Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0E017305.702ON1820180082400.0
SAKL0E14916g5.702ON1779177915141e-178
AFR286W5.702ON1758155214151e-164
ZYRO0G06600g5.702ON1820123613841e-160
TDEL0B021905.702ON1810114013301e-152
CAGL0G02497g5.702ON1780157913241e-152
Smik_11.3585.702ON1878113412611e-143
Suva_11.3315.702ON1898113312401e-140
KLTH0E01056g5.702ON1771123712021e-135
Skud_11.3345.702ON1885137512001e-135
YKR095W (MLP1)5.702ON1875113811901e-133
Kwal_55.196975.702ON1760122411831e-133
Ecym_40185.702ON1769121011301e-126
NCAS0A032005.702ON1788100510721e-119
KLLA0A00594g5.702ON1748129110141e-111
NDAI0E050405.702ON197312979631e-105
Skud_9.195.702ON168011817724e-82
YIL149C (MLP2)5.702ON167912147708e-82
Suva_9.395.702ON168211347592e-80
Smik_9.205.702ON168212147153e-75
NCAS0G002305.702ON173510275885e-60
KAFR0D022205.702ON167410235535e-56
KNAG0C065905.702ON16519984759e-47
KNAG0L021405.702ON160812324382e-42
KAFR0H002105.702ON14548874363e-42
Kpol_1043.705.702ON13214013754e-35
NDAI0F002905.702ON15541892466e-20
TPHA0E002305.702ON12844782207e-17
TPHA0D046105.702ON11832151964e-14
Skud_12.3934.46ON9132741114e-04
ZYRO0D11902g5.501ON44384980.011
Skud_15.3628.604ON829397950.032
YLR309C (IMH1)4.46ON911356940.043
KAFR0F030204.46ON824146930.052
Suva_8.3777.68ON1568168910.091
Kpol_2001.755.702ON100688880.20
Suva_8.2518.604ON829497880.21
Ecym_83564.39ON1811167870.28
KNAG0J019108.704ON763125830.70
NCAS0E019207.186ON1170200830.72
KLTH0D09504g8.604ON718297830.79
KNAG0B038605.501ON47283820.80
YOR195W (SLK19)8.604ON821164821.00
CAGL0E03454g4.46ON867185811.3
KAFR0G020908.604ON732433811.3
CAGL0D00924g4.238ON1980409802.0
NDAI0E014508.636ON518200792.0
Kpol_363.15.501ON42884782.3
Smik_12.3934.46ON91085792.4
NCAS0A149407.488ON133646792.5
YOR162C (YRR1)6.60ON810183782.7
KLLA0E15511g5.88ON905279782.8
KAFR0J017702.215ON161153743.3
ZYRO0C05676g6.289ON625222773.5
Suva_2.5285.414ON944340764.6
Kpol_483.114.238ON254692774.6
TBLA0C032905.308ON587113755.4
ZYRO0B12144g4.238ON2005251765.5
NDAI0B050501.278ON33572745.8
KAFR0J003605.308ON567118747.2
NCAS0A128602.590ON87679748.0
NCAS0C013508.678ON655210749.2
KLLA0C02299g1.81ON658128739.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0E01730
         (1820 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0E01730 Chr5 complement(417597..423059) [5463 bp, 1820 aa] {...  3178   0.0  
SAKL0E14916g Chr5 (1236762..1242101) [5340 bp, 1779 aa] {ON} sim...   587   e-178
AFR286W Chr6 (951485..956761) [5277 bp, 1758 aa] {ON} Syntenic h...   549   e-164
ZYRO0G06600g Chr7 complement(521893..527355) [5463 bp, 1820 aa] ...   537   e-160
TDEL0B02190 Chr2 complement(389562..394994) [5433 bp, 1810 aa] {...   516   e-152
CAGL0G02497g Chr7 (223375..228717) [5343 bp, 1780 aa] {ON} simil...   514   e-152
Smik_11.358 Chr11 (609897..615533) [5637 bp, 1878 aa] {ON} YKR09...   490   e-143
Suva_11.331 Chr11 (604552..610248) [5697 bp, 1898 aa] {ON} YKR09...   482   e-140
KLTH0E01056g Chr5 complement(99471..104786) [5316 bp, 1771 aa] {...   467   e-135
Skud_11.334 Chr11 (601335..606992) [5658 bp, 1885 aa] {ON} YKR09...   466   e-135
YKR095W Chr11 (619805..625432) [5628 bp, 1875 aa] {ON}  MLP1Myos...   462   e-133
Kwal_55.19697 s55 complement(82938..88220) [5283 bp, 1760 aa] {O...   460   e-133
Ecym_4018 Chr4 complement(42777..48086) [5310 bp, 1769 aa] {ON} ...   439   e-126
NCAS0A03200 Chr1 complement(627997..633363) [5367 bp, 1788 aa] {...   417   e-119
KLLA0A00594g Chr1 complement(53304..58550) [5247 bp, 1748 aa] {O...   395   e-111
NDAI0E05040 Chr5 (1150358..1156279) [5922 bp, 1973 aa] {ON} Anc_...   375   e-105
Skud_9.19 Chr9 complement(40103..45145) [5043 bp, 1680 aa] {ON} ...   301   4e-82
YIL149C Chr9 complement(63028..68067) [5040 bp, 1679 aa] {ON}  M...   301   8e-82
Suva_9.39 Chr9 complement(57700..62748) [5049 bp, 1682 aa] {ON} ...   296   2e-80
Smik_9.20 Chr9 complement(40653..45701) [5049 bp, 1682 aa] {ON} ...   280   3e-75
NCAS0G00230 Chr7 complement(33629..38836) [5208 bp, 1735 aa] {ON...   231   5e-60
KAFR0D02220 Chr4 complement(443928..448952) [5025 bp, 1674 aa] {...   217   5e-56
KNAG0C06590 Chr3 (1276738..1281693) [4956 bp, 1651 aa] {ON} Anc_...   187   9e-47
KNAG0L02140 Chr12 (381286..386112) [4827 bp, 1608 aa] {ON} Anc_5...   173   2e-42
KAFR0H00210 Chr8 complement(27128..31492) [4365 bp, 1454 aa] {ON...   172   3e-42
Kpol_1043.70 s1043 (147247..151212) [3966 bp, 1321 aa] {ON} (147...   149   4e-35
NDAI0F00290 Chr6 complement(60327..64991) [4665 bp, 1554 aa] {ON...    99   6e-20
TPHA0E00230 Chr5 complement(28358..32212) [3855 bp, 1284 aa] {ON...    89   7e-17
TPHA0D04610 Chr4 (1006833..1010384) [3552 bp, 1183 aa] {ON} Anc_...    80   4e-14
Skud_12.393 Chr12 complement(689954..692695) [2742 bp, 913 aa] {...    47   4e-04
ZYRO0D11902g Chr4 complement(1008230..1009561) [1332 bp, 443 aa]...    42   0.011
Skud_15.362 Chr15 (651999..654488) [2490 bp, 829 aa] {ON} YOR195...    41   0.032
YLR309C Chr12 complement(749034..751769) [2736 bp, 911 aa] {ON} ...    41   0.043
KAFR0F03020 Chr6 (595158..597632) [2475 bp, 824 aa] {ON} Anc_4.4...    40   0.052
Suva_8.377 Chr8 (666400..671106) [4707 bp, 1568 aa] {ON} YOR326W...    40   0.091
Kpol_2001.75 s2001 (206286..209306) [3021 bp, 1006 aa] {ON} (206...    39   0.20 
Suva_8.251 Chr8 (451862..454351) [2490 bp, 829 aa] {ON} YOR195W ...    39   0.21 
Ecym_8356 Chr8 (713086..718521) [5436 bp, 1811 aa] {ON} similar ...    38   0.28 
KNAG0J01910 Chr10 complement(346989..349280) [2292 bp, 763 aa] {...    37   0.70 
NCAS0E01920 Chr5 (368382..371894) [3513 bp, 1170 aa] {ON} Anc_7....    37   0.72 
KLTH0D09504g Chr4 (783223..785379) [2157 bp, 718 aa] {ON} weakly...    37   0.79 
KNAG0B03860 Chr2 (740115..741533) [1419 bp, 472 aa] {ON} Anc_5.5...    36   0.80 
YOR195W Chr15 (712866..715331) [2466 bp, 821 aa] {ON}  SLK19Kine...    36   1.00 
CAGL0E03454g Chr5 complement(316082..318685) [2604 bp, 867 aa] {...    36   1.3  
KAFR0G02090 Chr7 complement(437389..439587) [2199 bp, 732 aa] {O...    36   1.3  
CAGL0D00924g Chr4 (108341..114283) [5943 bp, 1980 aa] {ON} simil...    35   2.0  
NDAI0E01450 Chr5 (288999..290555) [1557 bp, 518 aa] {ON} Anc_8.6...    35   2.0  
Kpol_363.1 s363 complement(438..1724) [1287 bp, 428 aa] {ON} com...    35   2.3  
Smik_12.393 Chr12 complement(687243..689975) [2733 bp, 910 aa] {...    35   2.4  
NCAS0A14940 Chr1 (2941337..2945347) [4011 bp, 1336 aa] {ON} Anc_...    35   2.5  
YOR162C Chr15 complement(639560..641992) [2433 bp, 810 aa] {ON} ...    35   2.7  
KLLA0E15511g Chr5 (1388626..1391343) [2718 bp, 905 aa] {ON} simi...    35   2.8  
KAFR0J01770 Chr10 (339037..339522) [486 bp, 161 aa] {ON} Anc_2.2...    33   3.3  
ZYRO0C05676g Chr3 complement(434420..436297) [1878 bp, 625 aa] {...    34   3.5  
Suva_2.528 Chr2 (942956..945790) [2835 bp, 944 aa] {ON} YDR356W ...    34   4.6  
Kpol_483.11 s483 complement(25219..32859) [7641 bp, 2546 aa] {ON...    34   4.6  
TBLA0C03290 Chr3 complement(799041..800804) [1764 bp, 587 aa] {O...    33   5.4  
ZYRO0B12144g Chr2 complement(976039..982056) [6018 bp, 2005 aa] ...    34   5.5  
NDAI0B05050 Chr2 complement(1235335..1236342) [1008 bp, 335 aa] ...    33   5.8  
KAFR0J00360 Chr10 (64813..66516) [1704 bp, 567 aa] {ON} Anc_5.30...    33   7.2  
NCAS0A12860 Chr1 complement(2536095..2538725) [2631 bp, 876 aa] ...    33   8.0  
NCAS0C01350 Chr3 complement(246839..248806) [1968 bp, 655 aa] {O...    33   9.2  
KLLA0C02299g Chr3 complement(194267..196243) [1977 bp, 658 aa] {...    33   9.5  

>TBLA0E01730 Chr5 complement(417597..423059) [5463 bp, 1820 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1820

 Score = 3178 bits (8240), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1674/1800 (93%), Positives = 1674/1800 (93%)

Query: 1    MGESDGNGTSEADTLDSSFKNSNSENRHDSTILLQISSILDVPLEKLHTTDYDLILAVKD 60
            MGESDGNGTSEADTLDSSFKNSNSENRHDSTILLQISSILDVPLEKLHTTDYDLILAVKD
Sbjct: 1    MGESDGNGTSEADTLDSSFKNSNSENRHDSTILLQISSILDVPLEKLHTTDYDLILAVKD 60

Query: 61   KLDELRNSKDQSNVVSNDINELQTLADNKLTSLGGKLATVETEKKELIDKVNGYETQFNE 120
            KLDELRNSKDQSNVVSNDINELQTLADNKLTSLGGKLATVETEKKELIDKVNGYETQFNE
Sbjct: 61   KLDELRNSKDQSNVVSNDINELQTLADNKLTSLGGKLATVETEKKELIDKVNGYETQFNE 120

Query: 121  LKIKNEGLNLKVSNLNIELENWKNNSNNFETEKLNYVXXXXXLSIRESEIQRLKQEVTFL 180
            LKIKNEGLNLKVSNLNIELENWKNNSNNFETEKLNYV     LSIRESEIQRLKQEVTFL
Sbjct: 121  LKIKNEGLNLKVSNLNIELENWKNNSNNFETEKLNYVXXXXXLSIRESEIQRLKQEVTFL 180

Query: 181  NENKSSLSEQWXXXXXXXXXXXXXXXXXXXXSTIKLEEATTTLKSMEAKVSVLSDKNNDL 240
            NENKSSLSEQW                    STIKLEEATTTLKSMEAKVSVLSDKNNDL
Sbjct: 181  NENKSSLSEQWLKEKEEFNKAKLLLEKNLNNSTIKLEEATTTLKSMEAKVSVLSDKNNDL 240

Query: 241  TKKYENSIWEIKNLKDNLLVTKDDMNKEIAMKSKLIDLLQGQLSSTQEELRQNVELNSKF 300
            TKKYENSIWEIKNLKDNLLVTKDDMNKEIAMKSKLIDLLQGQLSSTQEELRQNVELNSKF
Sbjct: 241  TKKYENSIWEIKNLKDNLLVTKDDMNKEIAMKSKLIDLLQGQLSSTQEELRQNVELNSKF 300

Query: 301  TKFPDLESQNETLKSDIQDLTLKIEELQNENFNLXXXXXXXXXXXXXXXXXXXXXXXLPT 360
            TKFPDLESQNETLKSDIQDLTLKIEELQNENFNL                       LPT
Sbjct: 301  TKFPDLESQNETLKSDIQDLTLKIEELQNENFNLNSMINQMSNEQNNSNNSSSIDSNLPT 360

Query: 361  LYSKINLLKKQVTQEKLEKKHLQTQIESFIIELENKIPIISSFQEKNQAXXXXXXXXXXX 420
            LYSKINLLKKQVTQEKLEKKHLQTQIESFIIELENKIPIISSFQEKNQA           
Sbjct: 361  LYSKINLLKKQVTQEKLEKKHLQTQIESFIIELENKIPIISSFQEKNQALENELTNLTLL 420

Query: 421  XXXXXXXXXXIQNKLNNYDSKLLTYQSNIKELIRQRLDLANQVKHLLLFVAVKNDSGGPL 480
                      IQNKLNNYDSKLLTYQSNIKELIRQRLDLANQVKHLLLFVAVKNDSGGPL
Sbjct: 421  LNKTSNEKNTIQNKLNNYDSKLLTYQSNIKELIRQRLDLANQVKHLLLFVAVKNDSGGPL 480

Query: 481  TREEIEFINKISNNSEDLNGSELTSQHVISERLVTFSNIEELQAKNMELLNSIRSLSENL 540
            TREEIEFINKISNNSEDLNGSELTSQHVISERLVTFSNIEELQAKNMELLNSIRSLSENL
Sbjct: 481  TREEIEFINKISNNSEDLNGSELTSQHVISERLVTFSNIEELQAKNMELLNSIRSLSENL 540

Query: 541  ENIENANSHKEFQNKTIADAKEAILTLQYHNDILESKVKVLEAERDSFKLLLNNNVSIDS 600
            ENIENANSHKEFQNKTIADAKEAILTLQYHNDILESKVKVLEAERDSFKLLLNNNVSIDS
Sbjct: 541  ENIENANSHKEFQNKTIADAKEAILTLQYHNDILESKVKVLEAERDSFKLLLNNNVSIDS 600

Query: 601  SIKNDDLSSSTSPETNEKSIEKLQTLIEELKAELKKNKDALESQIASFTADKSNLTISLE 660
            SIKNDDLSSSTSPETNEKSIEKLQTLIEELKAELKKNKDALESQIASFTADKSNLTISLE
Sbjct: 601  SIKNDDLSSSTSPETNEKSIEKLQTLIEELKAELKKNKDALESQIASFTADKSNLTISLE 660

Query: 661  KEKSSNTLMAEKISLTESAFDMLKTENKELNKRFENLQNIIIKQESKLGDIINKYITGET 720
            KEKSSNTLMAEKISLTESAFDMLKTENKELNKRFENLQNIIIKQESKLGDIINKYITGET
Sbjct: 661  KEKSSNTLMAEKISLTESAFDMLKTENKELNKRFENLQNIIIKQESKLGDIINKYITGET 720

Query: 721  EISNLKTQLSIAKSEKDFLVKSQDSLNSELIKTSEEKNKLRIMLSQLQSLQNERMTLLDD 780
            EISNLKTQLSIAKSEKDFLVKSQDSLNSELIKTSEEKNKLRIMLSQLQSLQNERMTLLDD
Sbjct: 721  EISNLKTQLSIAKSEKDFLVKSQDSLNSELIKTSEEKNKLRIMLSQLQSLQNERMTLLDD 780

Query: 781  TQKKFMSKIHELENNNLDLIKNLGSKMTEIQKLSISNESQCTWYQNTIDDLKKINSAIKT 840
            TQKKFMSKIHELENNNLDLIKNLGSKMTEIQKLSISNESQCTWYQNTIDDLKKINSAIKT
Sbjct: 781  TQKKFMSKIHELENNNLDLIKNLGSKMTEIQKLSISNESQCTWYQNTIDDLKKINSAIKT 840

Query: 841  ELTSKNSLISDLNTKIELLESQSYTIDTNTRCSSSGNDFSQISKDLDITKLHLSEAYTQV 900
            ELTSKNSLISDLNTKIELLESQSYTIDTNTRCSSSGNDFSQISKDLDITKLHLSEAYTQV
Sbjct: 841  ELTSKNSLISDLNTKIELLESQSYTIDTNTRCSSSGNDFSQISKDLDITKLHLSEAYTQV 900

Query: 901  EEYKQLYTSTEESLKTLESNFESVKNLMDDKISKLLSENETLKASTGEYDKRISELSTDL 960
            EEYKQLYTSTEESLKTLESNFESVKNLMDDKISKLLSENETLKASTGEYDKRISELSTDL
Sbjct: 901  EEYKQLYTSTEESLKTLESNFESVKNLMDDKISKLLSENETLKASTGEYDKRISELSTDL 960

Query: 961  KNEKNKYSEEIAQLNVQITRLNKFKKDSADTASEYEEKISKLQSQLELKAKFADNAQEKY 1020
            KNEKNKYSEEIAQLNVQITRLNKFKKDSADTASEYEEKISKLQSQLELKAKFADNAQEKY
Sbjct: 961  KNEKNKYSEEIAQLNVQITRLNKFKKDSADTASEYEEKISKLQSQLELKAKFADNAQEKY 1020

Query: 1021 ESLLTKDNANLQSIEEFKEQIEKLNQRIVIIESDLEKKTSLLSENESLWKKKQDAFISDL 1080
            ESLLTKDNANLQSIEEFKEQIEKLNQRIVIIESDLEKKTSLLSENESLWKKKQDAFISDL
Sbjct: 1021 ESLLTKDNANLQSIEEFKEQIEKLNQRIVIIESDLEKKTSLLSENESLWKKKQDAFISDL 1080

Query: 1081 EESKKKIDNLTNQNKLYVDQLELLNKDFXXXXXXXXXXETKHMFNRLRADRDVLETKLSI 1140
            EESKKKIDNLTNQNKLYVDQLELLNKDF          ETKHMFNRLRADRDVLETKLSI
Sbjct: 1081 EESKKKIDNLTNQNKLYVDQLELLNKDFSSMDSSQLSSETKHMFNRLRADRDVLETKLSI 1140

Query: 1141 AERDSKNNASKLESLRDELANVQMKLISSENKLLRHSDLIENHEKIVSELNQITLFKESN 1200
            AERDSKNNASKLESLRDELANVQMKLISSENKLLRHSDLIENHEKIVSELNQITLFKESN
Sbjct: 1141 AERDSKNNASKLESLRDELANVQMKLISSENKLLRHSDLIENHEKIVSELNQITLFKESN 1200

Query: 1201 ETLRNQVSELNEKNKTLQTKLNEENSKLSNLSMELKSVKESLGDKETDIMLIKEESNKWR 1260
            ETLRNQVSELNEKNKTLQTKLNEENSKLSNLSMELKSVKESLGDKETDIMLIKEESNKWR
Sbjct: 1201 ETLRNQVSELNEKNKTLQTKLNEENSKLSNLSMELKSVKESLGDKETDIMLIKEESNKWR 1260

Query: 1261 LRAEELSVQIDKVDLDSVSKLSTELDALKDDAETKRKQNAELEERFNLLKKQAHERLNAS 1320
            LRAEELSVQIDKVDLDSVSKLSTELDALKDDAETKRKQNAELEERFNLLKKQAHERLNAS
Sbjct: 1261 LRAEELSVQIDKVDLDSVSKLSTELDALKDDAETKRKQNAELEERFNLLKKQAHERLNAS 1320

Query: 1321 KEIQSSLNKQINELKASNTNIELALSSEQKKSMDLQNTLSDNEVKYTQKLSNIESELKAL 1380
            KEIQSSLNKQINELKASNTNIELALSSEQKKSMDLQNTLSDNEVKYTQKLSNIESELKAL
Sbjct: 1321 KEIQSSLNKQINELKASNTNIELALSSEQKKSMDLQNTLSDNEVKYTQKLSNIESELKAL 1380

Query: 1381 KTENNSFKLSSEKEKMELTDEVDSLKKSLVEAQSKLSAIGSDSTDSTMNAMIXXXXXXXX 1440
            KTENNSFKLSSEKEKMELTDEVDSLKKSLVEAQSKLSAIGSDSTDSTMNAMI        
Sbjct: 1381 KTENNSFKLSSEKEKMELTDEVDSLKKSLVEAQSKLSAIGSDSTDSTMNAMIESMKKEFE 1440

Query: 1441 XXXXXXXXXXXXXXXAQWXXXXXXXXXXXXXXXXXXQSARTDQSIKIEEFQSLKKEWEEE 1500
                           AQW                  QSARTDQSIKIEEFQSLKKEWEEE
Sbjct: 1441 EEKLKLLEDKTNELEAQWKLEKDKLLKEYEEKIEDLQSARTDQSIKIEEFQSLKKEWEEE 1500

Query: 1501 YEKATLERIEEAKETLKKRIRLPSETKINRVIEKRKHELENEYEVKLQEKLNEIEANRNS 1560
            YEKATLERIEEAKETLKKRIRLPSETKINRVIEKRKHELENEYEVKLQEKLNEIEANRNS
Sbjct: 1501 YEKATLERIEEAKETLKKRIRLPSETKINRVIEKRKHELENEYEVKLQEKLNEIEANRNS 1560

Query: 1561 IETIDPGKLREEIKEEVKRDMLIKFENDLNEAKKKSFEEGKQQSSMKTTLLERKISKLES 1620
            IETIDPGKLREEIKEEVKRDMLIKFENDLNEAKKKSFEEGKQQSSMKTTLLERKISKLES
Sbjct: 1561 IETIDPGKLREEIKEEVKRDMLIKFENDLNEAKKKSFEEGKQQSSMKTTLLERKISKLES 1620

Query: 1621 QLSEAIENDKQSDKNPIISDLAQTSTLASIQPPSAKKPAFSFGGFNTTNSLNANKGFXXX 1680
            QLSEAIENDKQSDKNPIISDLAQTSTLASIQPPSAKKPAFSFGGFNTTNSLNANKGF   
Sbjct: 1621 QLSEAIENDKQSDKNPIISDLAQTSTLASIQPPSAKKPAFSFGGFNTTNSLNANKGFSSS 1680

Query: 1681 XXXXXXXXKDTEIVQNPFSLGVSQTSSSPMHFNPFSSSATTSNVFNQNGTSKNIFGNVMA 1740
                    KDTEIVQNPFSLGVSQTSSSPMHFNPFSSSATTSNVFNQNGTSKNIFGNVMA
Sbjct: 1681 SNNTSQSSKDTEIVQNPFSLGVSQTSSSPMHFNPFSSSATTSNVFNQNGTSKNIFGNVMA 1740

Query: 1741 MKPTTPTVEQAIKPLESVTPTETPEVPEDDLLSTRENTTETPSQEGDKMGEGSPLKRPIN 1800
            MKPTTPTVEQAIKPLESVTPTETPEVPEDDLLSTRENTTETPSQEGDKMGEGSPLKRPIN
Sbjct: 1741 MKPTTPTVEQAIKPLESVTPTETPEVPEDDLLSTRENTTETPSQEGDKMGEGSPLKRPIN 1800

