPDIFDKA 323
           +L++D +TG+   A V++R+T  +Y             F     Q++R+   Y ++  + 
Sbjct: 79  QLLEDAETGRDISAGVQNRKTIAEY----------YSTFD----QLNRDTLKYINLLKRL 124

Query: 324 NIDTSKLPSIDHDNLSRIAVDNPKMVVPSAGVHIILPSYYCPKDMGILDVKTADGRVMFF 383
           ++D +K   +   +++   +DN    VPS  +  IL  Y  P+     D++  D ++  +
Sbjct: 125 SVDLAKQVEVSDPSVTVYELDN---WVPSEKLQGILEEYCAPE----TDIRGVDAQIKNY 177

Query: 384 LPWQDKVLAGTTDIPMKKVPENPVATEADIEDILSELQHYCK 425
           L   D++        +    EN  + +  +  +  EL H+ K
Sbjct: 178 L---DQIKMARAKFGL----ENKYSLKEGLSTLTKELNHWRK 212

>TDEL0G04380 Chr7 (792278..794446) [2169 bp, 722 aa] {ON} Anc_6.31
           YMR001C
          Length = 722

 Score = 31.6 bits (70), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 23/46 (50%), Gaps = 4/46 (8%)

Query: 467 HFIFTSENNLVTIAGGKWTTYRRMAEETID----EAIKVGQLPNKP 508
            F F   N L    GGK  TY   + E++     E +K+G++PN P
Sbjct: 648 QFNFKDHNKLAVSEGGKLVTYISPSHESLTYPLVELLKIGEIPNYP 693

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.133    0.384 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 68,657,295
Number of extensions: 3015714
Number of successful extensions: 9007
Number of sequences better than 10.0: 30
Number of HSP's gapped: 9179
Number of HSP's successfully gapped: 30
Length of query: 665
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 549
Effective length of database: 40,180,143
Effective search space: 22058898507
Effective search space used: 22058898507
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 69 (31.2 bits)