>SAKL0E14916g Chr5 (1236762..1242101) [5340 bp, 1779 aa] {ON} similar
            to uniprot|Q02455 Saccharomyces cerevisiae YKR095W MLP1
            Myosin-like protein associated with the nuclear envelope
            connects the nuclear pore complex with the nuclear
            interior involved in the Tel1p pathway that controls
            telomere length involved in the retention of unspliced
            mRNAs in the nucleus
          Length = 1779

 Score =  587 bits (1514), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 533/1779 (29%), Positives = 939/1779 (52%), Gaps = 146/1779 (8%)

Query: 36   ISSILDVPLEKLHTTDYDLILAVKDKLDELRNSKDQSNVVSNDINELQTLADNKLTSLGG 95
            ISS L++   K+ T D  ++  +  K ++    K Q+   S  ++EL++ ++ +  +   
Sbjct: 21   ISSFLELDASKVSTLDPAVVRQLSIKANQFGQLKAQNLKYSVTLDELKSSSERRSEAFKL 80

Query: 96   KLATV--------------ETEKKELIDK-------VNGYETQFNELKIKNEG------- 127
            +L  +              E EK +LID+       VN  ++Q  ELK +NE        
Sbjct: 81   QLEKINENTESLRKEKDAFEDEKFKLIDEKANASKEVNLLKSQLTELKQQNEIFRSSKQD 140

Query: 128  ----LNLKVSNLNIELENWKNNSNNFET------EKLNYVXXXXXLSIR-ESEIQRLKQE 176
                LN K+ +L    +  K    N +T      E  N V       +R ++E+QRL QE
Sbjct: 141  VVQLLNEKIGDLEASQDEAKQLLQNTKTLRKQVLELENEVQTFKSNDLRGKAEMQRLTQE 200

Query: 177  VTFLNENKSSLSEQWXXXXXXXXXXXXXXXXXXXXSTIKLEEATTTLKSMEAKVSV---- 232
            +  L  N      QW                    S  +L+ A + L S+ +++ +    
Sbjct: 201  MNLLKSNN-----QWLEKELASKSEEFGSYRQRVNS--ELQTALSELNSIRSELEIERSS 253

Query: 233  ---LSDKNNDLTKKYENSIWEIKNLKDNLLVTKDDMNKEIAMKSKLIDLLQGQLSSTQEE 289
               L  + NDL+++ ++ + E+K+L+D+  + K +  +E+ +K +LIDLL+ Q+ S + E
Sbjct: 254  SQTLKSRANDLSQQLQDKMTELKSLRDSSSIEKQEFTREMTLKQRLIDLLEKQIESFKTE 313

Query: 290  LRQNVELNSKFTKFPDLESQNETLKSDI----------QDLTLKIEELQNENFNLXXXXX 339
            L      N   +    ++++ E +  ++          +   +K+EE  +E   L     
Sbjct: 314  LESAR--NKSVSNSDHVDAEREKIIEELIETKKKLEISESKAVKLEETVDE---LLSTDG 368

Query: 340  XXXXXXXXXXXXXXXXXXLPTLYSKINLLKKQVTQEKLEKKHLQTQIESFIIELENKIPI 399
                              +P L+  I LLKK++ QE+ +K+ LQ Q+E+F++ELE+K+P+
Sbjct: 369  ERGAGNTSKVSLDSKNSIVPKLHGDIGLLKKRLIQERRQKEQLQYQVEAFVLELEHKVPV 428

Query: 400  ISSFQEKNQAXXXXXXXXXXXXXXXXXXXXXIQNKLNNYDSKLLTYQSNIKELIRQRLDL 459
            ++SF+E+ +                       +++L +  SK+  Y++ I  L+RQR DL
Sbjct: 429  LNSFKERTEMLEKELSDVALMLEATSKDKEEKEHELTSVKSKIADYETQIHSLVRQRSDL 488

Query: 460  ANQVKHLLLFVAVKNDSGGPLTREEIEFINKISNNSEDLNGSELTSQHVISERLVTFSNI 519
            A+QV+HLL+ V+V+NDS GPLT EE  FI KI N+SE  +  E  +Q +ISERLV F ++
Sbjct: 489  AHQVQHLLIQVSVRNDSNGPLTPEETNFIKKIINSSE--SPVEQDAQRIISERLVRFESM 546

Query: 520  EELQAKNMELLNSIRSLSENLENIENANSHKEFQNK--TIADAKEAILTLQYHNDILESK 577
             ELQ KNMELLNSIR+L++ LE  E  +  K  + +  T+ +AKEAILTLQ +N  LES+
Sbjct: 547  VELQEKNMELLNSIRNLADKLEAEEKESKSKSKEVESETVKEAKEAILTLQEYNKSLESQ 606

Query: 578  VKVLEAERDSFKLLLNNNVSIDSSIKNDDLSSSTSPETNEKSIEKLQTLIEELKAELKKN 637
            ++++  ERD+FK+L ++     +   N + S +      E+ I++L+  +  L  E  KN
Sbjct: 607  LEIIAKERDAFKILASDK-GTSNGPSNVNSSENRHLVLAEEKIKELENHLSSLTEESAKN 665

Query: 638  KDALESQIASFTADKSNLTISLEKEKSSNTLMAEKISLTESAFDMLKTENKELNKRFENL 697
               L  +I S    +++ +++LEKE+SS  L  ++  L  +  +M K EN EL KRF +L
Sbjct: 666  IKLLNEEIHSLYRAQADTSVNLEKERSSRILAEDRSKLISNTLEMTKMENDELRKRFHSL 725

Query: 698  QNIIIKQESKLGDIINKYITGETEISNLKTQLSIAKSEKDFLVKSQDSLNSELIKTSEEK 757
            Q  I+KQ+SK    I   I+ ++++S L++QL+ ++SE+D L   Q++L  E    SEE+
Sbjct: 726  QENILKQDSKTQQTIESLISCKSQLSALQSQLNNSQSERDLLRSIQENLKKENESLSEER 785

Query: 758  NKLRIMLSQLQSLQNERMTLLDDTQKKFMSKIHELENNNLDLIKNLGSKMTEIQKLSISN 817
            N +RI+++QLQ+LQ ER +LL++TQK F  K ++LE    D ++ L +K  EI     + 
Sbjct: 786  NNMRILITQLQTLQTERESLLEETQKNFQGKTNKLETELSDTLEKLDAKSKEISDYISTK 845

Query: 818  ESQCTWYQNTIDDL-KKINSA---IKTELTSKNSL---ISDLNTKIELLESQSYTIDTNT 870
            +SQ  WYQ   D L +++N++   + ++LT    L   +  LN K+E  E++    +   
Sbjct: 846  DSQEKWYQEKFDRLNEELNNSREKLSSKLTDIQHLELKVESLNNKLEESEARIQAFNALN 905

Query: 871  RCSSSGNDFSQISKDLDITKLHLSEAYTQVEEYKQLYTSTEESLKTLESNFESVKNLMDD 930
               S  +    + ++L+ T++ L++AY+QVE+YK +  S+EES   ++   E  K    +
Sbjct: 906  YSESVESQTETLRQELEKTRIKLADAYSQVEQYKSMADSSEESATAIKDALEQSKAEYTE 965

Query: 931  KISKLLSENETLKASTGEYDKRISELSTDLKNEKNKYSEEIAQLNVQITRLNKFKKDSAD 990
            KI  L  E +  K        +IS L+ +L ++K+++  +I+     +  L   + +  +
Sbjct: 966  KIETLTKERDMFKDQVPILKDQISNLNNELNHQKSQFESQISDYTRNLEDLKAKQSELDN 1025

Query: 991  TASEYEEKISKLQSQLELKAKFADNAQEKYESLLTKDNANLQSIEEFKEQIEKLNQRIVI 1050
              +EYE+KISK+Q  L  +  +A+ AQ+ YE  L K     + I   + + +K       
Sbjct: 1026 MKAEYEQKISKIQEDLNQQTSYANTAQKNYEQELQKHADVSKKISLLRAEAQKYKSETET 1085

Query: 1051 IESDLEKKTSLLSENESLWKKKQDAFISDLEESKKKIDNLTNQNKLYVDQLELLNKDFXX 1110
            + +  E     L ++E  W+K+   +  +L  + ++I++L  Q+K+  DQ++ L+K    
Sbjct: 1086 LRNAAENAKKALEQSELSWEKQSSDYEDELRLAHQRIEDLNAQSKILYDQIDFLSKGKPT 1145

Query: 1111 XXX--XXXXXETKHMFNRLRADRDVLETKLSIAERDSKNNASKLESLRDELANVQMKLIS 1168
                      ET+++   LR ++D+LETKL ++ R+ K    KL+ +  +L   +++L  
Sbjct: 1146 SSEDLMPISTETRNLLTSLRREKDILETKLEVSTREEKVLRQKLKLIESDLEGSRIELSK 1205

Query: 1169 SENKLLRHSDLIENHEKIVSELNQITLFKESNETLRNQVSELNEKNKTLQTKLNEENSKL 1228
             +     +S  +++ E+I+++LNQ+ L +ESN TLRN+  +  E+++ L+ +L+    K+
Sbjct: 1206 LQRAASGNSATLKDQEEIMTQLNQLNLLRESNITLRNEAQKNGERSRELKAELDALYGKV 1265

Query: 1229 SNLSMELKSVKESLGDKETDIMLIKEESNKWRLRAEELSVQIDKVDLDSVSKLSTELDAL 1288
              L  ++  ++ S+ +K+  I L  EE+ +W+ R++++  + +++D +   KL+ ++  L
Sbjct: 1266 QPLESKVTLLQNSVREKDLQISLKNEEAERWKQRSQDILHKYERIDPEEHQKLADKVSEL 1325

Query: 1289 KDDAETKRKQNAELEERFNLLKKQAHERLNASKEIQSSLNKQINELKASNTNIELALSSE 1348
            + + ++K  +N EL+ RF  LK+QAHE+LNA+K  QS+L  Q+N+LKA+   +E  L S+
Sbjct: 1326 QQEIKSKSDENEELDTRFKRLKQQAHEKLNAAKTAQSTLTSQLNDLKATKEKLENDLGSQ 1385

Query: 1349 QKKSMDLQNTLSDNEVKYTQKLSNIESEL-----KALKTENNSFKLSS-----EKEKME- 1397
            +++  +L++ ++D E   + + ++++ +L     K L+TEN   +++S     EKE  E 
Sbjct: 1386 KEEVKNLESKITDIEKNKSSEKNDLQEQLENSQAKLLETENKLEQVTSSSALLEKELNER 1445

Query: 1398 ---LTDEVDSLKKSLVEAQSKLSAIGSDSTDSTMNA--MIXXXXXXXXXXXXXXXXXXXX 1452
               L +++  L++ L +A+++    GS S++   N   ++                    
Sbjct: 1446 IESLMNKIKLLEEDLEKAKTESPNDGSQSSELVENTSKIVENLKIEFEEEKAKMISDKES 1505

Query: 1453 XXXAQWXXXXXXX-XXXXXXXXXXXQSARTDQSIKIEEFQSLKKEWEEEYEKATLERIEE 1511
                Q+                    + + D  + I+E   +KK+WEEEYE+ T +RI E
Sbjct: 1506 ELREQFEEEKASILEAKEQELREQLATQKLDPPVNIDE---IKKKWEEEYEQKTSQRIRE 1562

Query: 1512 AKETLKKRIRLPSETKINRVIEKRKHELENEYEVKLQEKLNEIEANRNSIETIDPGKLRE 1571
            + E LKKRIRLP+E KIN+++EK++ ELE E+E  +Q+K  EI  ++++  +     L +
Sbjct: 1563 SNEQLKKRIRLPTEEKINKIVEKKRLELEAEFEANVQKKAEEIAKSKSASNSNSTEVLEK 1622

Query: 1572 EIK--EEVKRDMLIKFENDLNEAKKKSFEEGKQQSSMKTTLLERKISKLESQL---SEAI 1626
              +  E +K++M  KF+ D+ + KK++FEEGKQQ+SMK+T LE+KI+KLE+Q+     AI
Sbjct: 1623 HKQDLENLKQEMQKKFDEDIAQIKKRAFEEGKQQASMKSTFLEKKIAKLETQIKAHDSAI 1682

Query: 1627 E-NDKQS----DKNPIISDLAQTSTL----ASIQP--PSAKKPA-FSFG---GFNTTNSL 1671
              ND  S    +  P   D+ Q + +    A+I P  P    PA F+FG   G  T+NS 
Sbjct: 1683 PINDNSSATPAESGPTTQDVKQLTPILNNQAAILPGKPLPFNPAHFAFGMPFGQTTSNSF 1742

Query: 1672 NANKGFXXXXXXXXXXXKDTEIVQNPF-SLGVSQTSSSP 1709
                                   QNPF S    QT +SP
Sbjct: 1743 -----------------------QNPFNSQPPEQTPNSP 1758

>AFR286W Chr6 (951485..956761) [5277 bp, 1758 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YKR095W (MLP1) and
            YIL149C (MLP2)
          Length = 1758

 Score =  549 bits (1415), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 460/1552 (29%), Positives = 822/1552 (52%), Gaps = 73/1552 (4%)

Query: 164  SIRE-SEIQRLKQEVTFLNENKSSLSEQWXXXXXXXXXXXXXXXXXXXXSTIKLEEATTT 222
            S+RE +EIQRL+QE+  +  N    + Q                     + ++L      
Sbjct: 181  SLREQAEIQRLQQELALVRSNAEWTTGQLNEKNQQLNSYREKTNGEIQSTQVELNIVKNE 240

Query: 223  LKSMEAKVSVLSDKNNDLTKKYENSIWEIKNLKDNLLVTKDDMNKEIAMKSKLIDLLQGQ 282
            L+   A V+ L  KN +L+K+ ++++ E K L D+L   K +  +E+A+K +LI+LL GQ
Sbjct: 241  LEVEHANVAALRSKNGELSKQLQDALCETKRLTDSLHSEKQEFAREMALKQRLIELLNGQ 300

Query: 283  LSSTQEELRQNVELNSKFTKFPDLESQNETLKSDIQDLTLKIEELQNENFNLX------- 335
            +++ +++L +  ++ +K     D  S+ E L +D+ D   K+E  Q     L        
Sbjct: 301  VATMKQDLEKAYDV-AKNGGMSD--SERERLLNDLFDTKKKLELSQANVSRLEDTIKELL 357

Query: 336  ----XXXXXXXXXXXXXXXXXXXXXXLPTLYSKINLLKKQVTQEKLEKKHLQTQIESFII 391
                                      + T+Y  +  L+KQ+ QE+  K+ LQ Q+ESF++
Sbjct: 358  ETDNVQSGGRNGIEHANVGSPSGGSTISTVYGDLAALRKQLVQERRHKEELQLQVESFVV 417

Query: 392  ELENKIPIISSFQEKNQAXXXXXXXXXXXXXXXXXXXXXIQNKLNNYDSKLLTYQSNIKE 451
            ELE+KIP+++SF+++ +                         ++  Y +K+  Y++ +  
Sbjct: 418  ELEHKIPVLNSFKKRIEELEKQLNGVTLLLEATARERDEKVVQIKQYKNKVGDYETQVGH 477

Query: 452  LIRQRLDLANQVKHLLLFVAVKNDSGGPLTREEIEFINKISNNSEDLNGSELTSQHVISE 511
            L++QR DLA QV+ LL+ ++V++DS GPLT EE+EF+ K+ +  +   GS+  +Q +IS 
Sbjct: 478  LVQQRSDLARQVQCLLIHISVRDDSSGPLTAEEVEFVKKLQSCRDSATGSD--TQAIISN 535

Query: 512  RLVTFSNIEELQAKNMELLNSIRSLSENLENIENANSHK--EFQNKTIADAKEAILTLQY 569
            RLV F ++ ELQ KN ELLN+IR L++ LE  E+    K    +  T+ +AKEAIL+LQ 
Sbjct: 536  RLVEFKSVVELQQKNAELLNAIRQLAQKLEQEEHKTQSKVKSLEQNTVNEAKEAILSLQE 595

Query: 570  HNDILESKVKVLEAERDSFKLLLNNNVSIDSSIKNDDLSSSTSPETNEKSIEKLQTLIEE 629
            H  +LE +++ +  ERDSFKLL++     ++S+ N   +++  P+     I  L+  ++ 
Sbjct: 596  HVQMLEDQLETVTTERDSFKLLVSEGK--NNSLPNPVGAAALQPQEVADGIAHLEARLKA 653

Query: 630  LKAELKKNKDALESQIASFTADKSNLTISLEKEKSSNTLMAEKISLTESAFDMLKTENKE 689
            +  E +++   L  +I +     S L I LE+E+SS  L  EK+SL + + +++K EN +
Sbjct: 654  MAEESEQHAKMLNEEIKALYKSNSQLAIELERERSSRELADEKLSLIQKSLELVKGENAD 713

Query: 690  LNKRFENLQNIIIKQESKLGDIINKYITGETEISNLKTQLSIAKSEKDFLVKSQDSLNSE 749
            L  R  +LQ ++++Q+++    I ++++ ++E+ ++ +QL+I +SE+DFL K +  L  E
Sbjct: 714  LQNRAGSLQALLLEQDTRRQSTIEEFVSAKSELFSISSQLTILQSERDFLRKVEADLKKE 773

Query: 750  LIKTSEEKNKLRIMLSQLQSLQNERMTLLDDTQKKFMSKIHELENNNLDLIKNLGSKMTE 809
                +++ N  ++++ QL++ Q ER +L+++T+K++ ++I EL+       + L  K  E
Sbjct: 774  NESLNKDNNDSQLLILQLKTAQKERDSLIEETRKRYETRIEELDGELSATKQQLERKQRE 833

Query: 810  IQKLSISNESQCTWYQNTIDDLKK-INS---AIKTELTSKNSLISDLNTKIELLESQSYT 865
              +LS S+ +QC W+Q+ +D LK+ + S   A+K + +  ++L + LN+    LE  S  
Sbjct: 834  YDELSSSSSTQCKWFQSKLDSLKEELGSSKLALKAKTSELDALKARLNSSTSKLEPASMD 893

Query: 866  IDTNTRC--SSSGNDFSQISKDLDITKLHLSEAYTQVEEYKQLYTSTEE---SLKTLESN 920
               ++    S   +    +SKDLD     LS AY+++E YK    +TE    S   ++ N
Sbjct: 894  HQQSSLVLESDHASRVQSLSKDLDEANRKLSSAYSEIERYKAASNATERPSLSYNAVQDN 953

Query: 921  FESVKNLMDDKISKLLSENETLKASTGEYDKRISELSTDLKNEKNKYSEEIAQLNVQITR 980
             +  K      IS L +E   L +     + RI  L  +L   +  YS E ++L  +I  
Sbjct: 954  KDGSKQAA---IS-LEAELTKLNSDIAMANDRIKVLEDELNRREATYSTERSELQEKINA 1009

Query: 981  LNKFKKDSADTASEYEEKISKLQSQLELKAKFADNAQEKYESLLTKDNANLQSIEEFKEQ 1040
            L   K+   +  ++Y++KI++LQ+ LE +    + A+ KY++ L K     ++IE  ++ 
Sbjct: 1010 LVTDKQRIEEAKADYQQKITQLQTDLEKQISSTNEAETKYQTALQKQAEISENIESLRKS 1069

Query: 1041 IEKLNQRIVIIESDLEKKTSLLSENESLWKKKQDAFISDLEESKKKIDNLTNQNKLYVDQ 1100
             E     I   +S  E+   +L  NE  W +++    ++L+ + ++I+ L+ QN+L  DQ
Sbjct: 1070 SESYKSEIAKFKSAAEEARKVLERNEQTWDQQKADIEANLDLAHQRIEELSTQNRLLYDQ 1129

Query: 1101 LELLNKDFXXXXXXXX--XXETKHMFNRLRADRDVLETKLSIAERDSKNNASKLESLRDE 1158
            +ELL++              + + +   LR +RD+LETK+ +++R+ K    +LE  + E
Sbjct: 1130 IELLSRSPSSSLEPDTKISSDARELIVTLRRERDILETKIDVSKREEKMLRQRLELTKSE 1189

Query: 1159 LANVQMKLISSENKLLRHSDLIENHEKIVSELNQITLFKESNETLRNQVSELNEKNKTLQ 1218
            L N++ +L  S+  +   +D  +N E++  +LNQ+ L +E N +LRN+  +++E N+ LQ
Sbjct: 1190 LDNLRAQLSESKGLVTEGTDSSQNQEELFEKLNQLNLLREHNMSLRNESEKVSEHNEFLQ 1249

Query: 1219 TKLNEENSKLSNLSMELKSVKESLGDKETDIMLIKEESNKWRLRAEELSVQIDKVDLDSV 1278
             ++     K+  +  ++KS+  +L +KE  + L+KEES++W+ R++++  + +++D +  
Sbjct: 1250 NEILSLQEKVQPMEEQIKSLTATLTEKEQKLALLKEESDRWKQRSQDILHKYERIDPEEY 1309

Query: 1279 SKLSTELDALKDDAETKRKQNAELEERFNLLKKQAHERLNASKEIQSSLNKQINELKASN 1338
             KL++E++ LK + E K  ++ + +ERF  L+KQA+ERL+  K  ++ +  ++    +  
Sbjct: 1310 RKLASEIEVLKAELERKSAESIDSQERFRKLRKQANERLDEFKAAKAKVESELELALSGK 1369

Query: 1339 TNIELALSSEQKKSMDLQNTLS-------DNEVKY-----TQKLSNIESELKALKTENNS 1386
            + +E  LS  ++K   L+  L+       DN V +       KL + E+ +  LK+E   
Sbjct: 1370 SQLEAKLSEAREKITSLETQLTERPASEDDNPVSHELEETKTKLQDAENTINMLKSE--- 1426

Query: 1387 FKLSSEKEKMELTDEVDSLKKSLVEAQSKLSAIGSDSTDST-----MNAMIXXXXXXXXX 1441
            + +S E  K +L    D L K L E   K SA  S  +D +       A++         
Sbjct: 1427 WSISEESFKKQL----DELNKQL-ETIQKNSAPSSGHSDPSSYHEQPTAVLEDFKKQVEE 1481

Query: 1442 XXXXXXXXXXXXXXAQWXXXXXXXXXXXXXXXXXXQSARTDQSIKI--EEFQSLKKEWEE 1499
                          A+                   + + T+ S++   +  ++LKK+WEE
Sbjct: 1482 ERRTLIESHQQELTARLEASRKNFLAEKEKALEELRDSLTNVSVEAASQNLEALKKKWEE 1541

Query: 1500 EYEKATLERIEEAKETLKKRIRLPSETKINRVIEKRKHELENEYEVKLQE-KLNEIEANR 1558
            EYE+ TL+RI EA+E LKKRIRLPSE +IN+VIE+++  LE E+  K+    L  ++ N 
Sbjct: 1542 EYEQQTLQRIREAEEALKKRIRLPSEERINQVIERKQKALEQEFTTKVNATALALLKENP 1601

Query: 1559 NSIETIDPGKLREEIKE--EVKRDMLIKFENDLNEAKKKSFEEGKQQSSMKTTLLERKIS 1616
            +SI +     +++  KE  ++K+D+  KFE  L + KKK+FEEG+QQ  MK  LLE KIS
Sbjct: 1602 DSIASDKADLIKDHQKEIVQLKKDLADKFEGQLVQVKKKAFEEGRQQGIMKVKLLESKIS 1661

Query: 1617 KLESQLSEAIENDKQSDKNPIISDLAQTSTLASIQP--PSAKKPAFSFGGFN 1666
            KLESQ    +  +      P    L  T  LA   P  PS  + A++   F 
Sbjct: 1662 KLESQAKAPLGTNV-----PTKIPLENTQPLAQQVPVKPSPFQLAYAQATFG 1708

>ZYRO0G06600g Chr7 complement(521893..527355) [5463 bp, 1820 aa] {ON}
            some similarities with uniprot|Q02455 Saccharomyces
            cerevisiae YKR095W MLP1 Myosin-like protein associated
            with the nuclear envelope, connects the nuclear pore
            complex with the nuclear interior; involved in the Tel1p
            pathway that controls telomere length; involved in the
            retention of unspliced mRNAs in the nucleus
          Length = 1820

 Score =  537 bits (1384), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 418/1236 (33%), Positives = 696/1236 (56%), Gaps = 63/1236 (5%)

Query: 232  VLSDKNNDLTKKYENSIWEIKNLKDNLLVTKDDMNKEIAMKSKLIDLLQGQLSSTQEEL- 290
            V++ KN +LTK  +  + E+K+L D+L   K +   E++MK KLIDLL+ Q+ S Q EL 
Sbjct: 261  VITTKNEELTKSLQEKLMEMKDLSDSLYREKQEFAHEMSMKQKLIDLLENQVKSLQGELN 320

Query: 291  ----RQNVELNSKFTKFPDLESQNETLKSDIQDL-TLK--IEELQNENFNLXXXXXXXXX 343
                + NVEL +   +     ++NE L   IQ+L TLK   EE + E   L         
Sbjct: 321  ASLDKDNVELLASGER----NTENEKL---IQELITLKENFEESERERLRLEALVQELIP 373

Query: 344  XXXXXXXXXXXXXXLPTLYSK------INLLKKQVTQEKLEKKHLQTQIESFIIELENKI 397
                          + +L +K      + +LKK++ +E+ +K+ LQ Q+ESFI+ELE KI
Sbjct: 374  GDDSQDDINNTSSFI-SLRNKDSSLRDMGILKKELIKERHQKERLQRQVESFIVELEYKI 432

Query: 398  PIISSFQEKNQAXXXXXXXXXXXXXXXXXXXXXIQNKLNNYDSKLLTYQSNIKELIRQRL 457
            P+I+SF+E+                         + +      K+   +S+I  L RQR 
Sbjct: 433  PVINSFKERTSMLEKELNDVALLLDHTSNEKEKREREFEALSKKVKDSESSIHTLTRQRT 492

Query: 458  DLANQVKHLLLFVAVKNDSGGPLTREEIEFINKISNNSEDLNGSELTSQHVISERLVTFS 517
            DLA+QV+ LL+ ++V+ DSGG L+ EE+ FI +I NN  D   SE  SQ VISERLV F+
Sbjct: 493  DLAHQVQFLLMNISVQVDSGGLLSAEEVSFIKRIVNN--DDPNSESDSQRVISERLVEFN 550

Query: 518  NIEELQAKNMELLNSIRSLSENLENIENANSHK--EFQNKTIADAKEAILTLQYHNDILE 575
            NI  LQ KNMELL ++R L+E LE+ E   + K   F+N TI +AKEAI++LQ +N  LE
Sbjct: 551  NIATLQEKNMELLKTVRKLAEKLESEEKDVNKKIQTFENDTIKEAKEAIVSLQDYNANLE 610

Query: 576  SKVKVLEAERDSFKLLLNNNVS-IDSSIKNDDLSSSTSPETNEKSIEKLQTLIEELKAEL 634
            SKV++L  E D+FK + + N S  + S+  +    + +  ++E+ +  L+  +  L  E 
Sbjct: 611  SKVEILTKECDAFKAICSRNGSDQNGSLSANGTQGNRNGSSDEEKLRTLEARLTSLTVES 670

Query: 635  KKNKDALESQIASFTADKSNLTISLEKEKSSNTLMAEKISLTESAFDMLKTENKELNKRF 694
             +N   L ++I      K+ ++I LEKE+SS TL  E++ L +   ++ + EN++L KR 
Sbjct: 671  SQNNKMLNNEIHELYRSKTQISIELEKERSSKTLTEERLKLIQHTLELTRNENQQLVKRS 730

Query: 695  ENLQNIIIKQESKLGDIINKYITGETEISNLKTQLSIAKSEKDFLVKSQDSLNSELIKTS 754
            +NLQ+I  +Q+S+  + +N+ I   ++++ L+T+++  ++EK+ L  S+ +     +K S
Sbjct: 731  QNLQSIFDRQDSRTAETVNELIACNSKLAVLETKVANLETEKELLQSSERTSRENYLKLS 790

Query: 755  EEKNKLRIMLSQLQSLQNERMTLLDDTQKKFMSKIHELENNNLDLIKNLGSKMTEIQKLS 814
            EE+N LRIM+SQLQ+LQ+ER   L + Q  +   +  LE    D    L +K  E + + 
Sbjct: 791  EERNSLRIMVSQLQTLQSEREKFLKEIQTTYKENLDSLEQEKADARARLDAKTKEAEDME 850

Query: 815  ISNESQCTWYQNTIDDLKKINSAIKTELTSKNSLISDLNTKIELLES---------QSYT 865
             S  +Q  WYQ+ +D +   +  +K EL +K  L++DL +++  LE          QSY 
Sbjct: 851  NSKRTQIQWYQDKLDSVVAESQHLKQELQTKTFLVTDLESEVRKLEKQVEESEARIQSYQ 910

Query: 866  IDTNTRCSSSGNDFSQISKDLDITKLHLSEAYTQVEEYKQLYTSTEESLKTLESNFESVK 925
            + + +   +S    S + K+L+ TK++LS+ Y ++++YK L ++TEESL  L  ++ S K
Sbjct: 911  VLSGSEVETSPE--SSLRKELEKTKINLSDTYAEIDQYKNLLSTTEESLSQLTQDYASGK 968

Query: 926  NLMDDKISKLLSENETLKASTGEYDKRISELSTDLK-------NEKNKYSEEIAQLNVQI 978
              +  ++  L +E   L+    + ++ +++L   L+       NEKN   ++IA L  + 
Sbjct: 969  QELQLQVETLQNEKSQLQDVVAKLNESVTKLEESLQDANKAAENEKNTLQKKIATLETE- 1027

Query: 979  TRLNKFKKDSADTASEYEEKISKLQSQLELKAKFADNAQEKYESLLTKDNANLQSIEEFK 1038
                   K S     EY+ +I KLQ  LE +A FA+ AQ  YE  L KD+   ++I E +
Sbjct: 1028 ------SKGSHQLKEEYDAQILKLQRDLEQQASFANRAQRNYEEELQKDSNVSKTISELR 1081

Query: 1039 EQIEKLNQRIVIIESDLEKKTSLLSENESLWKKKQDAFISDLEESKKKIDNLTNQNKLYV 1098
            EQ +K    I  +++  E+   +L +NE  W  +++ +   LE S++ +++L+ QN L  
Sbjct: 1082 EQSQKDRIAITRLKNSEEQVRQVLEQNEKSWSAQKEEYERQLETSRQHLEDLSTQNSLLY 1141

Query: 1099 DQLELLNKDFXXXXXXXXXXETKHMFNRLRADRDVLETKLSIAERDSKNNASKLESLRDE 1158
            DQ+EL +KD           E + +   LR +RD+L TKL++++R+ +     L S+ +E
Sbjct: 1142 DQIELFSKD-NSDGVNGETAEVREILTNLRRERDILGTKLTVSQREEQTLRGSLASVENE 1200

Query: 1159 LANVQMKLISSENKLLRHSDLIENHEKIVSELNQITLFKESNETLRNQVSELNEKNKTLQ 1218
            L   + +L   + ++  HS+LI  HEKI+ +LNQ+ L +ESN TLRN   E N+KN+ LQ
Sbjct: 1201 LDTTKRQLSQFQKEITTHSELIGQHEKIIEQLNQLNLLRESNITLRNAAEEENKKNRELQ 1260

Query: 1219 TKLNEENSKLSNLSMELKSVKESLGDKETDIMLIKEESNKWRLRAEELSVQIDKVDLDSV 1278
             +LN+   ++  L  EL ++  S+ +K+  + L KEE+N+W+ R++E+  + D++D +  
Sbjct: 1261 EELNQLRERILPLESELNTLHTSVLEKDQQLNLYKEEANRWKERSQEILHKHDRIDPEDH 1320

Query: 1279 SKLSTELDALKDDAETKRKQNAELEERFNLLKKQAHERLNASKEIQSSLNKQINELKASN 1338
             +L  ++  L+   +   K+N EL++RFN LKKQAHE+LN+SK  Q++L+ Q+NEL+ + 
Sbjct: 1321 KELKEKVSILETKLDETNKENKELDDRFNRLKKQAHEKLNSSKIAQTTLSNQLNELREAK 1380

Query: 1339 TNIELALSSEQKKSMDLQNTLSDNEVKYTQKLSNIESELK-ALKT-----ENNSFKLSSE 1392
            + +E    +E++K  +LQ  L+ +    T+ + +++ EL  AL+      +N S  L   
Sbjct: 1381 SELEGKFEAEERKVHELQERLNAH-GNDTETVESVQKELSDALEHSRELEQNLSATLQQN 1439

Query: 1393 KE-KMELTDEVDSLKKSL--VEAQSKLSAIGSDSTD 1425
            +E   +L DE+DSLK  L  ++ QS  +A G  S D
Sbjct: 1440 EEITKKLNDEIDSLKLELHSLKEQSAATAKGEISED 1475

 Score =  114 bits (284), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 100/307 (32%), Positives = 151/307 (49%), Gaps = 54/307 (17%)

Query: 1490 FQSLKKEWEEEYEKATLERIEEAKETLKKRIRLPSETKINRVIEKRKHELENEYEVKLQE 1549
            ++ +K++WE E E++ L+RI EA+E LKKRIRLP+E +I +V+EK+K  LE  Y+ KL+E
Sbjct: 1526 YEEIKRQWESEQEESILKRIAEAEENLKKRIRLPTEERIKQVVEKKKAALEELYKKKLEE 1585

Query: 1550 KLNEIEA--NRNSIETIDPGKLREEIKEEVKRDMLIKFENDLNEAKKKSFEEGKQQSSMK 1607
              + +E+    NS           ++K+++++D+  KFE ++   KKK+FEEGKQQ++MK
Sbjct: 1586 SKSSLESSDGNNS-----------DLKKQLEKDLQEKFEAEVQAVKKKAFEEGKQQAAMK 1634

Query: 1608 TTLLERKISKLESQLSEAIEN-DKQSDKN--------PIISDLAQTSTLASIQPP----- 1653
            +TLLERKISKLESQL   +++ DK S +         P   D    +T  S+  P     
Sbjct: 1635 STLLERKISKLESQLHGKVDSPDKSSSETSSVPKPNLPSKIDEKSVTTNQSVPNPLVSGE 1694

Query: 1654 -----SAKKPAFSFGGFNTTNSLNANKGFXXXXXXXXXXXKDTEIVQNPFSLGVSQTSSS 1708
                    KP F+F  F+  N   ++              K T      F+L  +   SS
Sbjct: 1695 KVLKLDPSKPTFNFSSFSGGNPFTSSPQNNDTMGTSAFGFKPT------FTLSNNSNKSS 1748

Query: 1709 PMHFNPFSSSATTSNVFNQNGTSKNIFGNVMAMKPTTPTVEQAIKPLESVTPTETPEVP- 1767
                +  S+    +N F+        F    A  P   +   A+ P    TP E    P 
Sbjct: 1749 GTKIDSSSTENKPANPFSS-------FTETGASSPERESSNTAMTP----TPGEGASTPS 1797

Query: 1768 ----EDD 1770
                EDD
Sbjct: 1798 KRAAEDD 1804

>TDEL0B02190 Chr2 complement(389562..394994) [5433 bp, 1810 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1810

 Score =  516 bits (1330), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 390/1140 (34%), Positives = 637/1140 (55%), Gaps = 24/1140 (2%)

Query: 236  KNNDLTKKYENSIWEIKNLKDNLLVTKDDMNKEIAMKSKLIDLLQGQLSSTQEELRQNVE 295
            KN ++++  +N ++EIK L D L   K + ++E+++K KL+DL   QL S +EELR   E
Sbjct: 261  KNQEISQDLQNKLYEIKKLSDELNTEKQEFSREMSLKQKLLDLQDEQLQSFKEELRLTEE 320

Query: 296  LNSKFTKFPDLES-QNETLKSDIQDLTLKIEELQNENFNLXXXXXXXXXXXXXXXXXXXX 354
             ++  T+  +L+S Q      D+  +  ++EE  +E   L                    
Sbjct: 321  KHNS-TEADNLQSTQQARFMDDLAQVRQQLEESNHERLRLQAVVNEVMGDSEEFDLDSTA 379

Query: 355  XXXLPTLYSKINLLKKQVTQEKLEKKHLQTQIESFIIELENKIPIISSFQEKNQAXXXXX 414
               +P LY  I +LKKQ+ +E+ +K++LQ QIESF++ELE K+P+I+S +E++       
Sbjct: 380  NVSIPKLYGDIGVLKKQLIKERHQKENLQRQIESFVVELEYKVPVINSLKERSYTLEKEL 439

Query: 415  XXXXXXXXXXXXXXXXIQNKLNNYDSKLLTYQSNIKELIRQRLDLANQVKHLLLFVAVKN 474
                               +L +   K+   + N   LIRQR DLA QV+ LL    ++N
Sbjct: 440  SDIALLLEHTSHEKERKTRELESATGKIKQLEINTHTLIRQRSDLARQVQFLLFNGTLQN 499

Query: 475  DSGGPLTREEIEFINKISNNSEDLNGSELTSQHVISERLVTFSNIEELQAKNMELLNSIR 534
            DS GPLT +E+ FI KI  N    N S+  SQ +I+ERLV F +I  LQ +N ELL + R
Sbjct: 500  DSRGPLTADEVAFIKKIIENENPSNESD--SQSIITERLVEFKDIATLQERNTELLKTAR 557

Query: 535  SLSENLENIE-NANSHKE-FQNKTIADAKEAILTLQYHNDILESKVKVLEAERDSFKLLL 592
            +L++ LE  E N+N   +  + KTI +AKEAI+TLQ  N  +ESKV  +E ERD++K +L
Sbjct: 558  TLADRLEEEEKNSNIRIDSLERKTIDEAKEAIITLQERNSEIESKVSTIEKERDAYKAIL 617

Query: 593  NN-NVSIDSSIKNDDLSSSTSPETNEKSIEKLQTLIEELKAELKKNKDALESQIASFTAD 651
            +  + S D+    D +  S   + N++ I+ L+  +  L  E  KN + L  +I +    
Sbjct: 618  SQTSQSFDNLGDADRMKDS---QENQELIKSLEDKLSTLTTETSKNNELLNQEIRNLYQS 674

Query: 652  KSNLTISLEKEKSSNTLMAEKISLTESAFDMLKTENKELNKRFENLQNIIIKQESKLGDI 711
            K+ LTIS EKE+SS TL  +++ L +S  +M K EN EL +R   LQ+I+ KQE++ G+ 
Sbjct: 675  KTQLTISHEKERSSRTLAEDRLKLLQSTLEMTKNENAELIRRSHELQSILSKQEARNGET 734

Query: 712  INKYITGETEISNLKTQLSIAKSEKDFLVKSQDSLNSELIKTSEEKNKLRIMLSQLQSLQ 771
            +NKYI+ ++++S L+ + +   +EK  L  S DSL  E+ K S E+N L +M++QLQ+LQ
Sbjct: 735  VNKYISCQSKLSVLEARAANLDAEKSLLQSSSDSLRREIQKISVERNSLNLMVTQLQTLQ 794

Query: 772  NERMTLLDDTQKKFMSKIHELENNNLDLIKNLGSKMTEIQKLSISNESQCTWYQNTIDDL 831
            +ER  LL ++Q    + I +LE    +L   + SK  EI+    +  +Q  W+Q  ID++
Sbjct: 795  SERENLLKESQASHKAAIAQLEVQTSELKTEISSKDNEIKASEDAKRAQTKWFQEKIDEM 854

Query: 832  KKINSAIKTELTSKNSLIS-------DLNTKIELLESQSYTIDTNTRCSSSGNDFSQISK 884
                  I+ EL +K + ++       DL  KIE  +S+  +  T     +      Q+ K
Sbjct: 855  SSDAGKIRDELATKTATVAQLELEVNDLKKKIEESDSRIASYKTLNDAGNGETTQGQLRK 914

Query: 885  DLDITKLHLSEAYTQVEEYKQLYTSTEESLKTLESNFESVKNLMDDKISKLLSENETLKA 944
            DL+ T + L  AY+Q EE+KQ+ ++ EE+LK L + FE     +     K L+E   L+ 
Sbjct: 915  DLEKTMIELKHAYSQNEEFKQISSTAEETLKNLSNEFEERTEALKSNAEKYLAEKVQLEQ 974

Query: 945  STGEYDKRISELSTDLKNEKNKYSEEIAQLNVQITRLNKFKKDSADTASEYEEKISKLQS 1004
                  K I  L+ +   +KN+  EE  ++  ++  L   +        EY++K+ +LQ 
Sbjct: 975  CVSNLKKNIDFLNNEYALQKNRSEEEKNEILKKLVSLESSEHSLGQVKKEYDQKLYQLQK 1034

Query: 1005 QLELKAKFADNAQEKYESLLTKDNANLQSIEEFKEQIEKLNQRIVIIESDLEKKTSLLSE 1064
             LE +  +A+ AQ+ YE  L K     + I + + +++     I  +++  ++   +L  
Sbjct: 1035 DLEQQTAYANIAQKNYEEELQKHAEVSKIISQLRSEVQSGRSEIQQLKASEQQAKEVLEN 1094

Query: 1065 NESLW---KKKQDAFISDLEESKKKIDNLTNQNKLYVDQLELLNKDFXXXXXXXXXXETK 1121
             E  W   K + DA I DL   K+++DN+++QNKL   Q+ELL+K             ++
Sbjct: 1095 GEKSWYNQKTELDAHIDDL---KRQVDNISSQNKLLFSQVELLSKSEREFENKLLPGSSE 1151

Query: 1122 HMFNRLRADRDVLETKLSIAERDSKNNASKLESLRDELANVQMKLISSENKLLRHSDLIE 1181
             + + LR +RD+LETKL++++R+ K    K  +L DELA  + KL   +     HSD+ +
Sbjct: 1152 LLIS-LRRERDILETKLTVSKREEKLLHQKQVALEDELAEARKKLFKLQENDSNHSDIAK 1210

Query: 1182 NHEKIVSELNQITLFKESNETLRNQVSELNEKNKTLQTKLNEENSKLSNLSMELKSVKES 1241
             HE I+ +LNQ+ L +ESN TLRN V+   EKN  LQ++LN   SK+  L+ EL   ++S
Sbjct: 1211 QHEDIMEQLNQMNLLRESNVTLRNAVNAAQEKNSDLQSELNHLQSKILPLNSELSECRQS 1270

Query: 1242 LGDKETDIMLIKEESNKWRLRAEELSVQIDKVDLDSVSKLSTELDALKDDAETKRKQNAE 1301
            + +K+  I+L+ +E+++W+ R+ ++  + +K+D +   KL  E+  LK + E K K+N +
Sbjct: 1271 IEEKDQRIILLIDEADRWKERSHDILRRHEKIDPEEYRKLEEEISNLKKELEAKSKENTD 1330

Query: 1302 LEERFNLLKKQAHERLNASKEIQSSLNKQINELKASNTNIELALSSEQKKSMDLQNTLSD 1361
            L +RF  LKKQAHE+LNASK  Q++L+ ++NEL+ + T +E  L   Q K ++L+  L++
Sbjct: 1331 LNDRFTRLKKQAHEKLNASKIAQANLSAEVNELQGTKTKMEEILKETQTKVLNLEKLLTE 1390

 Score =  129 bits (324), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 94/252 (37%), Positives = 136/252 (53%), Gaps = 46/252 (18%)

Query: 1492 SLKKEWEEEYEKATLERIEEAKETLKKRIRLPSETKINRVIEKRKHELENEYEVKLQEKL 1551
            SLKK+WEEEYE  + +RI+EA+E LKKRIR+P+E +I +V++KRK ELE E++ +L+E  
Sbjct: 1517 SLKKQWEEEYEAISQQRIQEAEENLKKRIRMPTEERIKKVLDKRKTELEEEFQRRLKE-- 1574

Query: 1552 NEIEANRNSIETIDPGKLREEIKEEVKRDMLIKFENDLNEAKKKSFEEGKQQSSMKTTLL 1611
                 N    E  D  K REE+K++++ +   K++  L   KKK+FEEGKQQ++MK+TLL
Sbjct: 1575 -----NNLQPEGGD-AKEREELKKQLESEFEAKYKEILASTKKKAFEEGKQQAAMKSTLL 1628

Query: 1612 ERKISKLESQLSEAIENDKQSDKN-------PIISDLAQTSTLASIQPPSAK-------K 1657
            ERKISKLESQL+ +  N+   +K        P   D ++T  +A+  P   +       K
Sbjct: 1629 ERKISKLESQLNSS--NNPTPEKAAATSVGLPTKIDESRTENMATGTPAFGEKVLKLSDK 1686

Query: 1658 PAFSFGGFNTTNSLNANKGFXXXXXXXXXXXKDTEIVQNPFSLGVSQTSSSPMHFNPFSS 1717
            PAFSF   + +N                     + +  N    G+  T S    F P SS
Sbjct: 1687 PAFSFQPSSKSNPFT------------------SALPGNNNVFGMKPTFS----FTPGSS 1724

Query: 1718 SATTSNVFNQNG 1729
               +   F   G
Sbjct: 1725 QPESRPTFGSTG 1736

>CAGL0G02497g Chr7 (223375..228717) [5343 bp, 1780 aa] {ON} similar to
            uniprot|Q02455 Saccharomyces cerevisiae YKR095w MLP1
          Length = 1780

 Score =  514 bits (1324), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 476/1579 (30%), Positives = 841/1579 (53%), Gaps = 115/1579 (7%)

Query: 166  RESEIQRLKQEVTFLNENKSSLSEQWXXXXXXXXXXXXXXXXXXXXSTIKLEEATTTLKS 225
            R+SE++R  QE+  L +N+  L ++                     +   +E+  + LK 
Sbjct: 178  RKSELERNAQEILLLRKNQEWLEQELTNKNQHFMFYRKKTDLMVHDAVTNVEKLKSDLKI 237

Query: 226  MEAKVSVLSDKNNDLTKKYENSIWEIKNLKDNLLVTKDDMNKEIAMKSKLIDLLQGQLSS 285
             ++   +LS K ++ T++ +N++ E K+LKD L V K + +KE+++K KLI L + Q+ S
Sbjct: 238  EKSSKEILSKKLDETTEQLQNNLIENKDLKDVLAVEKQEFDKELSIKDKLIKLYENQIKS 297

Query: 286  TQEELRQNVELNSKF-TKFPDLESQNETLKS-------------DIQDLTLKIEELQNEN 331
             +  L+Q      KF T   + E+ +E +KS             D+++  +++E + + +
Sbjct: 298  LESTLQQ------KFKTAEANEENSSEVVKSLKEELSLAERKLQDMEEKCVRLESILDHD 351

Query: 332  FNLXXXXXXXXXXXXXXXXXXXXXXXLPT----------LYSKINLLKKQVTQEKLEKKH 381
             N                        L +          +   I +LK+Q+ QEK +K+ 
Sbjct: 352  SNDVSLQTKGRKRTYSNDSNSNSSDELGSFDDSSISLSRMQGDIKILKRQLVQEKRQKEK 411

Query: 382  LQTQIESFIIELENKIPIISSFQEKNQAXXXXXXXXXXXXXXXXXXXXXIQNKLNNYDSK 441
            LQ Q+ESF+IELE+KIP+I+SFQE+                          N+L +   K
Sbjct: 412  LQNQVESFVIELEHKIPVINSFQERTSVLEKELTDTALLLEHATKENELKTNELQSLKKK 471

Query: 442  LLTYQSNIKELIRQRLDLANQVKHLLLFVAVKNDSGGPLTREEIEFINKISNNSEDLNGS 501
            +    S ++ L+RQR DLA+Q+++LL+ +++ ND+   L  +EI+FI  + +N  D   S
Sbjct: 472  ISDDNSQLEILLRQRTDLAHQLQYLLINISIINDNDHLLNEDEIKFIKNLVSN--DNMAS 529

Query: 502  ELTSQHVISERLVTFSNIEELQAKNMELLNSIRSLSENLENIENANSHKEFQNKTI---- 557
               SQ VISE L+ F +I++LQ KNMEL+ ++R+L++ LE  EN    K   N T+    
Sbjct: 530  TNDSQKVISEHLIKFKDIQQLQEKNMELVKTVRTLAQQLE--ENEEKKKSTSNNTVDEDN 587

Query: 558  ---ADAKEAILTLQYHNDILESKVKVLEAERDSFKLLLN-----NNVSIDSSIKNDDLSS 609
               A+AKEAILTL+  N+ LE  ++++  ERD+FKLL++     N  S +S  K  +L S
Sbjct: 588  EIFAEAKEAILTLEKVNENLEKNLQIVTKERDAFKLLVSEDRERNFKSSNSVHKYHELKS 647

Query: 610  STSPETNEKSIEKLQTLIEELKAELKKNKDALESQIASFTADKSNLTISLEKEKSSNTLM 669
                  NE  ++ L+  + +L  +   +  AL  ++     + S L + +EK +S+ +L 
Sbjct: 648  -----YNETVVKDLENRLTQLTNDSNAHSKALTEELNLLHKEISQLNVQIEKYRSAKSLA 702

Query: 670  AEKISLTESAFDMLKTENKELNKRFENLQNIIIKQESKLGDIINKYITGETEISNLKTQL 729
             E++ +T+++ ++L  EN++L  R   L++ +++Q+ +     + Y+   ++ S+L+T +
Sbjct: 703  EERLKITQNSMELLSKENEQLRIRSSRLEDSLLQQDKETQKTFSSYVEAISKNSSLETSV 762

Query: 730  SIAKSEKDFLVKSQDSLNSELIKTSEEKNKLRIMLSQLQSLQNERMTLLDDTQKKFMSKI 789
               ++E   L   + SL SEL  T+EEK KLRIM++QLQSLQ+ER TLL+  Q  F  +I
Sbjct: 763  RNLETEVTLLKDREISLKSELSNTTEEKTKLRIMVTQLQSLQSERETLLERVQSDFKKRI 822

Query: 790  HELENNNLDLIKNLGSKMTEIQKLSISNESQCTWYQNTIDDLKKINSAIKTELTSKNSLI 849
             E+   N  L K L  ++ EI K+     +Q  WYQ  ID+  +    I+ +L +KN  +
Sbjct: 823  SEVNYINEKLDKQLSERVHEIDKIEKERNAQYEWYQKKIDEASQQQQQIQGQLQTKNDEL 882

Query: 850  SDLNTKIELLESQ-------SYTIDTNTRCSSSGNDFSQISKDLDITKLHLSEAYTQVEE 902
              L+ + + LE +        +T +T  + +S   + + + K+L+ TK+ L++AY+Q+EE
Sbjct: 883  ERLHLQNKTLEKELEGAQIRIHTYETINQNNSENQEENDVIKELEKTKIELADAYSQLEE 942

Query: 903  YKQLYTSTEESLKTLESNFESVKNLMDDKISKLLSEN-------ETLKASTGEYDKRISE 955
            +K L  ++E++LK L ++F +      D I  L  E        E LK         ++ 
Sbjct: 943  FKNLSQNSEDALKELNASFNAKDRDYRDAIKTLTEEKTEIEGRFEILKQQLENIKNELTV 1002

Query: 956  LSTDLKNEKNKYSEEIAQLNVQITRLNKFKKDSADTASEYEEKISKLQSQLELKAKFADN 1015
             S + ++E+ + ++ IA+L      + + KK        +EEK+ KL++ LE +  +A+N
Sbjct: 1003 QSEEAESERKRLTQTIAELQGAAQPIEEVKK-------MFEEKLQKLENDLEEQTVYANN 1055

Query: 1016 AQEKYESLLTKDNANLQSIEEFKEQIEKLNQRIVIIESDLEKKTSLLSENESLWKKKQDA 1075
            AQ+ YE  L +     ++I E +EQ ++L      + ++L+     +S+NE   K ++D 
Sbjct: 1056 AQKNYEQELQRHADVSKTISELREQNQRLKNDTKSLTAELQSLQDQMSQNEKHLKSERDE 1115

Query: 1076 FISDLEESKKKIDNLTNQNKLYVDQLELLNK--DFXXXXXXXXXXETKHMFNRLRADRDV 1133
            +   ++ ++++ID++T QN+L  +Q++LLN+               +  +   LR +RD+
Sbjct: 1116 YRIQIDLAQQRIDDITKQNQLLYNQIDLLNRAESVNENSSDDEANGSTALVLSLRRERDI 1175

Query: 1134 LETKLSIAERDSKNNASKLESLRDELANVQMKLISSENKLLRHSDLIENHEKIVSELNQI 1193
            L+TK+++ E +  +   KL+ +++EL N +      E++   HSDLI N++ I  +L Q+
Sbjct: 1176 LDTKINVIETEKNSLQQKLDDIQNELENTKRSAALLESEYSEHSDLINNYQTIRGDLEQL 1235

Query: 1194 TLFKESNETLRNQVSE-LNEKNKT---LQTKLNEENSKLSNLSMELKSVKESLGDKETDI 1249
             L +ESN TLRN++ + L+EK+K    LQ   NE    L  L   L+S    + +K+  I
Sbjct: 1236 NLLRESNVTLRNELKQALDEKDKIAKDLQICRNE----LLPLQSNLESANNLIKEKDLKI 1291

Query: 1250 MLIKEESNKWRLRAEELSVQIDKVDLDSVSKLSTELDALKDDAETKRKQNAELEERFNLL 1309
                +ES +W+ R EE+  +  KV++D  +KL   L+  K   + K ++  EL +RFN L
Sbjct: 1292 ASANDESQRWKTRLEEMIEKHQKVNVDDYTKLEETLNETKQLLDNKVQETNELNDRFNRL 1351

Query: 1310 KKQAHERLNASKEIQSSLNKQINELKASNTNIELALSSEQKKSMDLQNTLSDNEVKYTQK 1369
            KKQAHE+LN SKE+QSSL +QI+ L +   +I   L  + +++ +L + L++    + +K
Sbjct: 1352 KKQAHEKLNTSKELQSSLQEQISNLISEKDDIRKQLDVKTEENSELLSELNN----FREK 1407

Query: 1370 LSNIESELKAL-----KTENNSFKLSSEKEKMELTD-----EVDSLKKSLVEAQSKLSAI 1419
             +++E+  + L     K+E    KL +E E   L       E++ L+K + + +++L+A 
Sbjct: 1408 QNDLETLREELNKEISKSEELEVKLQNEIESSSLASRNTNKEIEELQKVIDDLKTQLAAN 1467

Query: 1420 GSDSTDSTMNAMIXXXXXXXXXXXXXXXXXXXXXXXAQWXXXXXXXXXXXXXXXXXXQSA 1479
             +D+ + T   +                         ++                  +  
Sbjct: 1468 STDADEQTNRNV-----EAIKREFENQKTKFIAEKTEEFNKRLIEETEKIRNEFQENEKP 1522

Query: 1480 RTDQSIKIEEFQSLKKEWEEEYEKATLERIEEAKETLKKRIRLPSETKINRVIEKRKHEL 1539
             T+ ++ +E   +L+K+WEE+ E+   +RI EA++ LKKRIRLPSE KIN++IEKR+ EL
Sbjct: 1523 DTELNVDVE---ALRKQWEEDSEELIQKRIAEAEDNLKKRIRLPSEEKINKIIEKRRSEL 1579

Query: 1540 ENEYEVKLQEKLNEIEANRNSIETIDPGKLREEIKEEVKRDMLIKFENDLNEAKKKSFEE 1599
            E+E++ K+++K  ++  N +S       +   E+KE +++++  +FE++L  A+KK+FEE
Sbjct: 1580 ESEFDQKIRDKARDLLMNDHS------NEFNNELKEALEKELKERFEDELQAARKKAFEE 1633

Query: 1600 GKQQSSMKTTLLERKISKLESQLSEAIENDKQS-DKNPIISDLAQTSTLASIQPPSAKKP 1658
            GKQQ++MKTTLLERKI KLESQ+ E  ++ +++ D  P   +   T ++  I P +    
Sbjct: 1634 GKQQATMKTTLLERKIQKLESQIQEKEKDSEETQDVKP---EENSTPSVKKI-PETLNSS 1689

Query: 1659 AFSFGGFNTTNSLNANKGF 1677
              SFG  N    L  +  F
Sbjct: 1690 DTSFGNSNNVKVLKPSSPF 1708

>Smik_11.358 Chr11 (609897..615533) [5637 bp, 1878 aa] {ON} YKR095W
            (REAL)
          Length = 1878

 Score =  490 bits (1261), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 390/1134 (34%), Positives = 629/1134 (55%), Gaps = 22/1134 (1%)

Query: 232  VLSDKNNDLTKKYENSIWEIKNLKDNLLVTKDDMNKEIAMKSKLIDLLQGQLSSTQEELR 291
            VL+ KN++L+K  +  + EIK+L D L   K + + EI +K +L+DLL+ QL++ +EEL 
Sbjct: 259  VLTQKNDELSKSLQEKLLEIKSLSDCLSSEKQEFSTEINLKQRLVDLLESQLNAVKEELD 318

Query: 292  QNVELNSKFTKFPDLESQNETLKSDIQDLTLKIEELQNENFNLXXXXXXXXXXXXXXXXX 351
                L +       + S+ E L  ++Q    ++ + ++E   L                 
Sbjct: 319  STRGLETSNDSKKHM-SEKEDLVKELQLTKEELAQCKSECIRLSSIIGETDEESGSSTSR 377

Query: 352  XXXXXXLPTLYSKINLLKKQVTQEKLEKKHLQTQIESFIIELENKIPIISSFQEKNQAXX 411
                  L         LKKQ+ +EK  K+HLQ QIESFI+ELE+K+PII+SF+E+     
Sbjct: 378  SSSDFIL---------LKKQLIKEKRAKEHLQNQIESFILELEHKVPIINSFKERTDTLE 428

Query: 412  XXXXXXXXXXXXXXXXXXXIQNKLNNYDSKLLTYQSNIKELIRQRLDLANQVKHLLLFVA 471
                                  +L+    KL   +++I+ LI+QRLDL  QV++LL+  +
Sbjct: 429  NELNNAALLLEHTSNEKNAKIRELSAKSEKLKQCENDIQTLIKQRLDLCRQVQYLLITNS 488

Query: 472  VKNDSGGPLTREEIEFINKISNNSEDLNGSELTSQHVISERLVTFSNIEELQAKNMELLN 531
            V  DS GPL +EEI FI  I  N  D   +E  SQ +++ERLV F +I ELQ KN ELL 
Sbjct: 489  VSKDSKGPLRKEEIMFIQNILQNDSD-TATETDSQKIVTERLVEFRSIIELQEKNTELLK 547

Query: 532  SIRSLSENLENIENAN--SHKEFQNKTIADAKEAILTLQYHNDILESKVKVLEAERDSFK 589
             +R+L++ LE+ EN +  S ++ +++TI +AKEAILTL+   + LESKV+ LE E ++ K
Sbjct: 548  IVRNLADRLESNENESKQSLQKIESETINEAKEAILTLKAEKEQLESKVEELEKECENSK 607

Query: 590  LLLNNNVSIDSSIKNDDLSSSTSPETN-EKSIEKLQTLIEELKAELKKNKDALESQIASF 648
             LL+N    ++S  N  +      + N E  I+ LQ+ I ++  E  +N   L  +I   
Sbjct: 608  ALLSNE---ETSHLNSTIQQLNETKRNLECQIQDLQSNISQITRESTENMSLLNKEIQDL 664

Query: 649  TADKSNLTISLEKEKSSNTLMAEKISLTESAFDMLKTENKELNKRFENLQNIIIKQESKL 708
               KS+++I L KEKSS  L  E+  L  +  D+ K EN +L KRF+ LQ+ I+KQ+SK 
Sbjct: 665  YDSKSDISIKLGKEKSSRILAEERFKLLSNTLDLTKAENDQLRKRFDCLQSTILKQDSKT 724

Query: 709  GDIINKYITGETEISNLKTQLSIAKSEKDFLVKSQDSLNSELIKTSEEKNKLRIMLSQLQ 768
             + +N+YI+ +++++  +T+L   K E+   + S+ +L  E+ K S EK  LRIM++QLQ
Sbjct: 725  QETLNEYISCKSKLNICETELYNLKEEQKLKIDSEQNLKQEMQKLSSEKTGLRIMVTQLQ 784

Query: 769  SLQNERMTLLDDTQKKFMSKIHELENNNLDLIKNLGSKMTEIQKLSISNESQCTWYQNTI 828
            +LQ ER  LLD+T+K + +KI ELE+ + +L      K   I++L   N S   WYQN I
Sbjct: 785  TLQKERENLLDETRKSYQNKIDELEHAHNELKGEASHKDQRIKQLEEDNNSSIEWYQNKI 844

Query: 829  DDLKKINSAIKTELTSKNSLISDLNTKIELLESQ----SYTIDTNTRCSSSGNDFSQISK 884
            + LKK N +I   +  K + I  L  K++ LE +       + T      + ND S + K
Sbjct: 845  EVLKKDNESIICSMNDKQAEIEKLQHKVKSLEKEIDENKIRLHTYNVIDGTINDDS-LRK 903

Query: 885  DLDITKLHLSEAYTQVEEYKQLYTSTEESLKTLESNFESVKNLMDDKISKLLSENETLKA 944
            +L+ +K+ L++AY+Q++EYK+LY +  +SLK + S FE       ++I  L +E  +L+ 
Sbjct: 904  ELEKSKISLTDAYSQIQEYKELYETNAKSLKQMHSKFEESSKDFSNRIKNLTNEKSSLEE 963

Query: 945  STGEYDKRISELSTDLKNEKNKYSEEIAQLNVQITRLNKFKKDSADTASEYEEKISKLQS 1004
                  ++I  L+ +L  +     EE A+   +I+ L    K+     SEYE K+SK+Q 
Sbjct: 964  KISLLKEQIFNLNNELDLQNKGMKEEKAEFRKKISILQNNNKEVEAVKSEYESKLSKIQK 1023

Query: 1005 QLELKAKFADNAQEKYESLLTKDNANLQSIEEFKEQIEKLNQRIVIIESDLEKKTSLLSE 1064
             L+ +  +A+ AQ  YE  L K     ++I E +EQ+     ++  +     +  S L E
Sbjct: 1024 DLDQQTIYANTAQNNYEQELQKHADVSKTISELREQLHTYRVQVNTLTLSRNQLESTLKE 1083

Query: 1065 NESLWKKKQDAFISDLEESKKKIDNLTNQNKLYVDQLELLNKDFXXXXXXXXXXETKHMF 1124
            NE  W  ++ A I  LE S  +I++LT+QNKL  DQ+EL                   + 
Sbjct: 1084 NERSWTSQRKALIEQLESSNSRIEDLTSQNKLLYDQIELYTTADKGVTDTNDKPALNSIL 1143

Query: 1125 NRLRADRDVLETKLSIAERDSKNNASKLESLRDELANVQMKLISSENKLLRHSDLIENHE 1184
              LR +RD+L+TK+++AERD+K    K+  +  EL   + KL +S  +  +   +I+ HE
Sbjct: 1144 LSLRRERDILDTKVTVAERDAKMLRQKISLMDIELQEARTKLDNSRLEEEKRPTIIQQHE 1203

Query: 1185 KIVSELNQITLFKESNETLRNQVSELNEKNKTLQTKLNEENSKLSNLSMELKSVKESLGD 1244
             I+ +LNQ+ L +ESN TLRN++   NE+ + LQ++L++    ++ +  EL ++K S+ +
Sbjct: 1204 DIMEKLNQLNLLRESNITLRNELENNNEEKRVLQSELDKLKQDIAPIESELAALKYSMQE 1263

Query: 1245 KETDIMLIKEESNKWRLRAEELSVQIDKVDLDSVSKLSTELDALKDDAETKRKQNAELEE 1304
            KE ++ L KEE ++W+ R++++  +  ++      KL  E+D+LK   + K +Q AE EE
Sbjct: 1264 KEQELRLTKEEVHRWKKRSQDILEKHRQMSSSDYEKLEHEIDSLKVKLDEKTRQGAEAEE 1323

Query: 1305 RFNLLKKQAHERLNASKEIQSSLNKQINELKASNTNIELALSSEQKKSMDLQNT 1358
            RFN L++QA ERL  SK    +L +Q+N+LK +   +E +L     K  +L+N 
Sbjct: 1324 RFNRLRRQAQERLKTSKLSLDTLTEQVNDLKNAKIKLEKSLDDANTKIEELENA 1377

 Score =  108 bits (269), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 68/168 (40%), Positives = 104/168 (61%), Gaps = 39/168 (23%)

Query: 1493 LKKEWEEEYEKATLERIEEAKETLKKRIRLPSETKINRVIEKRKHELENEY--------- 1543
            LK +W+ E+E+  + RI EA+E LKKRIRLP+E KI+++IE+++ +LE E+         
Sbjct: 1501 LKIKWKAEHEEEVVNRIREAEEALKKRIRLPTEEKISKIIERKREDLEKEFDEKVEERIK 1560

Query: 1544 ----------------EVKLQEKLNEIE----------ANRNSIETIDPGKLREEIKEEV 1577
                            E+++QEK  E+E          ++ NSI   +  +LR EI+ ++
Sbjct: 1561 LLSQSGQMDVTFQKQFEIRIQEKQKELEDKYNEKLKELSHSNSISIDERDQLRAEIETKM 1620

Query: 1578 KRDMLIKFENDLNEAKKKSFEEGKQQSSMKTTLLERKISKLESQLSEA 1625
            ++++    +N+L   KKKSFEEGKQQ+ MKTTLLERK++K+ESQLSE 
Sbjct: 1621 RKEL----DNELQHIKKKSFEEGKQQAMMKTTLLERKLAKMESQLSET 1664

>Suva_11.331 Chr11 (604552..610248) [5697 bp, 1898 aa] {ON} YKR095W
            (REAL)
          Length = 1898

 Score =  482 bits (1240), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 388/1133 (34%), Positives = 626/1133 (55%), Gaps = 41/1133 (3%)

Query: 232  VLSDKNNDLTKKYENSIWEIKNLKDNLLVTKDDMNKEIAMKSKLIDLLQGQLSSTQEELR 291
            VL  KNN+L+K  +  + +IK L D+    K D + EI +K +LIDLL+ QL++ +EEL 
Sbjct: 259  VLRQKNNELSKDLQEKLLQIKTLSDSSNSEKRDFSAEITLKQRLIDLLESQLNAVKEELN 318

Query: 292  QNVELNSKFTKFPD---LESQNETLKSDIQDLTLKIEELQNENFNLXXXXXXXXXXXXXX 348
               E N       D   L S+NE L  D+Q    K+ + +NE   L              
Sbjct: 319  NTRESNYSDVNSDDSKQLISENEKLLKDLQLTKHKLVQCENECLRLSSITEEAGKED--- 375

Query: 349  XXXXXXXXXLPTLYSKIN----LLKKQVTQEKLEKKHLQTQIESFIIELENKIPIISSFQ 404
                        L SK N    LLKKQ+ +EK  K+HLQ QIESFI+ELE+K+PII+SF+
Sbjct: 376  ----------GILTSKSNGDFILLKKQLIKEKRAKEHLQNQIESFIVELEHKVPIINSFK 425

Query: 405  EKNQAXXXXXXXXXXXXXXXXXXXXXIQNKLNNYDSKLLTYQSNIKELIRQRLDLANQVK 464
            E+                           +L   + KL  Y+  I  L +QRLDL  Q++
Sbjct: 426  ERTDTLENELNNAALLLEHTSNEKNAKIKELKVKNEKLAEYKDEIHILSKQRLDLCRQIQ 485

Query: 465  HLLLFVAVKNDSGGPLTREEIEFINKISNNSEDLNGSELTSQHVISERLVTFSNIEELQA 524
            +LL+  +V NDS GPL +EEI+FI  I  N +D   +E  SQ +++ERLV F +I +LQ 
Sbjct: 486  YLLVTNSVSNDSKGPLRKEEIKFIQNILQN-DDSATTESDSQKIVTERLVEFRDIIQLQE 544

Query: 525  KNMELLNSIRSLSENLENIENA--NSHKEFQNKTIADAKEAILTLQYHNDILESKVKVLE 582
            KN ELL   R+L++ LE+ EN   N  K  +N+TI +AKEAILTLQ     LESK+  LE
Sbjct: 545  KNSELLRVTRNLADKLESNENKSKNYLKNIENETINEAKEAILTLQSQKVQLESKIHELE 604

Query: 583  AERDSFKLLLNNNVSIDSSIKNDDLSSSTSPETN-EKSIEKLQTLIEELKAELKKNKDAL 641
             ER+ FK   N  +  ++S  N  +   T  +   E   + LQ  I ++  E  +N   L
Sbjct: 605  KEREKFK---NWTMDQETSPNNSVIQQLTETKRELESQTQDLQARISQVTRESTENMSLL 661

Query: 642  ESQIASFTADKSNLTISLEKEKSSNTLMAEKISLTESAFDMLKTENKELNKRFENLQNII 701
              ++      KS+L+I L +EKSS  L  E+  L  +  D+ K EN +L KR  NLQN I
Sbjct: 662  NKELQDLYDSKSSLSIELGREKSSRILAEERFKLLSNTLDLAKAENDQLRKRSINLQNAI 721

Query: 702  IKQESKLGDIINKYITGETEISNLKTQLSIAKSEKDFLVKSQDSLNSELIKTSEEKNKLR 761
             KQ+SK  + +N Y++ ++++S ++T+LS  K E+   ++ + +L  EL + S EK  L 
Sbjct: 722  SKQDSKTQETLNDYVSCKSKLSAIETELSNLKLERTLKIELEKNLKQELSELSSEKTSLH 781

Query: 762  IMLSQLQSLQNERMTLLDDTQKKFMSKIHELENNNLDLIKNLGSKMTEIQKLSISNESQC 821
            IM++QLQ+LQ ER  LLD+T+K   +KI  L+N   +L      K   I++L   N+S+ 
Sbjct: 782  IMVTQLQTLQKERENLLDETKKSCQNKIDALQNAQNELKTEAIRKDQYIKQLEEDNDSKI 841

Query: 822  TWYQNTIDDLKKINSAIKTELTSKNSLISDLNTKIELLESQ----SYTIDTNTRCSSSGN 877
             WYQN I+ L+K + ++ + L  K   +     +I+ LE +       + T      S N
Sbjct: 842  EWYQNKIETLRKDHESVMSSLNEKQIEVERFQYEIKSLEKEIEENKIRLHTYNVLDESIN 901

Query: 878  DFSQISKDLDITKLHLSEAYTQVEEYKQLYTSTEESLKTLESNFESVKNLMDDKISKLLS 937
            D S + ++L+ +K++L++AY+Q++EYK+LY +T++SL+ + S  +       ++I  L  
Sbjct: 902  DDS-LRRELEKSKINLTDAYSQIQEYKKLYETTDKSLQEMSSQLDESNKAFSNQIQNLTD 960

Query: 938  ENETLKASTGEYDKRISELSTDLKNEKNKYSEEIAQLNVQITRLNKFKKDSADTASEYEE 997
            E  +L+       +++S L+ +L  +     +E A+   +I+ L    K+     +EYE 
Sbjct: 961  EKTSLEDKVSLLREQMSNLNNELDLQNQAMEKEKAEFKKKISILQNNNKEIEAVKTEYES 1020

Query: 998  KISKLQSQLELKAKFADNAQEKYESLLTKDNANLQSIEEFKEQIEKLNQRIVIIESDLEK 1057
            K+SK+Q  L+ +  +A+ AQ  YE  L K     ++I E +EQ+     ++  +     +
Sbjct: 1021 KLSKIQKDLDQQTIYANTAQNNYEQELQKHADVSKTISELREQLHTYKGQVETLNLARGQ 1080

Query: 1058 KTSLLSENESLWKKKQDAFISDLEESKKKIDNLTNQNKLYVDQLELLNKDFXXXXXXXXX 1117
                L ENE+ W  ++++ +  L+ S  +I++L++QNKL  DQ+EL    +         
Sbjct: 1081 FEKALKENETNWNSQKESLLEQLDLSNSRIEDLSSQNKLLYDQIEL----YTTTGNKPTD 1136

Query: 1118 XETKHMFNR-----LRADRDVLETKLSIAERDSKNNASKLESLRDELANVQMKLISSENK 1172
             ++  + N      LR +RD+L+TK+++AERD+K    K+  +  EL   + KL +S+ +
Sbjct: 1137 AKSGSVLNNDILITLRRERDILDTKVAVAERDAKMLRQKISLIDVELQEARTKLCNSKVE 1196

Query: 1173 LLRHSDLIENHEKIVSELNQITLFKESNETLRNQVSELNEKNKTLQTKLNEENSKLSNLS 1232
              + S +I+ H++++ +LNQ+ L +ESN TLRN++   N KNK LQ++L      ++ + 
Sbjct: 1197 NEKRSFIIQQHDEVMEKLNQLNLLRESNTTLRNELDSSNSKNKELQSELERLRGNIAPIE 1256

Query: 1233 MELKSVKESLGDKETDIMLIKEESNKWRLRAEELSVQIDKVDLDSVSKLSTELDALKDDA 1292
             EL ++K S+ +KE +I L KEE ++W+ R++++  +  ++      KL TE+++LK   
Sbjct: 1257 SELAALKFSIQEKEQEIRLTKEEVHRWKKRSQDIMEKHQQLSSTDYEKLETEIESLKAQL 1316

Query: 1293 ETKRKQNAELEERFNLLKKQAHERLNASKEIQSSLNKQINELKASNTNIELAL 1345
            E K +Q A+ EE+FN L++QA E+L ASK  Q S  +Q+NELK +   +E +L
Sbjct: 1317 EDKTQQGADSEEKFNRLRRQAQEKLKASKLSQDSFIEQLNELKDAKLALEKSL 1369

 Score =  108 bits (269), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 92/284 (32%), Positives = 133/284 (46%), Gaps = 76/284 (26%)

Query: 1493 LKKEWEEEYEKATLERIEEAKETLKKRIRLPSETKINRVIEKRKH--------------- 1537
            +KK+WE E+ +   ++I EA+E LKKRIRLP+E KI+++IE++K                
Sbjct: 1512 IKKQWEAEHNEEVSKKIREAEEALKKRIRLPTEEKISKIIERKKEDLEKEFDEKVEERLK 1571

Query: 1538 -------------------------ELENEYEVKLQEKLNEIEANRNSIETIDPGKLREE 1572
                                     ELENEY  KLQEKL E+ ++ + I + D  KLR +
Sbjct: 1572 SISQSGKMEDIFQKQLESRIQEKQKELENEYNKKLQEKLRELPSS-DIISSDDKDKLRAD 1630

Query: 1573 IKEEVKRDMLIKFENDLNEAKKKSFEEGKQQSSMKTTLLERKISKLESQLSEAIENDKQS 1632
            I+ +++ +    F ++L   KKKSFEEGKQQ+ MKTTLLERK++K+ESQLSE  ++    
Sbjct: 1631 IEAQLREE----FNHELQTIKKKSFEEGKQQAMMKTTLLERKLAKMESQLSETKQSVDSP 1686

Query: 1633 DK------NPII---------SDLAQTSTLASIQPPSAKKPAFSFGGFNTTNSLNANKGF 1677
             K      NP++         S+      L+  +       + S GGFN   S + NK  
Sbjct: 1687 PKHLSKMPNPLLGLPRKIEENSNPPYNPLLSGEKLLKLNSKSSSSGGFNPFTSPSPNKPL 1746

Query: 1678 XXXXXXXXXXXKDTEIVQNPFSLGVSQTSSSPMHFNP-FSSSAT 1720
                        +TE                P H  P F+  AT
Sbjct: 1747 QGDEAEREPSSNETE---------------PPTHLAPSFNIPAT 1775

>KLTH0E01056g Chr5 complement(99471..104786) [5316 bp, 1771 aa] {ON}
            similar to uniprot|Q02455 Saccharomyces cerevisiae
            YKR095W MLP1 Myosin-like protein associated with the
            nuclear envelope, connects the nuclear pore complex with
            the nuclear interior; involved in the Tel1p pathway that
            controls telomere length; involved in the retention of
            unspliced mRNAs in the nucleus
          Length = 1771

 Score =  467 bits (1202), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 378/1237 (30%), Positives = 654/1237 (52%), Gaps = 51/1237 (4%)

Query: 166  RESEIQRLKQEVTFLNENKSSLSEQWXXXXXXXXXXXXXXXXXXXXSTIKLEEATTTLKS 225
            R++E+ RL QE++    N   L  Q                      T KLE     L++
Sbjct: 188  RKAELHRLSQELSLCRSNSEWLESQLGQKNAEFNAYRHTTQSQLAALTQKLETLEQELQA 247

Query: 226  MEAKVSVLSDKNNDLTKKYENSIWEIKNLKDNLLVTKDDMNKEIAMKSKLIDLLQGQLSS 285
                   L + N  +T   E  +  +K L DNL   K +  +E+++K +L+DLL+GQ+ S
Sbjct: 248  STRTNKSLREHNARITNDLETQLRNVKKLTDNLNSEKQEFTREMSLKERLVDLLEGQVQS 307

Query: 286  TQEELRQNVELNSKFTKFPDLESQNETLKSDIQDLTLKIEELQNENFNLXXXXXXXX--- 342
                L+ ++EL S   +  D    N  L +  ++L  K ++L+   F +           
Sbjct: 308  ----LKSDLELRSTAGEGDDGSFSN-PLNALSEELAQKTQQLEESEFKVQKLEQTVQDLV 362

Query: 343  ---XXXXXXXXXXXXXXXLPTLYSKINLLKKQVTQEKLEKKHLQTQIESFIIELENKIPI 399
                              +  LY  I+LLK+QV  EK +K+HLQ Q+E+F++ELE+K+P+
Sbjct: 363  STDKESRLKSSAHEYPASVTDLYGDISLLKRQVIHEKRQKEHLQNQVEAFVVELESKVPM 422

Query: 400  ISSFQEKNQAXXXXXXXXXXXXXXXXXXXXXIQNKLNNYDSKLLTYQSNIKELIRQRLDL 459
            +SSF+++N                       +   L    +++  ++  I EL RQR DL
Sbjct: 423  LSSFKDRNDMLEEQLAETAYMLESISKDKESVALDLRRTKAQIHDFEIQISELTRQRSDL 482

Query: 460  ANQVKHLLLFVAVKNDSGGPLTREEIEFINKISNNSEDLNGSELTSQHVISERLVTFSNI 519
            A QV++LL+  +V++DS GPLT EEI F+ +I     DL+  E  +Q VISERLV F +I
Sbjct: 483  ARQVQYLLIQASVRSDSKGPLTTEEIAFVRRILEQG-DLS-LERDTQKVISERLVEFRDI 540

Query: 520  EELQAKNMELLNSIRSLSENLENIENAN--SHKEFQNKTIADAKEAILTLQYHNDILESK 577
             ELQ+KN +LL +IR+L++ LE+ E  +    K  +N  I +AKEAI+TLQ H   LES+
Sbjct: 541  VELQSKNSDLLRTIRNLADKLESEEEQSKMRSKTVENDAIREAKEAIITLQEHAQELESR 600

Query: 578  VKVLEAERDSFKLLL----NNNVSIDSSIKNDDLSSSTSPETNEKSIEKLQTLIEELKAE 633
            ++VL  ERD++K +     N N   + ++ N     S   +  E+S      L+ E + E
Sbjct: 601  IEVLTKERDAYKAIQPSTNNGNKITEHALANSKGKMSARVDDLERS------LVTE-REE 653

Query: 634  LKKNKDALESQIASFTADKSNLTISLEKEKSSNTLMAEKISLTESAFDMLKTENKELNKR 693
             +KN   L S+I      K+ L I +EKE++S  L  E++ +++ +  + K EN+ELNKR
Sbjct: 654  AEKNMKMLNSEIQELLRQKTKLAIEIEKERTSKCLAEERLKVSQGSLKLTKQENEELNKR 713

Query: 694  FENLQNIIIKQESKLGDIINKYITGETEISNLKTQL--SIAKSEKDFLVKSQDSLNSELI 751
            +  +Q+ ++KQ++K  + ++  I  +++++ L+++L  S+AK E    + S    N+E I
Sbjct: 714  YHIIQDNLLKQDTKTQETLSCLIECQSKLATLESELKSSVAKIES---LSSCQKKNTESI 770

Query: 752  -KTSEEKNKLRIMLSQLQSLQNERMTLLDDTQKKFMSKIHELENNNLDLIKNLGSKMTEI 810
             + + E+N L I+++QLQ+LQ ER  LL +T+K +  K+  LE     L   L  K  E 
Sbjct: 771  EQLTAERNNLTILVTQLQTLQGERDKLLAETEKSYKEKVDALEVEASQLRTQLSRKDEEF 830

Query: 811  QKLSISNESQCTWYQNTIDDLKKINSAIKTELTSKNSLISDLNTKIELLESQSYTIDTNT 870
                 +N+S+  WYQ  ID L +    + ++L S+     DL ++ +LLE +   ++T  
Sbjct: 831  NDFIQTNDSRSQWYQEKIDSLNETLKVVTSQLESQAQTTRDLESQKKLLEGRLKEVETKA 890

Query: 871  RCSSSGNDFSQI-------SKDLDITKLHLSEAYTQVEEYKQLYTSTEESLKTLESNFES 923
            +     N    +         +L+ +K+ L +AY+Q+EE++  Y S EE+L  + + FE 
Sbjct: 891  QSYDVLNQTDDVLAQTEALRMELEKSKIKLQDAYSQIEEHRSRYKSAEEALSAITNAFER 950

Query: 924  VKNLMDDKISKLLSENETLKASTGEYDKRISELSTDLKNEKNKYSEEIAQLNVQITRLNK 983
             KN        +  + + L         +IS L+ +L ++K ++  E  +L  Q+  L  
Sbjct: 951  FKNEHSKDFGNMKKKEDELVGQVEALKHQISNLNNELGHQKKQFDSEKNELENQLVSLQS 1010

Query: 984  FKKDSADTASEYEEKISKLQSQLELKAKFADNAQEKYESLLTKDNANLQSIEEFKEQIEK 1043
             ++        YE+++ KL   L  +A FA+ AQE YE  L +     ++I + +E+ +K
Sbjct: 1011 TQETMNSMKEHYEQQLGKLTQDLNQQAAFANKAQENYEQELQRHADVSKTISQLREESQK 1070

Query: 1044 LNQRIVIIESDLEKKTSLLSENESLWKKKQDAFISDLEESKKKIDNLTNQNKLYVDQLEL 1103
               +  +++S +E+    L E++  W  +++ + + L    ++I++LT QN L +DQL+L
Sbjct: 1071 YKNQASVLQSSIEQLEKTLDESDGKWLNQKEEYEAQLRSLNQRIEDLTVQNGLLLDQLDL 1130

Query: 1104 LNKDFXXXXXXXXXXE-TKHMFNRLRADRDVLETKLSIAERDSKNNASKLESLRDELANV 1162
              KD           E  + +   LR +RD+L+TKL +++R    +  KLE++  EL+  
Sbjct: 1131 EAKDPNSELGQSEPQEKVRELITSLRRERDILQTKLEVSKRSETVSLRKLEAIEQELSFA 1190

Query: 1163 QMKLISSENKLLRHSDLIENHEKIVSELNQITLFKESNETLRNQVSELNEKNKTLQTKLN 1222
            + +L S +    ++S + + H K++ +LNQ+ L +ESN TLR++V +  ++ + L+ +++
Sbjct: 1191 KEELSSLQALSSQNSIMADEHNKLLEQLNQLNLLRESNITLRSEVQKKTQRCQELEGQID 1250

Query: 1223 EENSKLSNLSMELKSVKESLGDKETDIMLIKEESNKWRLRAEELSVQIDKVDLDSVSKLS 1282
                 L  L  EL S+K S+  K++ I LI EE+N+W+ R++++  + +++D +   KL 
Sbjct: 1251 NLQQSLQPLESELASLKRSVRAKDSQISLISEETNRWKQRSQDILSKFERIDPEEHKKLG 1310

Query: 1283 TELDALKDDAETKRKQNAELEERFNLLKKQAHERLNASKEIQSSLNKQINELKASNTNIE 1342
             EL   K +   K  QN+ELE+RF  LKKQA ERL+A+K +Q++L+ ++ + + + +N+E
Sbjct: 1311 EELSQAKAELAAKADQNSELEDRFQRLKKQARERLDAAKAVQNNLSVELAQAREAQSNME 1370

Query: 1343 LALSSEQKKSMDLQNTLSDNEVKYTQKLSNIESELKA 1379
            L L  EQ  +  LQ +           L  +ESE KA
Sbjct: 1371 LQLRKEQDVNKALQES-----------LQRVESEAKA 1396

 Score =  122 bits (307), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 69/158 (43%), Positives = 110/158 (69%), Gaps = 15/158 (9%)

Query: 1489 EFQSLKKEWEEEYEKATLERIEEAKETLKKRIRLPSETKINRVIEKRKHELENEYEVKLQ 1548
            + ++LKK+WEE+YE+ T++RIEE+ E L+KRIRLP+E KIN+++E RK ELE E+E KLQ
Sbjct: 1525 DIETLKKQWEEDYEQKTIKRIEESNEILRKRIRLPTEEKINKIVETRKSELEQEFEAKLQ 1584

Query: 1549 EKLNEIEANRNSIETIDPGKLREEIK------EEVKRDMLIKFENDLNEAKKKSFEEGKQ 1602
            ++ +E+ AN    E   P    E +K      E++K D+  + + ++ + +KK+F+EGKQ
Sbjct: 1585 KRASEL-AN----EKPQPASFTEVMKRHKQEMEKLKADLTREMDEEMAQVRKKAFDEGKQ 1639

Query: 1603 QSSMKTTLLERKISKLESQL----SEAIENDKQSDKNP 1636
            Q+SMK+  LE+KI+KLE+Q+    +EA+ +   S  +P
Sbjct: 1640 QASMKSMFLEKKIAKLEAQVKASGTEAVPSAPTSKNSP 1677

>Skud_11.334 Chr11 (601335..606992) [5658 bp, 1885 aa] {ON} YKR095W
            (REAL)
          Length = 1885

 Score =  466 bits (1200), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 436/1375 (31%), Positives = 718/1375 (52%), Gaps = 94/1375 (6%)

Query: 36   ISSILDVPLEKLHTTDYDLILAVKDKLDELRNSKDQSNVVSNDINELQTLADNKLTSL-- 93
            I+S  D  LE++ + D D+I  + +KL +    K ++  ++   +EL+T +  K+  L  
Sbjct: 24   IASFFDCSLEQVKSIDTDIITRLNEKLIQFNELKSENLQITVSFDELKTNSLKKIDGLKT 83

Query: 94   -------------------GGKLATVETEKKELIDKVNGYETQFNEL------------- 121
                                 K   ++ EK +L +++   + + N+L             
Sbjct: 84   EMENVLRQNDEIRKERNDTSAKFEFLQNEKIQLSNELESVKRKLNDLTEEKKEIQSNQQR 143

Query: 122  --KIKNEGLN----LKVSN--LNIELENWKNNSNNFETEKLNYVXXXXXLSIRESEIQRL 173
              KI +E L      KV N   N E  N ++     ET++  Y+     L+ R SE++R 
Sbjct: 144  TLKILDERLKEVEMAKVENNRTNNECRNLRSTVVELETKQQTYITND--LNSR-SELERK 200

Query: 174  KQEVTFLNENKSSLSEQWXXXXXXXXXXXXXXXXXXXXSTIKLEEATTTLKSMEAKVSVL 233
             QE+  L  NK  L ++                        +L       +  +    VL
Sbjct: 201  TQELNLLQSNKDWLEKELSSKSEQYLSYRQRTDATISEIRSELNRLKNDFQLEKTNNDVL 260

Query: 234  SDKNNDLTKKYENSIWEIKNLKDNLLVTKDDMNKEIAMKSKLIDLLQGQLSSTQEELRQN 293
              KNN+L+   +  + ++KNL D+L   K + + EIA+K +LIDLL+ QL++ +EEL+  
Sbjct: 261  KQKNNELSNSLQEKVLDLKNLSDSLNTEKQEFSTEIALKQRLIDLLETQLNAVKEELKSI 320

Query: 294  VELNSKFTKFPD---LESQNETLKSDIQDLTLKIEELQNENFNLXXXXXXXXXXXXXXXX 350
             + +S      D   L S+NE+L  D++    K+ + ++E   L                
Sbjct: 321  RKSDSSNVTSDDSRKLISENESLLKDLRLTKEKLAQCESECLRLSSITEETGEES----- 375

Query: 351  XXXXXXXLPTLYSKIN----LLKKQVTQEKLEKKHLQTQIESFIIELENKIPIISSFQEK 406
                     TL S+ +    LLKKQ  +EK  K+ LQ QIESFI+ELE+K+P+I+SF+E+
Sbjct: 376  --------GTLTSRSSTDFILLKKQYIKEKRAKEQLQNQIESFIVELEHKVPVINSFKER 427

Query: 407  NQAXXXXXXXXXXXXXXXXXXXXXIQNKLNNYDSKLLTYQSNIKELIRQRLDLANQVKHL 466
                                       +LN  + K+   +++I  L RQRLDL  QV++L
Sbjct: 428  TDMLENELNNSALLLEHTSNEKNAKIRELNIKNEKIAKCENDIHILTRQRLDLCRQVQYL 487

Query: 467  LLFVAVKNDSGGPLTREEIEFINKISNNSEDLNG-SELTSQHVISERLVTFSNIEELQAK 525
            L+  +V NDS GPL +EEI+FI  I  N  D +G +E  SQ +++ RLV F N+ ELQ K
Sbjct: 488  LITNSVSNDSKGPLRKEEIKFIQNILQN--DNSGTTESDSQKILTGRLVEFRNVIELQEK 545

Query: 526  NMELLNSIRSLSENLEN--IENANSHKEFQNKTIADAKEAILTLQYHNDILESKVKVLEA 583
            N ELL   R+L++ LE+  I++  +  + +NKTI +AKEAIL+LQ     LESKV+ LE 
Sbjct: 546  NTELLRITRNLADKLESNEIKSKQNLLKIENKTINEAKEAILSLQSEKMSLESKVEELER 605

Query: 584  ERDSFKLLLNNNVSIDSSIKNDDLSSSTSPETN-EKSIEKLQTLIEELKAELKKNKDALE 642
            ER++ K  ++      SS  N  +   T  +   E  ++ LQ  I ++  E  +N   L 
Sbjct: 606  ERETLKSSISKQA---SSFNNSVIQQLTKTKRELESQVQDLQARISQITRESTQNMSLLN 662

Query: 643  SQIASFTADKSNLTISLEKEKSSNTLMAEKISLTESAFDMLKTENKELNKRFENLQNIII 702
             +I      KS+++I L KEKSS  L  E+  L  +  D+ K EN +L KR ++LQ+ I 
Sbjct: 663  KEIQDIYDSKSDISIELGKEKSSRILAEERFKLLSNTLDLTKAENDQLRKRSDSLQSSIS 722

Query: 703  KQESKLGDIINKYITGETEISNLKTQLSIAKSEKDFLVKSQDSLNSELIKTSEEKNKLRI 762
            KQ+SK  + +N+YI+ ++++S  +T LS  K E+   + S+ SL  EL K S EK  LRI
Sbjct: 723  KQDSKTHETLNEYISCKSKLSVTETALSNLKLEQKLKIDSEKSLKQELDKLSSEKTSLRI 782

Query: 763  MLSQLQSLQNERMTLLDDTQKKFMSKIHELENNNLDLIKNLGSKMTEIQKLSISNESQCT 822
            M++QLQ+LQ ER  LLD+ +K   +KI+E+E    +L      K   I +L   N S+  
Sbjct: 783  MVTQLQTLQKEREDLLDEARKSCQNKINEVEEAYNELKVETSHKDQHIMQLEEDNTSKIE 842

Query: 823  WYQNTIDDLKKINSAIKTELTSKNSLISDLNTKIELLESQ----SYTIDTNTRCSSSGND 878
            WYQN I+ LKK N ++   +  K + I  L  K++ LE +       + T      + ND
Sbjct: 843  WYQNKIETLKKDNDSVMNLVNEKQTEIEKLQYKVKSLEKEIEENKIRLHTYNVMDETIND 902

Query: 879  FSQISKDLDITKLHLSEAYTQVEEYKQLYTSTEESLKTLESNFESVKNLMDDKISKLLSE 938
             S + K+L+++K++L+EAY+Q++EYK+LY ST +SL+ + S  +       ++I  L  E
Sbjct: 903  DS-LRKELEMSKINLTEAYSQIQEYKKLYESTAQSLREMNSKLDESNEAFSNQIQSLTDE 961

Query: 939  NETLKASTGEYDKRISELSTDLKNEKNKYSEEIAQLNVQITRLNKFKKDSADTASEYEEK 998
               L+       ++   L+ +L  +KN+  ++  +    I  L    K+     SEYE K
Sbjct: 962  KINLEDKVSLLKEQSFNLNNELDLQKNEMEKKKVEFKKIIAILQNNNKEIETVKSEYESK 1021

Query: 999  ISKLQSQLELKAKFADNAQEKYESLLTKDNANLQSIEEFKEQIEKLNQRI---VIIESDL 1055
            +SK+Q  L+ +  +A+ AQ  YE  L K     ++I E +EQ+     ++    +  S+L
Sbjct: 1022 LSKIQDDLDQQTIYANTAQNNYEQELQKHADVSKTISELREQLHTYRGQVKTLTLSRSEL 1081

Query: 1056 EKKTSLLSENESLWKKKQDAFISDLEESKKKIDNLTNQNKLYVDQLELLNKDFXXXXXXX 1115
            E   ++L ENE  W  ++ + +  L+ S  +I++L++QNKL  +Q+EL    +       
Sbjct: 1082 E---NILKENEKSWTSQKQSLLEQLDLSNSRIEDLSSQNKLLYNQIEL----YTAAGNGV 1134

Query: 1116 XXXETKHMFNR-----LRADRDVLETKLSIAERDSKNNASKLESLRDELANVQMKLISSE 1170
                     N      LR +RD+L+TK+++AERD+K    K+  +  EL + + KL +S 
Sbjct: 1135 GDARNGPTLNNDILVTLRRERDILDTKVTVAERDAKMLRQKITLMDVELQDARTKLNNSR 1194

Query: 1171 NKLLRHSDLIENHEKIVSELNQITLFKESNETLRNQVSELNEKNKTLQTKLNEENSKLSN 1230
             +    S +++ H+ I+ +LNQ+ L +ESN TLRN++   ++KNK LQ++L +    ++ 
Sbjct: 1195 VENDERSSIVQQHDVIMEKLNQLNLLRESNITLRNELENCSKKNKELQSELVKLKEIIAP 1254

Query: 1231 LSMELKSVKESLGDKETDIMLIKEESNKWRLRAEELSVQIDKVDLDSVSKLSTELDALKD 1290
            +  EL ++K S+ +KE +I L KEE ++W+ R++++  +  ++  +   KL +E+++LK 
Sbjct: 1255 IESELSALKYSMQEKEQEIRLAKEEVHRWKKRSQDILEKHQQLSSNDYEKLESEVESLKA 1314

Query: 1291 DAETKRKQNAELEERFNLLKKQAHERLNASKEIQSSLNKQINELKASNTNIELAL 1345
              E K +Q  E EERFN L++QA E+L  SK  Q +L +Q+NELK +   +E +L
Sbjct: 1315 QLEDKMQQGTEAEERFNRLRRQAQEKLKTSKLTQETLTEQLNELKDAKVALERSL 1369

 Score = 93.6 bits (231), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 93/276 (33%), Positives = 135/276 (48%), Gaps = 80/276 (28%)

Query: 1484 SIKIEEFQSLKKEWEEEYEKATLERIEEAKETLKKRIRLPSETKINRVIEKRKH------ 1537
            S+ I+E   +KK+WE E+E+   ER+ EA+E LKKRIRLP+E KI+++IE++K       
Sbjct: 1500 SVNIDE---MKKQWEAEHEEEVAERVREAEEALKKRIRLPTEEKISKIIERKKEDLEKEF 1556

Query: 1538 ----------------------------------ELENEYEVKLQEKLNEIEANRNSIET 1563
                                              ELE+EY  KLQEKL E+ ++ +SI  
Sbjct: 1557 NEKLEEKVKSISGSEQMEAMLQKQLEIRVQEKQKELEDEYNEKLQEKLKEV-SHSSSISV 1615

Query: 1564 IDPGKLREEIKEEVKRDMLIKFENDLNEAKKKSFEEGKQQSSMKTTLLERKISKLESQLS 1623
             +  +LR EI+ +++ ++     ++L   KKKSFEEGKQQ++MKTTLLERK++K+ESQLS
Sbjct: 1616 NEKDELRAEIEAKLREEL----NDELQNVKKKSFEEGKQQATMKTTLLERKLAKMESQLS 1671

Query: 1624 EAIENDKQSDKNPIISDLAQTSTLASIQPPSAKKPAFSFGGFNTTNSLNANKGFXXXXXX 1683
            E     KQS ++P               P  A        G       N+N  F      
Sbjct: 1672 EI----KQSAESP---------------PKHANNVPNPLLGLPRKIEENSNSPFNT---- 1708

Query: 1684 XXXXXKDTEIVQNPFSLGVSQTSSSPMHFNPFSSSA 1719
                     ++     L  +  SSS   FNPF+S +
Sbjct: 1709 ---------LLSGEKLLKFNSKSSSSGAFNPFTSPS 1735

>YKR095W Chr11 (619805..625432) [5628 bp, 1875 aa] {ON}
            MLP1Myosin-like protein associated with the nuclear
            envelope, connects the nuclear pore complex with the
            nuclear interior; involved with Tel1p in telomere length
            control; involved with Pml1p and Pml39p in nuclear
            retention of unspliced mRNAs
          Length = 1875

 Score =  462 bits (1190), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 383/1138 (33%), Positives = 639/1138 (56%), Gaps = 26/1138 (2%)

Query: 232  VLSDKNNDLTKKYENSIWEIKNLKDNLLVTKDDMNKEIAMKSKLIDLLQGQLSSTQEELR 291
            VL  KNN+L+K  +  + EIK L D+L   K + + E+++K +L+DLL+ QL++ +EEL 
Sbjct: 259  VLKQKNNELSKSLQEKLLEIKGLSDSLNSEKQEFSAEMSLKQRLVDLLESQLNAVKEELN 318

Query: 292  QNVELNSKFTKFPDLESQ---NETLKSDIQDLTLKIEELQNENFNLXXXXXXXXXXXXXX 348
               ELN+      D + Q   NE L  ++Q    K+ + + E   L              
Sbjct: 319  SIRELNTAKVIADDSKKQTPENEDLLKELQLTKEKLAQCEKECLRLSSITDEADEDNENL 378

Query: 349  XXXXXXXXXLPTLYSKINLLKKQVTQEKLEKKHLQTQIESFIIELENKIPIISSFQEKNQ 408
                          S    LKKQ+ +E+  K+HLQ QIE+FI+ELE+K+PII+SF+E+  
Sbjct: 379  SAKSS---------SDFIFLKKQLIKERRTKEHLQNQIETFIVELEHKVPIINSFKERTD 429

Query: 409  AXXXXXXXXXXXXXXXXXXXXXIQNKLNNYDSKLLTYQSNIKELIRQRLDLANQVKHLLL 468
                                     +LN  + KL+  +++++ L +QRLDL  Q+++LL+
Sbjct: 430  MLENELNNAALLLEHTSNEKNAKVKELNAKNQKLVECENDLQTLTKQRLDLCRQIQYLLI 489

Query: 469  FVAVKNDSGGPLTREEIEFINKISNNSEDLNGSELTSQHVISERLVTFSNIEELQAKNME 528
              +V NDS GPL +EEI+FI  I    +D   +E  SQ V++ERLV F NI +LQ KN E
Sbjct: 490  TNSVSNDSKGPLRKEEIQFIQNIMQ-EDDSTITESDSQKVVTERLVEFKNIIQLQEKNAE 548

Query: 529  LLNSIRSLSENLENIENA--NSHKEFQNKTIADAKEAILTLQYHNDILESKVKVLEAERD 586
            LL  +R+L++ LE+ E     S ++ +++T+ +AKEAI+TL+     LES+++ L+ E +
Sbjct: 549  LLKVVRNLADKLESKEKKSKQSLQKIESETVNEAKEAIITLKSEKMDLESRIEELQKELE 608

Query: 587  SFKLLLNNNVSIDSSIKNDDLSSSTSPETN-EKSIEKLQTLIEELKAELKKNKDALESQI 645
              K  + N    D+S  N  +   T  + + E  ++ LQT I ++  E  +N   L  +I
Sbjct: 609  ELKTSVPNE---DASYSNVTIKQLTETKRDLESQVQDLQTRISQITRESTENMSLLNKEI 665

Query: 646  ASFTADKSNLTISLEKEKSSNTLMAEKISLTESAFDMLKTENKELNKRFENLQNIIIKQE 705
                  KS+++I L KEKSS  L  E+  L  +  D+ K EN +L KRF+ LQN I+KQ+
Sbjct: 666  QDLYDSKSDISIKLGKEKSSRILAEERFKLLSNTLDLTKAENDQLRKRFDYLQNTILKQD 725

Query: 706  SKLGDIINKYITGETEISNLKTQLSIAKSEKDFLVKSQDSLNSELIKTSEEKNKLRIMLS 765
            SK  + +N+Y++ ++++S ++T+L   K E+   V  + +L  EL K S EK+ LRIM++
Sbjct: 726  SKTHETLNEYVSCKSKLSIVETELLNLKEEQKLRVHLEKNLKQELNKLSPEKDSLRIMVT 785

Query: 766  QLQSLQNERMTLLDDTQKKFMSKIHELENNNLDLIKNLGSKMTEIQKLSISNESQCTWYQ 825
            QLQ+LQ ER  LL++T+K    KI ELE+   +L K    K   I++L   N S   WYQ
Sbjct: 786  QLQTLQKEREDLLEETRKSCQKKIDELEDALSELKKETSQKDHHIKQLEEDNNSNIEWYQ 845

Query: 826  NTIDDLKKINSAIKTELTSKNSLISDLNTKIELLESQ----SYTIDTNTRCSSSGNDFSQ 881
            N I+ LKK   ++ T + SK + I  L  K++ LE +       + T      + ND S 
Sbjct: 846  NKIEALKKDYESVITSVDSKQTDIEKLQYKVKSLEKEIEEDKIRLHTYNVMDETINDDS- 904

Query: 882  ISKDLDITKLHLSEAYTQVEEYKQLYTSTEESLKTLESNF-ESVKNLMDDKISKLLSENE 940
            + K+L+ +K++L++AY+Q++EYK LY +T +SL+   S   ES K+  + +I  L  E  
Sbjct: 905  LRKELEKSKINLTDAYSQIKEYKDLYETTSQSLQQTNSKLDESFKDFTN-QIKNLTDEKT 963

Query: 941  TLKASTGEYDKRISELSTDLKNEKNKYSEEIAQLNVQITRLNKFKKDSADTASEYEEKIS 1000
            +L+       +++  L+ +L  +K    +E A    +I+ L    K+     SEYE K+S
Sbjct: 964  SLEDKISLLKEQMFNLNNELDLQKKGMEKEKADFKKRISILQNNNKEVEAVKSEYESKLS 1023

Query: 1001 KLQSQLELKAKFADNAQEKYESLLTKDNANLQSIEEFKEQIEKLNQRIVIIESDLEKKTS 1060
            K+Q+ L+ +  +A+ AQ  YE  L K     ++I E +EQ+     ++  +    ++  +
Sbjct: 1024 KIQNDLDQQTIYANTAQNNYEQELQKHADVSKTISELREQLHTYKGQVKTLNLSRDQLEN 1083

Query: 1061 LLSENESLWKKKQDAFISDLEESKKKIDNLTNQNKLYVDQLELLNKDFXXXXXXXXXXET 1120
             L ENE  W  ++++ +  L+ S  +I++L++QNKL  DQ+++                 
Sbjct: 1084 ALKENEKSWSSQKESLLEQLDLSNSRIEDLSSQNKLLYDQIQIYTAADKEVNNSTNGPGL 1143

Query: 1121 KHMFNRLRADRDVLETKLSIAERDSKNNASKLESLRDELANVQMKLISSENKLLRHSDLI 1180
             ++   LR +RD+L+TK+++AERD+K    K+  +  EL + + KL +S  +   HS +I
Sbjct: 1144 NNILITLRRERDILDTKVTVAERDAKMLRQKISLMDVELQDARTKLDNSRVEKENHSSII 1203

Query: 1181 ENHEKIVSELNQITLFKESNETLRNQVSELNEKNKTLQTKLNEENSKLSNLSMELKSVKE 1240
            + H+ I+ +LNQ+ L +ESN TLRN++   N K K LQ++L++    ++ +  EL ++K 
Sbjct: 1204 QQHDDIMEKLNQLNLLRESNITLRNELENNNNKKKELQSELDKLKQNVAPIESELTALKY 1263

Query: 1241 SLGDKETDIMLIKEESNKWRLRAEELSVQIDKVDLDSVSKLSTELDALKDDAETKRKQNA 1300
            S+ +KE ++ L KEE ++W+ R++++  + +++      KL +E++ LK++ E K +Q A
Sbjct: 1264 SMQEKEQELKLAKEEVHRWKKRSQDILEKHEQLSSSDYEKLESEIENLKEELENKERQGA 1323

Query: 1301 ELEERFNLLKKQAHERLNASKEIQSSLNKQINELKASNTNIELALSSEQKKSMDLQNT 1358
            E EE+FN L++QA ERL  SK  Q SL +Q+N L+ +   +E +LS    +  +LQN 
Sbjct: 1324 EAEEKFNRLRRQAQERLKTSKLSQDSLTEQVNSLRDAKNVLENSLSEANARIEELQNA 1381

 Score =  110 bits (276), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 95/302 (31%), Positives = 141/302 (46%), Gaps = 91/302 (30%)

Query: 1490 FQSLKKEWEEEYEKATLERIEEAKETLKKRIRLPSETKINRVI----------------- 1532
             + +KK+WE E+E+   ++I EA+E LKKRIRLP+E KIN++I                 
Sbjct: 1502 MEEIKKKWESEHEQEVSQKIREAEEALKKRIRLPTEEKINKIIERKKEELEKEFEEKVEE 1561

Query: 1533 -----------------------EKRKHELENEYEVKLQEKLNEIEANRNSIETIDPGKL 1569
                                   ++++ ELENEY  KLQE+L ++  + + I   +  KL
Sbjct: 1562 RIKSMEQSGEIDVVLRKQLEAKVQEKQKELENEYNKKLQEELKDV-PHSSHISDDERDKL 1620

Query: 1570 REEIKEEVKRDMLIKFENDLNEAKKKSFEEGKQQSSMKTTLLERKISKLESQLSEAIEND 1629
            R EI+  ++ +    F N+L   KKKSF+EGKQQ+ MKTTLLERK++K+ESQLSE     
Sbjct: 1621 RAEIESRLREE----FNNELQAIKKKSFDEGKQQAMMKTTLLERKLAKMESQLSET---- 1672

Query: 1630 KQSDKNPIISDLAQTSTLASIQPPSAKKPAFSFGGFNTTNSLNANKGFXXXXXXXXXXXK 1689
            KQS ++P         ++ ++Q P          G       N+N  F            
Sbjct: 1673 KQSAESP-------PKSVNNVQNP--------LLGLPRKIEENSNSPF------------ 1705

Query: 1690 DTEIVQNPFSLGVS----QTSSSPMHFNPFSSSATTSNVFNQNGTSKNIFGNVMAMKPTT 1745
                  NP   G       + SS   FNPF+S +   ++ N N   ++     +A K   
Sbjct: 1706 ------NPLLSGEKLLKLNSKSSSGGFNPFTSPSPNKHLQNDNDKRES-----LANKTDP 1754

Query: 1746 PT 1747
            PT
Sbjct: 1755 PT 1756

>Kwal_55.19697 s55 complement(82938..88220) [5283 bp, 1760 aa] {ON}
            YKR095W (MLP1) - colied-coil protein (putative), similar
            to myosin and TPR [contig 159] FULL
          Length = 1760

 Score =  460 bits (1183), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 371/1224 (30%), Positives = 643/1224 (52%), Gaps = 56/1224 (4%)

Query: 168  SEIQRLKQEVTFLNENKSSLSEQWXXXXXXXXXXXXXXXXXXXXSTIKLEEATTTLKSME 227
            ++  +L Q+V+ LN N   L  Q                      + +LE     L++  
Sbjct: 192  ADFHQLSQKVSLLNTNNEWLESQLNQKNSEFNAYRQRTQSELASVSQRLETCEGDLQAAT 251

Query: 228  AKVSVLSDKNNDLTKKYENSIWEIKNLKDNLLVTKDDMNKEIAMKSKLIDLLQGQLSSTQ 287
              +  L ++N     + E     +K L D L   K +  +E+++K +L++LL+GQ+S+ +
Sbjct: 252  KTIKTLREQNGQKESELEGQFQAVKKLTDELTSAKQEFTREMSLKQRLVELLEGQVSALK 311

Query: 288  EELRQNVELNSKFTKFPDLESQNETLKSDIQ---DLTLKIEELQNENFNLXXXXXXXXXX 344
             EL        +F   P   +   T +S  Q   +L  K ++L+     +          
Sbjct: 312  SEL--------EFKNSPQASTDAATTESQSQIEDELVHKTQQLEESELKIQKLEQTVEQL 363

Query: 345  XXXXXXXXXXXXXLPTLYSKINLLKKQVTQEKLEKKHLQTQIESFIIELENKIPIISSFQ 404
                         LP LY+ I +LKKQV  E+ +K+ LQ Q+E+F++ELENK+P++SSF+
Sbjct: 364  LSADEKTISGSQSLPDLYADIGILKKQVIHERRQKEFLQNQVEAFVVELENKVPMLSSFK 423

Query: 405  EKNQAXXXXXXXXXXXXXXXXXXXXXIQNKLNNYDSKLLTYQSNIKELIRQRLDLANQVK 464
            ++N                           L    S++   +S I  L +QR DLA QV+
Sbjct: 424  DRNDVLEKELAETAYMLDSISKDKDETAADLKRTKSQIRDLESQISALTQQRSDLARQVQ 483

Query: 465  HLLLFVAVKNDSGGPLTREEIEFINKISN--NSEDLNGSELTSQHVISERLVTFSNIEEL 522
            +LL+ V V+ DS GPL+ EE  F+ K+ N  N++  +G    +Q +ISERLV F NI EL
Sbjct: 484  YLLIQVTVRGDSHGPLSAEETAFVKKVVNMENTQP-DGD---AQGIISERLVEFKNIVEL 539

Query: 523  QAKNMELLNSIRSLSENLENIENANSHK--EFQNKTIADAKEAILTLQYHNDILESKVKV 580
            QAKN +LL+++R+L+  LE  E     K    +N TI +AKEAI+TLQ H   LE+++ V
Sbjct: 540  QAKNADLLHTVRNLANQLETEERKVKSKTEAIENDTITEAKEAIVTLQDHIQELETRIDV 599

Query: 581  LEAERDSFKLLLNNNVSIDSSIKNDDLSSSTSPETNEKSIEKLQTLIEELKAELKKNKDA 640
            +  ERD++K + +      S+    D+++  S E ++  I +L+ L+   K E + N   
Sbjct: 600  ITRERDAYKAIQSQTSHEGSNGGLRDVNAKAS-ENSDLKIRELEELLSAAKREAEANVKL 658

Query: 641  LESQIASFTADKSNLTISLEKEKSSNTLMAEKISLTESAFDMLKTENKELNKRFENLQNI 700
            L ++       KS L +++EKEKSS  L  E++ +++S+  + K EN+ELNKR   L+N 
Sbjct: 659  LMTENQELARSKSELVVNVEKEKSSRLLAEERLKISKSSLLLTKQENEELNKRGLVLENN 718

Query: 701  IIKQESKLGDIINKYITGETEISNLKTQL--SIAKSEKDFLVKSQDSLNSELIKTSEEKN 758
            + KQ+++  + I++ I  +++++ L  +L  SIAK  ++ L  S   L     + ++E+N
Sbjct: 719  LAKQDTRTQETISELIDCKSQLATLSAELKNSIAK--ENLLNTSHQKLKETNEQLTKERN 776

Query: 759  KLRIMLSQLQSLQNERMTLLDDTQKKFMSKIHELENNNLDLIKNLGSKMTEIQKLSISNE 818
            +L I+++QLQ+LQ ER TLL D+   F  KI  LE     L   L  K TE+     +++
Sbjct: 777  ELTILVTQLQTLQKERDTLLKDSDDNFKGKIDSLEAEISQLRTLLSQKATELSDFMSTSD 836

Query: 819  SQCTWYQNTIDDLKKINSAIKTELTSKNSLISDLNTKIELL---------ESQSYTIDTN 869
            S+  WYQ  ID L +   +  ++L SK  +I +L ++  LL         +SQSY++   
Sbjct: 837  SRSRWYQEKIDALNECLKSTTSDLNSKTQMIQELQSQQSLLTSKLRDAETKSQSYSVLNQ 896

Query: 870  TRCSSSGNDFSQISKDLDITKLHLSEAYTQVEEYKQLYTSTEESLKTLESNFESVKNLMD 929
            T    +  D   +  +L+ T+++L +A++QV+EYK LY ST+E+L  + +  E  K    
Sbjct: 897  TDDVLTQTDA--LRSELEKTRINLKDAFSQVDEYKGLYASTKETLTAMTTALEHSKQDHT 954

Query: 930  DKISKLLSENETLKASTGEYDKRISELSTDL----------KNEKNKYSEEIAQLNVQIT 979
             ++  L  E + L         +++ L+++L          K+E NK  EE+      + 
Sbjct: 955  IEVETLKKERDALSNDAAVLKDQLANLNSELDYQKNLLETLKHEHNKCEEEVKSNKTAL- 1013

Query: 980  RLNKFKKDSADTASEYEEKISKLQSQLELKAKFADNAQEKYESLLTKDNANLQSIEEFKE 1039
                     A    +Y+ ++SKL   L  +A +A+ AQE YE  L +     ++I + +E
Sbjct: 1014 ---------ASMKDQYQLELSKLTEDLNQQAMYANKAQENYEQELQRHADVSKTISQLRE 1064

Query: 1040 QIEKLNQRIVIIESDLEKKTSLLSENESLWKKKQDAFISDLEESKKKIDNLTNQNKLYVD 1099
            + +K   ++  +E+ + +    L ENES W  ++  + +    S ++I++L+ QN+L  D
Sbjct: 1065 EAQKHKNKVHSLEASITELKKSLEENESCWAAQKQEYETQASLSSQRIEDLSTQNRLLFD 1124

Query: 1100 QLELLNKDFXXXXXXXXXXETKHMFNRLRADRDVLETKLSIAERDSKNNASKLESLRDEL 1159
            Q+ L + D           E + + + L+ + D+L+TKL +A+RD  N   KLE    EL
Sbjct: 1125 QISLKDTD-SIPINDELKSEARELISTLKRECDILQTKLELAKRDESNLKQKLEFTEQEL 1183

Query: 1160 ANVQMKLISSENKLLRHSDLIENHEKIVSELNQITLFKESNETLRNQVSELNEKNKTLQT 1219
            +  + ++  S+      S +IE + KI+ +LNQ+ L +ESN TLRN++   +++N+ L+ 
Sbjct: 1184 SVAKSEIRKSQVTSDTRSIMIEENSKILEQLNQVNLLRESNITLRNELQRKSQRNQDLER 1243

Query: 1220 KLNEENSKLSNLSMELKSVKESLGDKETDIMLIKEESNKWRLRAEELSVQIDKVDLDSVS 1279
             + E    L  L  ++ +++ S+G K+  I LI EE N+W+ R++++ ++ ++VD +   
Sbjct: 1244 NVEELQEALKPLENDILTLQRSVGAKDKQISLITEEVNRWKQRSQDILLKYERVDPEEHK 1303

Query: 1280 KLSTELDALKDDAETKRKQNAELEERFNLLKKQAHERLNASKEIQSSLNKQINELKASNT 1339
            KL+ EL   + +A    +Q +ELE+RF  LKKQA ERL+ ++  Q++LN ++ E + S  
Sbjct: 1304 KLAEELSQARAEAAANAQQRSELEDRFQRLKKQARERLDNARTTQNTLNAELTEARESQK 1363

Query: 1340 NIELALSSEQKKSMDLQNTLSDNE 1363
             +E AL  E++K+  LQ ++   E
Sbjct: 1364 ALEDALDKEREKTRSLQESIKATE 1387

 Score =  121 bits (304), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 67/139 (48%), Positives = 98/139 (70%), Gaps = 11/139 (7%)

Query: 1483 QSIKIEEFQSLKKEWEEEYEKATLERIEEAKETLKKRIRLPSETKINRVIEKRKHELENE 1542
            +S+K  + ++LKKEWEEEYE+ T++RIEEA E L+KRIRLP+E KIN++IE RK EL+ E
Sbjct: 1516 ESLKSSDIENLKKEWEEEYEQRTIKRIEEANEILRKRIRLPTEEKINKIIENRKRELDEE 1575

Query: 1543 YEVKLQEKLNEIEANRNSIETIDPGKLREEIK------EEVKRDMLIKFENDLNEAKKKS 1596
            +E KLQ++ +E+       E   P    E +K      E++K DM  + + ++ +AKKK+
Sbjct: 1576 FEAKLQQRTSELAG-----EKPLPATFTEVMKRHKQEVEKLKADMKREMDEEVAQAKKKA 1630

Query: 1597 FEEGKQQSSMKTTLLERKI 1615
            F+EGKQQ+SMK+  LE+KI
Sbjct: 1631 FDEGKQQASMKSMFLEKKI 1649

>Ecym_4018 Chr4 complement(42777..48086) [5310 bp, 1769 aa] {ON}
            similar to Ashbya gossypii AFR286W
          Length = 1769

 Score =  439 bits (1130), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 364/1210 (30%), Positives = 648/1210 (53%), Gaps = 43/1210 (3%)

Query: 165  IRE-SEIQRLKQEVTFLNENKSSLSEQWXXXXXXXXXXXXXXXXXXXXSTIKLEEATTTL 223
            +RE SEIQRL QE+  +  N   LS++                        ++    + L
Sbjct: 185  LREKSEIQRLHQELNLVKSNADWLSKELESKNEQLNSFREKTNSELQNGYEQVNSLKSQL 244

Query: 224  KSMEAKVSVLSDKNNDLTKKYENSIWEIKNLKDNLLVTKDDMNKEIAMKSKLIDLLQGQL 283
            +   A  S L  K  +L+ + +  + E K L D L   K++  +E+++K +LIDLL+ Q+
Sbjct: 245  EFARANNSTLKAKTAELSNQLQEKLVETKKLADVLNTEKEEFTREMSLKQRLIDLLESQV 304

Query: 284  SSTQEELR---QNVELNSKFTKFPDLESQNETLKSDIQDLTLKIEELQNENFNLXXXX-- 338
            SS + +L    Q+   N   T   D       L  ++ D    +E  Q EN  L      
Sbjct: 305  SSMKSDLENAYQSANQNGMSTPEKD------QLLDELIDTKKNLEATQAENIKLEATVNE 358

Query: 339  ---------XXXXXXXXXXXXXXXXXXXLPTLYSKINLLKKQVTQEKLEKKHLQTQIESF 389
                                        +P L   I +LKKQ+ QE+ +K+ LQ Q+ESF
Sbjct: 359  LLSVNGKNGVAVINSNVSDTSLDSKISTVPKLCGDIGILKKQLVQERRQKEELQNQVESF 418

Query: 390  IIELENKIPIISSFQEKNQAXXXXXXXXXXXXXXXXXXXXXIQNKLNNYDSKLLTYQSNI 449
            ++ELE+KIPI++SF+E+                           +LN Y +K+  Y+S +
Sbjct: 419  VVELEHKIPILNSFKERTDMLERELNDVTLLLESTAKQRDQKTIELNQYKNKINNYESQV 478

Query: 450  KELIRQRLDLANQVKHLLLFVAVKNDSGGPLTREEIEFINKISNNSEDLNGSELTSQHVI 509
              LI QR DLA+QV++LL+ ++V++D+ GPLT +E+EF+ +I ++ ++   S+  +Q +I
Sbjct: 479  CSLIVQRSDLAHQVQYLLMQLSVRDDAHGPLTEQEVEFVKRIISSEDEAPKSD--TQGII 536

Query: 510  SERLVTFSNIEELQAKNMELLNSIRSLSENLENIENANSH--KEFQNKTIADAKEAILTL 567
            SERLV F ++ ELQ+KN ELLN+IR L++ LE+ E  +    K  + +T+ +AKEAIL+L
Sbjct: 537  SERLVQFKSVIELQSKNAELLNTIRQLADKLEDEEKKSRFRLKSVETQTVKEAKEAILSL 596

Query: 568  QYHNDILESKVKVLEAERDSFKLLLNNNVSIDSSIKNDDLSSSTSPETNEKSIEKLQTLI 627
            Q H   LE ++K++  ERD+FKL  + N   DS+      SS+   +  ++ I +L+  +
Sbjct: 597  QEHVQRLEDQLKIVSKERDAFKLANSANKQGDSAP-----SSTYQSKKLDEHIMELEKRL 651

Query: 628  EELKAELKKNKDALESQIASFTADKSNLTISLEKEKSSNTLMAEKISLTESAFDMLKTEN 687
            + L  + + N   L  +I +    KS +T+ LE+E+SS  L  E++ L +S   + K EN
Sbjct: 652  KNLAEQSQDNIKLLNDEIKALYKAKSEVTVILEQERSSKVLAEERLKLIQSTLSLTKEEN 711

Query: 688  KELNKRFENLQNIIIKQESKLGDIINKYITGETEISNLKTQLSIAKSEKDFLVKSQDSLN 747
             EL+KR ++LQ +++KQ+ K    I++ I  ++++SNL ++L+I  SE+DFL K +  L 
Sbjct: 712  LELHKRSDDLQRVLLKQDEKTQSTIDEIIATKSQLSNLTSKLAILTSERDFLRKIEAELK 771

Query: 748  SELIKTSEEKNKLRIMLSQLQSLQNERMTLLDDTQKKFMSKIHELENNNLDLIKNLGSKM 807
            +E    ++E    +I++SQLQ+LQ ER  LL++ Q  +   I +LE++  +  ++L  + 
Sbjct: 772  NENEALTKENTTSKILVSQLQTLQRERDILLEEAQTNYRKNIEKLESDLHETREHLVRRT 831

Query: 808  TEIQKLSISNESQCTWYQNTIDDL-KKINSAIKTELTSKNSL------ISDLNTKIE--L 858
             E ++  +S+ SQ  W+Q  +D L +++++A KT     NS+         L  K+E   
Sbjct: 832  REYEEQRVSDTSQYKWFQAKVDSLNEQLDNARKTLQEKTNSIETLQLHAKSLTAKLEEAE 891

Query: 859  LESQSYTIDTNTRCSSSGNDFSQISKDLDITKLHLSEAYTQVEEYKQLYTSTEESLKTLE 918
            L +QSY++  N       +    + K+L+   ++L++AY+Q+E+YK +   +E+S   + 
Sbjct: 892  LRTQSYSVLAN--ADDITDKIETLRKNLEKANINLADAYSQIEQYKSMAKVSEQSAVEIS 949

Query: 919  SNFESVKNLMDDKISKLLSENETLKASTGEYDKRISELSTDLKNEKNKYSEEIAQLNVQI 978
               E  +      I+ L  E ++L       + +I +L+++L ++K++   E ++L  ++
Sbjct: 950  KALEESQANYRKNIALLEQERKSLTDQIALLNDQIKDLNSELDHQKSQNQSEKSELIKKL 1009

Query: 979  TRLNKFKKDSADTASEYEEKISKLQSQLELKAKFADNAQEKYESLLTKDNANLQSIEEFK 1038
            + L   ++   +  SEYEEKISKLQ  L  +A +A+ AQ+ YE  L K     ++I   +
Sbjct: 1010 SILQGSQRSLDELKSEYEEKISKLQEDLTQQASYANQAQKNYEQELQKHADVTKTISLLR 1069

Query: 1039 EQIEKLNQRIVIIESDLEKKTSLLSENESLWKKKQDAFISDLEESKKKIDNLTNQNKLYV 1098
            E+ +K    +   +    +  S L  NE  W ++     S L  ++++ + L  QN+L  
Sbjct: 1070 EESQKYKSEMEGFKRSASEAKSALERNEQSWCQQVADLESQLSLAQQRTEELNTQNRLLY 1129

Query: 1099 DQLELLNKDFX--XXXXXXXXXETKHMFNRLRADRDVLETKLSIAERDSKNNASKLESLR 1156
            DQ+ELL+K              E++ +   LR +RD+LETKL ++ R+ K    +L   +
Sbjct: 1130 DQVELLSKATSSDSEAAASMSAESRELIMTLRRERDILETKLDVSIREEKILRQRLGLAK 1189

Query: 1157 DELANVQMKLISSENKLLRHSDLIENHEKIVSELNQITLFKESNETLRNQVSELNEKNKT 1216
             EL NV+++   ++          E+ E+I+ +LNQ+ L +ESN TLRN+  +  E+++ 
Sbjct: 1190 TELENVRLEFSKTQATAPDSIFARESQEQIMEKLNQLNLLRESNVTLRNESKKYLEQSQH 1249

Query: 1217 LQTKLNEENSKLSNLSMELKSVKESLGDKETDIMLIKEESNKWRLRAEELSVQIDKVDLD 1276
             Q ++ +   +L  L  +LKS+  ++ +++  I L+KEES++W+ R++++  + +++D  
Sbjct: 1250 FQNEIAKLQEQLQPLESQLKSLTITISERDQQISLLKEESSRWKQRSQDILHKYERIDPV 1309

Query: 1277 SVSKLSTELDALKDDAETKRKQNAELEERFNLLKKQAHERLNASKEIQSSLNKQINELKA 1336
               KL+ E+  LK++ E K  +N E +ERF  L+KQA+ERL+  K  ++ +  +   +  
Sbjct: 1310 EHQKLADEVTELKNELEKKSLENLESQERFRKLRKQANERLDEFKAAKAKVESEFEAVSI 1369

Query: 1337 SNTNIELALS 1346
            +   +E  L+
Sbjct: 1370 AKAQLEAELA 1379

 Score =  114 bits (285), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 79/188 (42%), Positives = 111/188 (59%), Gaps = 5/188 (2%)

Query: 1491 QSLKKEWEEEYEKATLERIEEAKETLKKRIRLPSETKINRVIEKRKHELENEYEVKLQEK 1550
            ++LK + E EYEK TLERI EA+E LKKRIRLPSE +IN+VIE+R+  L+ E+E++++ +
Sbjct: 1537 ETLKSKLEAEYEKKTLERIREAEEALKKRIRLPSEERINQVIERRQRALDQEFELRVRAR 1596

Query: 1551 LNEIEANRNSIETIDPGKLREEIKEEVKRDMLIKFENDLNEAKKKSFEEGKQQSSMKTTL 1610
              E+          D  KL +E +EE+ + +  KF+  L   +KK+FEEGKQQ  MK  L
Sbjct: 1597 ALELFKENPESFVGDTAKLIKEHQEEMDK-LEAKFDEQLALVRKKAFEEGKQQLVMKVKL 1655

Query: 1611 LERKISKLESQLSEAIENDKQSDKNPIISDLAQTSTLASIQPPSAKKPAF--SFGGFNTT 1668
            LE KI+KLE Q ++   N+    K PI  D    S+    QP + K   F  +FG     
Sbjct: 1656 LESKIAKLEGQPNKINLNNSVPSKIPI--DNNNNSSPQGAQPIAIKPSPFQVAFGKAMEN 1713

Query: 1669 NSLNANKG 1676
             S  + KG
Sbjct: 1714 TSFGSFKG 1721

>NCAS0A03200 Chr1 complement(627997..633363) [5367 bp, 1788 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1788

 Score =  417 bits (1072), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 315/1005 (31%), Positives = 562/1005 (55%), Gaps = 25/1005 (2%)

Query: 365  INLLKKQVTQEKLEKKHLQTQIESFIIELENKIPIISSFQEKNQAXXXXXXXXXXXXXXX 424
            ++ +KK++ QE+ +K+ LQ Q+E FI+ELE K+P I+SF+++                  
Sbjct: 371  LDTIKKELIQERYQKEKLQNQVEIFIVELEKKVPTINSFKQRTDMLEKELTDATLLLENL 430

Query: 425  XXXXXXIQNKLNNYDSKLLTYQSNIKELIRQRLDLANQVKHLLLFVAVKNDSGGPLTREE 484
                  + N+L+       + +   K L +QR DLA+Q++++L+  +V+NDS GPL+ EE
Sbjct: 431  RREKNQVTNELDALRQNFKSVKWETKSLTKQRNDLAHQLQYILIHTSVQNDSNGPLSAEE 490

Query: 485  IEFINKISNNSEDLNGSELTSQHVISERLVTFSNIEELQAKNMELLNSIRSLSENLENIE 544
            + FI  I +N  +   S+  SQ VISERLVTF NI ELQ KN++LL S+R L+  LE  E
Sbjct: 491  VRFIQDILDNESNEESSD--SQQVISERLVTFQNIVELQQKNIDLLKSVRELARKLELQE 548

Query: 545  --NANSHKEFQNKTIADAKEAILTLQYHNDILESKVKVLEAERDSFKLLLNNNVSIDSSI 602
                ++ +  + + I +AKEAI++LQ +N  LE K+K L  E D +K L       D+ +
Sbjct: 549  EHQQSTSQVVEQQAIDEAKEAIISLQSYNTKLEDKIKTLNDELDCYKSL----PKPDTKV 604

Query: 603  KNDDLSSSTSPETNEKSIEKLQTLIEELKAELKKNKDALESQIASFTADKSNLTISLEKE 662
            + + L  +   E N   I++L+T +   + E  K   +L ++I     + S      + E
Sbjct: 605  ETEHLRLN---EENTDLIKELETRLATSREESNKTFASLNNEIDDIRRNHSQTVKECQNE 661

Query: 663  KSSNTLMAEKISLTESAFDMLKTENKELNKRFENLQNIIIKQESKLGDIINKYITGETEI 722
            ++S  L  +++ L +++  + K EN++L KR E LQ+I +KQ+ +  + + +Y++ +  +
Sbjct: 662  RASRELAEQRLKLIQNSLSLSKVENEQLQKRLEILQDITLKQDQRTQETLKEYVSCKVAL 721

Query: 723  SNLKTQLSIAKSEKDFLVKSQDSLNSELIKTSEEKNKLRIMLSQLQSLQNERMTLLDDTQ 782
            SN + +L+  +S+ +    ++ SL  ++   S+E+N+L+ ++SQLQSLQ ER  + + T+
Sbjct: 722  SNSQNELNYIQSQLNISKTNEKSLKDDITIVSKERNELKELVSQLQSLQTEREQIFNSTK 781

Query: 783  KKFMSKIHELENNNLDLIKNLGSKMTEIQKLSISNESQCTWYQNTIDDLKKINSAIKTEL 842
                +++  +E    D+ + L +K  EI++L  +  S+  WYQN ID +K+   A + EL
Sbjct: 782  LDSQTRLDTVERELYDISEKLKNKDREIKELESNRLSEIEWYQNKIDAIKEKRDAYQDEL 841

Query: 843  TSKNSLISDLNTKIELLESQ---------SYTIDTNTRCSSSGNDFSQISKDLDITKLHL 893
              K + I +LN +I+ L+           +Y +  N+   + G     +  +L+ +K++L
Sbjct: 842  LEKTNEIGELNYEIKKLQKDLQASESRVTAYKVLNNS--DNVGTKMETLQNELEKSKINL 899

Query: 894  SEAYTQVEEYKQLYTSTEESLKTLESNFESVKNLMDDKISKLLSENETLKASTGEYDKRI 953
            SEAY ++++YKQ  +  EE L+  ++  E  K     KI  L  + + L  +     ++I
Sbjct: 900  SEAYAELDQYKQSASEKEEFLENYQNTVEETKKEFIRKIETLQKDRDELLDTKSILSEQI 959

Query: 954  SELSTDLKNEKNKYSEEIAQLNVQITRLNKFKKDSADTASEYEEKISKLQSQLELKAKFA 1013
            ++L+ +L ++   + EE ++++ ++  L     +  + +++YE K+S LQ+ LE +A +A
Sbjct: 960  TDLNNELDHQNKAHLEEKSEISKKLNELLAQNHNIEEVSNQYELKLSTLQNDLEQQASYA 1019

Query: 1014 DNAQEKYESLLTKDNANLQSIEEFKEQIEKLNQRIVIIESDLEKKTSLLSENESLWKKKQ 1073
            + AQ  YE  L K     ++I + +E      +++  ++++      LL +NE LW++++
Sbjct: 1020 NIAQNNYEQELQKHAELAKTISQLREDAHTYRKKMDSMQANATTNEELLRKNEKLWEEQR 1079

Query: 1074 DAFISDLEESKKKIDNLTNQNKLYVDQLELLNKDFXXXXXXXXXXETKHMFNRLRADRDV 1133
             ++   +   KK+I++L++QNKL  DQ++LL+K              + +   LR+DRD+
Sbjct: 1080 KSYEDQIHALKKRIEDLSSQNKLLFDQVDLLSKSENSYNQQSSATPNEDLVLSLRSDRDI 1139

Query: 1134 LETKLSIAERDSKNNASKLESLRDELANVQMKLISSENKLLRHSDLIENHEKIVSELNQI 1193
            L+T+LS+ E + K    KL S+  EL N + KL     +       +E H+ I+++LNQ+
Sbjct: 1140 LQTRLSVTEEEGKALRLKLSSVNTELTNTRAKLTEIRQQYENTKISVEEHDNIMNQLNQL 1199

Query: 1194 TLFKESNETLRNQVSELNEKNKTLQTKLNEENSKLSNLSMELKSVKESLGDKETDIMLIK 1253
             L +ESN TLRN+ ++  EK K LQ  L     K+  L  E   +KE + + E  +   K
Sbjct: 1200 NLLRESNITLRNEANDSREKAKQLQEDLETLREKVLPLEAEQNRLKEVIKENEQQLNAYK 1259

Query: 1254 EESNKWRLRAEELSVQIDKVDLDSVSKLSTELDALKDDAETKRKQNAELEERFNLLKKQA 1313
            EE N+W+ R++++  +  K+D     KL  E+  LK +   K+K+N EL +RFN +KKQA
Sbjct: 1260 EECNRWKQRSQDILTKHKKIDPVEHEKLEAEIATLKQNLADKKKENEELNDRFNRIKKQA 1319

Query: 1314 HERLNASKEIQSSLNKQINELKASNTNIELALSSEQKKSMDLQNT 1358
            HERLN+SK  Q +L  QI +L+  N +I+  L +E+    ++QNT
Sbjct: 1320 HERLNSSKATQQTLIDQIKQLEDENAHIQSLLETERG---NIQNT 1361

 Score =  127 bits (318), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 109/330 (33%), Positives = 178/330 (53%), Gaps = 59/330 (17%)

Query: 1487 IEEFQSLKKEWEEEYEKATLERIEEAKETLKKRIRLPSETKINRVIEKRKHELENEYEVK 1546
            +++  + +++WE+EYE+  L+RIE+A+E LK+RIRLP+E KIN VI+K+K+ELE EY+ K
Sbjct: 1492 LQDISAQREQWEKEYEEIVLKRIEQAEENLKRRIRLPTEEKINSVIQKKKNELEKEYDEK 1551

Query: 1547 LQEKLNEI---EANRNSIETIDPGKLREEIKEEVKRDMLIKFENDLNEAKKKSFEEGKQQ 1603
            + ++  E+   E N+  IE      L+ +IK+E++R++    + +L  AK K+FEEGKQQ
Sbjct: 1552 VNQRAKELLSSEENKTFIED-----LKNDIKKELERNI----DQELKNAKAKAFEEGKQQ 1602

Query: 1604 SSMKTTLLERKISKLESQL--SEAIENDK---------QSDKNPIISDLAQTSTLASIQP 1652
            + MKTT LE+KISKLESQL  S A   +K          SD+N + S   +T +   +  
Sbjct: 1603 AMMKTTFLEKKISKLESQLQGSNAANENKNDVEVLLKTPSDENNVPSKQEETLSKPQLSK 1662

Query: 1653 PSAKKPAFSFGGFNTTNSLNANKGFXXXXXXXXXXXKDTEIVQNPFSLGVSQTSSSPMHF 1712
                 P  S GG  TT +LN ++                     P SL     SS+P   
Sbjct: 1663 IQIANPLLSTGG--TTLALNQSRA--------------------PSSLQNGSDSSNPF-T 1699

Query: 1713 NPFSSSATTSNVFNQNGTSKNIFGNVMAMKPTTPTVEQAIKPLESVTPTET-PEVP-EDD 1770
            +PF  +   +N+      ++  F   +  +P+ P +  +    +S + T T  E+P   +
Sbjct: 1700 SPFQQTKNDANI---PAVTQPAF---LLREPSEPNMSVSTISRQSTSETNTESELPVSSE 1753

Query: 1771 LLSTRENTTETPSQEG---DKMGEGSPLKR 1797
             L+T   +++ P+QE    +K+   +P K+
Sbjct: 1754 GLATP--SSKRPAQEDTEEEKLDAETPKKK 1781

>KLLA0A00594g Chr1 complement(53304..58550) [5247 bp, 1748 aa] {ON}
            similar to uniprot|Q02455 Saccharomyces cerevisiae
            YKR095W MLP1 Myosin-like protein associated with the
            nuclear envelope connects the nuclear pore complex with
            the nuclear interior involved in the Tel1p pathway that
            controls telomere length involved in the retention of
            unspliced mRNAs in the nucleus
          Length = 1748

 Score =  395 bits (1014), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 355/1291 (27%), Positives = 679/1291 (52%), Gaps = 106/1291 (8%)

Query: 106  ELIDKVNGYETQFNELKIKNEGLNLKVSNLNIELENWKNNSNNFETEKLNYVXXXXXLSI 165
            E I++++  + + NE +  N+ L  KV N   EL+  +                   L +
Sbjct: 136  EKIEELSSTKAKLNEAQGANKELRQKVVNTETELQTQQ------------------ALEL 177

Query: 166  R-ESEIQRLKQEVTFLNENKSSLSEQWXXXXXXXXXXXXXXXXXXXXSTIKLEEATTTLK 224
            R +SEI R++QE+T L EN   L+ Q                     S +K+    + L+
Sbjct: 178  RSKSEILRMEQEITLLRENNDWLTNQLNTKTVQLNEFRESTISELQDSQLKVSNMESELE 237

Query: 225  SMEAKVSVLSDKNNDLTKKYENSIWEIKNLKDNLLVTKDDMNKEIAMKSKLIDLLQGQLS 284
                    L    + L ++ E  + E K +KD    +K ++ KE+++K ++ID L+  + 
Sbjct: 238  IARTSNQKLKQSVHSLHEQLEQKLSENKEIKDEYNFSKQELTKEMSLKQRMIDALEKHME 297

Query: 285  STQEEL---RQNV---------------ELNSKFTKFPDLESQNETLKSDIQDLT--LKI 324
            S ++E+   + N+               ELN+   +    ES    LK  I +LT  +K+
Sbjct: 298  SLKKEMDATKNNMDSSYFTEKERDELIEELNAVKYRLDASESNCIKLKETIDELTSNIKL 357

Query: 325  EELQNENFNLXXXXXXXXXXXXXXXXXXXXXXXLPTLYSKINLLKKQVTQEKLEKKHLQT 384
            E+ +  N                          +P LY  + +LKKQ+  EK +K  L+ 
Sbjct: 358  EDSEVGN---------------TTASSEKSVSVIPKLYGDLGMLKKQLVIEKRQKDELKM 402

Query: 385  QIESFIIELENKIPIISSFQEKNQAXXXXXXXXXXXXXXXXXXXXXIQNKLNNYDSKLLT 444
            Q+E+F++ELE+KIP+++SF+E+++                        ++L+   + + +
Sbjct: 403  QVEAFVVELEHKIPVLNSFKERSEMLERELNEVTILLESTGKDRDQKSSQLDYLKATVKS 462

Query: 445  YQSNIKELIRQRLDLANQVKHLLLFVAVKNDSGGPLTREEIEFINKISNNSEDLNGSELT 504
            Y++ I  L +QR+DLA+Q+++LL+  ++K++ GGPL+ EE++F+  ++N+ E    S+  
Sbjct: 463  YETQIASLSKQRVDLAHQIQYLLVNESIKSEDGGPLSAEELQFVKNLTNSQEITKTSD-- 520

Query: 505  SQHVISERLVTFSNIEELQAKNMELLNSIRSLSENLEN--IENANSHKEFQNKTIADAKE 562
            +Q +I++RLV F ++ ELQ KN ELL++IR+L++ LE    EN +  +  +++T+ +AKE
Sbjct: 521  TQGIITDRLVEFRSVVELQQKNSELLSTIRNLADELERREAENKSQIQVLEDETVREAKE 580

Query: 563  AILTLQYHNDILESKVKVLEAERDSFKLLLNNNVSIDSSIKNDDLSSSTSPETNEKSIEK 622
             ILTL  H   LE+++ +L  ERD++K L   +V+  S        +  SP+ ++K ++ 
Sbjct: 581  TILTLHDHAQNLENQLVILSKERDAYKAL---SVNASSGTNTPKAITYPSPDNDDK-VKD 636

Query: 623  LQTLIEELKAELKKNKDALESQIASFTADKSNLTISLEKEKSSNTLMAEKISLTESAFDM 682
            L+T +  +  E + N     S+ ++       ++++ E EK+S TL  ++++L +S  ++
Sbjct: 637  LETRLTAVIQEAENNAKEWSSENSNLRKKLYEISLNFESEKTSRTLAEDRLNLLQSTLEL 696

Query: 683  LKTENKELNKRFENLQNIIIKQESKLGDIINKYITGETEISNLKTQLSIAKSEKDFLVKS 742
             K + +EL KR  +LQ+I+ KQ+ +  + ++  I  ++ +S+++++LSI KSEK F+ K 
Sbjct: 697  SKRQCEELQKRSSDLQDILTKQDKRTQETVDSLIKTKSTLSSIQSELSILKSEKQFMAKV 756

Query: 743  QDSLNSELIKTSEEKNKLRIMLSQLQSLQNERMTLLDDTQKKFMSKIHELENNNLDLIKN 802
            Q  L +E  + S+E  + +++++QLQ+LQ ER  LL +TQ  +  K+ +LE   ++L  +
Sbjct: 757  QKELKAENERFSKESVEYKVLIAQLQTLQREREMLLKETQNSYKEKLRKLE---IELSGS 813

Query: 803  LGSKMTEIQK----LSISNESQCTWYQNTIDDLKKINSAIKTELTSK-------NSLISD 851
            L  ++ EI+K    ++ + E Q  W+Q  ID L    +  KT L  K        S I++
Sbjct: 814  L-ERLEEIEKNTTGIASNKEHQYNWFQEKIDKLTSEAAQQKTTLEEKEAQLQKMQSTINE 872

Query: 852  LNTKIELLES--QSYTIDTNTRCSSSGNDFSQISKDLDITKLHLSEAYTQVEEYKQLYTS 909
             + K++  E+  QSYT+ +N     + N    + ++L+   L LS++Y+Q+E +K L   
Sbjct: 873  QSAKLKEAEARAQSYTMLSN--VDDAQNLVETLRQELEKVNLQLSDSYSQIEHHKTLAEQ 930

Query: 910  TEESLKTLESNFESVKNLMDDKISKLLSENETLKASTGEYDKRISELSTDLKNEKNKYSE 969
            + +S+  +   FE  +      I  L +E   L+++    + ++ +L+ ++ ++K++Y  
Sbjct: 931  SVQSVNEVSQAFEEAQKESQKTIITLENERNQLQSTVNILNDQVKDLNNEIFHQKSEYQT 990

Query: 970  EIAQLNVQITRLNKFKKDSADTASEYEEKISKLQSQLELKAKFADNAQEKYESLLTKDNA 1029
            E      +I++L   K+    T ++YEEKI+ +Q  LE++ ++A+ +Q  YE        
Sbjct: 991  ERNATMEEISKLQMVKESVDRTKADYEEKIAMIQKDLEMQTQYANESQRSYE-------L 1043

Query: 1030 NLQSIEEFKEQIEKLNQRIVIIESDLEK---KTSLLSEN----ESLWKKKQDAFISDLEE 1082
             LQ   +  + I  L       +SDLE    ++ L  EN    E LW +++  +   L  
Sbjct: 1044 ELQKHADVSKTITSLRTEAQSYKSDLETLKTQSQLAMENLKNSEKLWNEQKTEYEDKLSV 1103

Query: 1083 SKKKIDNLTNQNKLYVDQLELLNKDFXXXXXXXXXXETKHMFNRLRADRDVLETKLSIAE 1142
             ++++  L+ QNKL  DQ+ELLNK            ++  +   LR +RD+LETKL +A 
Sbjct: 1104 LEQRVQELSTQNKLLYDQIELLNK----TEDRDNSHDSSDLLISLRRERDMLETKLEVAL 1159

Query: 1143 RDSKNNASKLESLRDELANVQMKLISSENKLLRHSDLIENHEKIVSELNQITLFKESNET 1202
             +      +L+  + E+ ++  +L   +N     + L+E  E I+ EL+Q+ L +ESN T
Sbjct: 1160 SEQTVLKQRLDIAKSEIEDLNTQLSQVKNSSSESAHLLEQQENIMKELDQLHLLRESNVT 1219

Query: 1203 LRNQVSELNEKNKTLQTKLNEENSKLSNLSMELKSVKESLGDKETDIMLIKEESNKWRLR 1262
            LR++ S   ++   L+++L E N +L+ L   + S++  +  KE +++  KEE+ +W+ R
Sbjct: 1220 LRSENSSFKKECDNLKSQLQECNDRLAPLQSSISSLQNGIKIKEQELIQSKEEAERWKSR 1279

Query: 1263 AEELSVQIDKVDLDSVSKLSTELDALKDDAETKR-------KQNAELEERFNLLKKQAHE 1315
            ++++  + +++D +   KL  E++ +K++ +T +        +  + E +F  ++ QA +
Sbjct: 1280 SQDILHKYERIDPEEHGKLKEEINDVKNELQTTKDTLQSVIAEKDDWESKFQRIRLQARD 1339

Query: 1316 RLNASKEIQSSLNKQINELKASNTNIELALS 1346
            RLNASKE + SL+ +IN++  + + +E  L 
Sbjct: 1340 RLNASKEKEQSLSSEINQINEAKSQVEADLG 1370

 Score =  106 bits (264), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 76/179 (42%), Positives = 103/179 (57%), Gaps = 20/179 (11%)

Query: 1492 SLKKEWEEEYEKATLERIEEAKETLKKRIRLPSETKINRVIEKRKHELENEYEVKLQEKL 1551
            +LK EWE+EYEK TLE+I+ A+E LKKRIRLP++ KI++++E RK  LE  +E K+ EK 
Sbjct: 1551 ALKNEWEKEYEKQTLEKIKLAEEALKKRIRLPTQQKIDKIVEARKAVLEESFEEKVNEKA 1610

Query: 1552 NEIEANRNSIETIDPGKLREEIKEEVKRDMLIKFENDLNEAKKKSFEEGKQQSSMKTTLL 1611
             ++ A     + I   K R E+   +K  M  +FE DL E K+KSFEEGKQQ S+K   L
Sbjct: 1611 QKL-AGEIGNDAITLEKHRAELN-ALKDSMRKQFEADLAEIKQKSFEEGKQQVSLKLKFL 1668

Query: 1612 ERKISKLESQLSEAIENDKQSDKNPIISDLAQTSTLASIQPPSAKKPAFSFGGFNTTNS 1670
            E KI  LE Q         +S   P+ +D +  S  A+ Q P        FG  +T  S
Sbjct: 1669 ESKIRNLEQQ---------KSTIKPVENDTSNMS--AAFQAP-------VFGSHSTFTS 1709

>NDAI0E05040 Chr5 (1150358..1156279) [5922 bp, 1973 aa] {ON} Anc_5.702
            YIL149C
          Length = 1973

 Score =  375 bits (963), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 363/1297 (27%), Positives = 666/1297 (51%), Gaps = 51/1297 (3%)

Query: 89   KLTSLGGKLATVETEKKELIDKVNGYETQFNELKIKNEGLN---LKVSNLNIELENWKNN 145
            ++ SL   ++ ++++K+ELI  ++   T+ NE +   E LN    K  N  ++LEN   +
Sbjct: 126  QIHSLEENVSELQSKKQELIKSLDDRITELNEYRHNIELLNNEKSKTRNKILQLENENQD 185

Query: 146  SNNFETEKLNYVXXXXXLSIRESEIQRLKQEVTFLNENKSSLSEQWXXXXXXXXXXXXXX 205
                   K+N       LS R ++++RL QE+  +N+ K  L E+               
Sbjct: 186  L------KIN------DLSQR-TQLERLSQELETINKEKLWLEERLGEKGEQFDSYREKS 232

Query: 206  XXXXXXSTIKLEEATTTLKSMEAKVSVLSDKNNDLTKKYENSIWEIKNLKDNLLVTKDDM 265
                    ++L      L  M++   VL ++ ++L+ K  ++   +KN++ +    K   
Sbjct: 233  INENQDLKLQLNTVKNELDQMKSTNCVLQERTDELSNKLRDTSTNLKNIQQSRNNDKATH 292

Query: 266  NKEIAMKSKLIDLLQGQLSSTQEELRQNVELNSKFTKFPDLESQNETLKSDIQDLTLKIE 325
             KE+ +K +LI +LQ QL+  Q E     EL+   +       ++     +I DL  ++ 
Sbjct: 293  EKELTLKQQLIVVLQSQLNELQRE--NGNELSLTVSDTASSSRKDSDFTREINDLKNQLN 350

Query: 326  ELQNENFNLXXXXXXXXXXXXXXXXXXXX--XXXLPTLYSKINLLKKQVTQEKLEKKHLQ 383
             +Q  N  L                         L   Y  I++LKK++  E+ ++++ +
Sbjct: 351  HVQERNVELEFKLRKSEDYTAVSNSTSSDDLRNSLAKAYDDIDVLKKKLNDEQSQRENFE 410

Query: 384  TQIESFIIELENKIPIISSFQEKNQAXXXXXXXXXXXXXXXXXXXXXIQNKLNNYDSKLL 443
              +E F+ +LE ++P + +++ +  A                     + ++LN   S++ 
Sbjct: 411  KNLEEFMDDLETELPTLEAYRHRAAAREEELKEATLLLEKANKEKSLVSSELNQAQSRIQ 470

Query: 444  TYQSNIKELIRQRLDLANQVKHLLLFVAVKNDSGGPLTREEIEFINKISNNSEDLNGSEL 503
            + +  IK + +QR DLANQ++  L+  +V NDS GPLT EE++FI  I    ++++  E 
Sbjct: 471  SIEQEIKLVAKQRSDLANQLQFFLVHNSVANDSAGPLTDEEVKFIRNIIQEDDEMHDKET 530

Query: 504  TSQHVISERLVTFSNIEELQAKNMELLNSIRSLSENLE---NIENANSHKEFQNKTIADA 560
             +Q VISERL  F +I ELQ KNMELL + R L+  LE    I+ A   +  + +TIA+A
Sbjct: 531  DTQKVISERLTKFKDIIELQQKNMELLKTTRELATKLEEEDKIKQAEKSR-IEEETIAEA 589

Query: 561  KEAILTLQYHNDILESKVKVLEAERDSFKLLLNNNVSIDSSIKND-DLSSSTSPETNEKS 619
            KEAILTLQ +N  L +K+  L  E +++K+L N     DSS   D D         + + 
Sbjct: 590  KEAILTLQNYNSSLTAKIAALTKELETYKVLSNTE---DSSTPADFDKQREQREIEHTQL 646

Query: 620  IEKLQTLIEELKAELKKNKDALESQIASFTADKSNLTISLEKEKSSNTLMAEKISLTESA 679
            +++L+T I  +  E K+N + L  +I +     ++++I L +EKS+  L  E++ L + +
Sbjct: 647  VKELETRIASIIQESKENANILNDKIFALDEKNNHISIELAREKSAKQLAEERLKLLQKS 706

Query: 680  FDMLKTENKELNKRFENLQNIIIKQESKLGDIINKYITGETEISNLKTQLSIAKSEKDFL 739
             DM  TEN+ L KR  +L+N++++Q+ +  + IN  I   +E++ ++ + +++++E   L
Sbjct: 707  MDMTITENERLQKRLNSLRNVVVEQDKRTHETINSLIKTRSELATVENKWNVSQNEIKLL 766

Query: 740  VKSQDSLNSELIKTSEEKNKLRIMLSQLQSLQNERMTLLDDTQKKFMSKIHELENNNLDL 799
              S++ L +EL + +EEKN +++++++LQ+LQ+ER  LL  TQ KF  ++++LE    DL
Sbjct: 767  HSSEEMLKNELTRLNEEKNSMKLLVTRLQTLQSEREHLLSTTQDKFNKELNDLEGTCNDL 826

Query: 800  IK-------NLGSKMTEIQKLSISNESQCTWYQNTIDDLKKINSAI---KTELTSKNS-L 848
             K       N GS M E  +L      +    +  + +++K  S I   + E   +N+ L
Sbjct: 827  RKKLKEAEENYGSLMEETTELKDDFRQKKKSLKEEMSNVEKRYSEIVEKERETKWENTRL 886

Query: 849  ISDLNTKIELLESQSYTIDTNTRCSSSGNDFSQISKDLDITKLHLSEAYTQVEEYKQLYT 908
               L  K EL+E      D   +      + S + K+L + K  L+E+Y+Q E Y++   
Sbjct: 887  TKQLKEKTELIEKYKAASDDEGKLE----EISSLQKELQVLKNELTESYSQTESYRKDIE 942

Query: 909  STEESLKTLESNFESVKNLMDDKISKL-LSENETLKASTGEYDKRISELSTDLKNEKNKY 967
               +S+  +     + +    ++I+++ L++N    ++T     +I +L+ +L+ +K  Y
Sbjct: 943  LLNQSIADINKQVLNKEAAFKERITEVELAKNNIADSNTV-LKTQIDDLNNELEVQKKLY 1001

Query: 968  SEEIAQLNVQITRLNKFKKDSADTASEYEEKISKLQSQLELKAKFADNAQEKYESLLTKD 1027
             +E          L +  K    +  +YE+K+  L   LE + K+A+ AQ  YE  L ++
Sbjct: 1002 EDEKINFTRNANELERVTKGLEQSKRDYEDKLKSLMKDLEEQVKYANKAQNNYEQEL-QN 1060

Query: 1028 NANL-QSIEEFKEQIEKLNQRIVIIESDLEKKTSLLSENESLWKKKQDAFISDLEESKKK 1086
            +AN+ ++I + +EQ +     I  +         LL+EN+  W+K++D +   +E  KK+
Sbjct: 1061 HANVSKTISQLREQTQHYRTEIAELTISATDAKRLLNENQISWQKQRDEYEKQIEFFKKR 1120

Query: 1087 IDNLTNQNKLYVDQLELL----NKDFXXXXXXXXXXETKHMFNRLRADRDVLETKLSIAE 1142
            I+  + QNK+  +Q +L     ++D               +   LR++RD+L+ +L++ E
Sbjct: 1121 IEEESEQNKMLFEQSKLTTQANDEDNAESSGVNSIEGDNKLVLSLRSERDLLQERLNVTE 1180

Query: 1143 RDSKNNASKLESLRDELANVQMKLISSENKLLRHSDLIENHEKIVSELNQITLFKESNET 1202
             + K    +L S+  +     ++L   + +   + DL+E H+ ++S+L Q+ L +ESN T
Sbjct: 1181 AEEKLLRERLTSIEKDFRATDLELQKIKEETHNYPDLLEQHKTVMSQLTQLDLLRESNIT 1240

Query: 1203 LRNQVSELNEKNKTLQTKLNEENSKLSNLSMELKSVKESLGDKETDIMLIKEESNKWRLR 1262
            LRN+  EL  KN+ LQT++   + KL  L  EL+++   + +K+  + +  EES +W+ R
Sbjct: 1241 LRNETIELQSKNQHLQTEVENLHDKLLPLETELQTLTNLIEEKDKQLSICHEESERWKQR 1300

Query: 1263 AEELSVQIDKVDLDSVSKLSTELDALKDDAETKRKQNAELEERFNLLKKQAHERLNASKE 1322
            ++++  +  ++D      L+ E + L+   E K K+N EL  RF  LKKQAHE+LNASK 
Sbjct: 1301 SQDILSKYQRIDPVEHENLAEERNRLQAQLEEKSKENEELGNRFEKLKKQAHEKLNASKI 1360

Query: 1323 IQSSLNKQINELKASNTNIELALSSEQKKSMDLQNTL 1359
             Q+SL  QIN+L+A    +   L +E++  + L+  L
Sbjct: 1361 SQNSLTIQINDLEAKKKELLSQLETEKEGKLSLEKRL 1397

 Score =  119 bits (299), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 73/162 (45%), Positives = 111/162 (68%), Gaps = 7/162 (4%)

Query: 1492 SLKKEWEEEYEKATLERIEEAKETLKKRIRLPSETKINRVIEKRKHELENEYEVKLQEKL 1551
            +++K+ EEEYE+AT +RI+EA+E LK+RIRLP+E KIN+VI+KR+ +LENE++ K++ + 
Sbjct: 1540 AIRKQIEEEYEQATSQRIKEAEENLKRRIRLPTEEKINKVIDKRRTQLENEFQNKVEARA 1599

Query: 1552 NEIEANRNSIETIDPGKLREEIKEEVKRDMLIKFENDLNEAKKKSFEEGKQQSSMKTTLL 1611
             E+       E  D  ++++EI+EE+ R    K+E +L   KKK+F+EG+QQ  MKT+ L
Sbjct: 1600 KELLTGDEKNEFFD--RMKKEIQEELAR----KYEEELQVVKKKAFDEGRQQVLMKTSFL 1653

Query: 1612 ERKISKLESQLSEAIENDKQSDKNPIISDLAQTSTLASIQPP 1653
            E+KI+KLES L  A  N   +D N I+S   +T    S + P
Sbjct: 1654 EKKITKLESDLQNAKSNTGATD-NTIVSTDNETKYEGSDKKP 1694

>Skud_9.19 Chr9 complement(40103..45145) [5043 bp, 1680 aa] {ON}
            YIL149C (REAL)
          Length = 1680

 Score =  301 bits (772), Expect = 4e-82,   Method: Compositional matrix adjust.
 Identities = 335/1181 (28%), Positives = 592/1181 (50%), Gaps = 101/1181 (8%)

Query: 215  KLEEATTTLKSMEAKVSVLSDKNNDLTKKYENSIWEIKNLKDNLLVTKDDMNKEIAMKSK 274
            KL +  T  +S+      L D+N  L+   E  + EIKNLKD     K + +KE+ ++ K
Sbjct: 219  KLNQTQTENESVSTYNKFLLDQNKKLSHLVEEKLLEIKNLKDTANTEKSEFSKEMTLQKK 278

Query: 275  LIDLLQGQLSSTQ--EELRQNVELNSKFTKFPDLESQNETLKSDIQDLTLKIEELQNENF 332
            + DLL+ QL+S +    LR   + + K  K P+    +  +  ++ D  LK+E+ + E  
Sbjct: 279  MNDLLRSQLTSFERGHSLRPKEKGDDKLCKNPE----HIDVAEELIDAKLKLEKSKEECQ 334

Query: 333  NLXXXXXXXXXXXXXXXXXXXXXXXLPTLYSKINLLKKQVTQEKLEKKHLQTQIESFIIE 392
             L                       +  L+S I  LK+Q+ +E+ +K  +Q Q++ F++E
Sbjct: 335  LLKNIVSDCIEENGTTVNTNTAAPTVGKLFSNIKTLKRQLVKERSQKFQVQNQLKDFVLE 394

Query: 393  LENKIPIISSFQEKNQAXXXXXXXXXXXXXXXXXXXXXIQNKLNNYDSKLLTYQSNIKEL 452
            LE+K P + SF+E+ +                       + KL + + K+ +Y++NI  L
Sbjct: 395  LEHKTPALVSFKERTELLEHELKCSTELLETMSLAKRKDEKKLTSLEQKINSYEANIHSL 454

Query: 453  IRQRLDLANQVKHLLLFVAVKNDSGGPLTREEIEFINKISNNSEDLNGSELTSQHVISER 512
            +RQRLDLA QVK LL  ++    +  PL+ +E+  + K+  +   +N  E  SQ +I+E+
Sbjct: 455  VRQRLDLARQVKILLSNISAIQTTTSPLSNDELMSLRKLLESENTVN--ERDSQIIITEK 512

Query: 513  LVTFSNIEELQAKNMELLNSIRSLSENLENIENA--NSHKEFQNKTIADAKEAILTLQYH 570
            LV F NI+ELQ KNMELL+ IR L++ LE  E     +  + +N+TI +AKEAI+ ++  
Sbjct: 513  LVEFKNIDELQEKNMELLDCIRILADKLETNEGEADKTVAKIENQTIKEAKEAIIEMESI 572

Query: 571  NDILESKVKVLEAERDSFKLLLNNNVSIDSSIKNDDLSSSTSPETNEKSIEKLQTLIEEL 630
            N  L  +V +L  ERDS+KLL + N   D+    D  +   +  T EK I +LQ+ +   
Sbjct: 573  NSKLALRVNILTRERDSYKLLASAN---DNKTHAD--TEGITEATYEKKIRELQSKLSST 627

Query: 631  KAELKKNKDALESQIASFTADKSNLTISLEKEKSSNTLMAEKISLTESAFDMLKTENKEL 690
            + E       L  Q+ ++   +++  I+L++ ++   L+AEK ++ +   + LKT+ ++ 
Sbjct: 628  RVESSAIIQNLNGQLLTYKKSQTDGKIALQEFENFKVLVAEKEAMLQERINHLKTQLEK- 686

Query: 691  NKRFENLQNIIIKQESKLGDIINKYITGETEISNLKTQLSIAKSEKDFLVKSQDSLNSEL 750
             +R      +   + S L D+ +     E +I +LK ++S  K E   L+  ++SL  +L
Sbjct: 687  -QRLSAAPPVQDYKYSNLTDLSH----SENKIGSLKYEISNLKKENTGLIAMKESLTRDL 741

Query: 751  IKTSEEKNKLRIMLSQLQSLQNERMTLLDDTQKKFMSKIHELENNNLDLIKNLGSKMTEI 810
             +  +EK +L + LS+ ++  NE+  +    + ++ ++I  LE N  +L   L SK  EI
Sbjct: 742  ERCCKEKMQLHVKLSESETSHNEQNLIFGSKELQYSTRIKVLEKNLKELNVRLESKEQEI 801

Query: 811  QKLSISNESQCTWYQNTIDDLKKINSAIKTELTSKNSLISDLNTKIELLESQ-------- 862
            + L  S  SQ  W QNTIDD +K   ++  EL++K + I  L+ +IE L ++        
Sbjct: 802  KTLQSSKNSQLKWAQNTIDDTEKNLKSVSAELSNKETTIGRLSLEIENLGNELRMTKLQY 861

Query: 863  ---SYTIDTNTRCSSSGNDFSQISKDLDITKLHLSEAYTQVEEYKQLYTSTEESLKTLES 919
               S T DTNT   +       + K+L  T++ L +A++Q++ Y+++ ++ E  LK L  
Sbjct: 862  KFLSNTSDTNTLEPT-------LRKELKQTQIELKDAHSQIKAYEEIISTNENVLKELNG 914

Query: 920  NFESVKNLMDDKISKLLSENETLKASTGEYDKRISELSTDLKNEKNKYSEEIAQLNVQIT 979
              +  K   +D  +K+  EN+   A   E      EL  +++  + K  E  + L +Q  
Sbjct: 915  ELKKAK---EDCETKIQLENKEKGAKEEELSHLRKELD-EIRCLQPKLREGASYLVLQSE 970

Query: 980  RLNKFKKDSADTASEYEEKISKLQSQLELKAKFADNAQEKYESLLTKDNANLQSIEEFKE 1039
            ++     D A    E + KI K+ + +E        A +K ES  ++  + L++ ++  E
Sbjct: 971  KVG----DQAQRIQEMKNKIDKMAAIIE--------AYQKEES--SQYQSELKTNKDLSE 1016

Query: 1040 QIEKLNQRIVIIESDLEK-KTSLLSENESL------WKKKQDAF----ISDLEESK---- 1084
             + +L +     +++L+K K SL S  E L      W +++  +    IS++E+++    
Sbjct: 1017 WVMRLEKEAFDYQTELKKTKKSLYSTQELLDRHEKKWMEEKADYERELISNIEQTESLRV 1076

Query: 1085 ------KKIDNLT---NQNKLYVDQLELLNKDFXXXXXXXXXXETKHMFNRLRADRDVLE 1135
                  +KID  T   N N+ Y   LEL++                 +F+ LR +R  LE
Sbjct: 1077 ENSVLIEKIDGATEGSNSNEKY---LELVS-----------------LFSNLRHERSSLE 1116

Query: 1136 TKLSIAERDSKNNASKLESLRDELANVQMKLISSENKLLRHSDLIENHEKIVSELNQITL 1195
            TKL+  +RD      K  SL   + ++Q       NK+   + +I+ +EKI+ E+ Q+ +
Sbjct: 1117 TKLTTCKRDLALLRQKNASLEKSIGDLQRANTVPRNKVQCPAVIIDEYEKIIKEIAQVNI 1176

Query: 1196 FKESNETLRNQVSELNEKNKTLQTKLNEENSKLSNLSMELKSVKESLGDKETDIMLIKEE 1255
             +E+N  L   +  + EKN+ +  +L     ++S L   L   KE +      ++  + E
Sbjct: 1177 LRENNAILHKSLKNVTEKNEAIYKELINMQEEISRLQGHLIQTKEQVSINANKVLAYESE 1236

Query: 1256 SNKWRLRAEELSVQIDKVDLDSVSKLSTELDALKDDAETKRKQNAELEERFNLLKKQAHE 1315
              + + R ++LS Q      +   KL   +  L+      +  NA+LE +FN LKKQAHE
Sbjct: 1237 IEQCKQRYQDLSQQQKLTHKNETEKLHNVIGDLEVKLLNVQNANADLENKFNRLKKQAHE 1296

Query: 1316 RLNASKEIQSSLNKQINELKASNTNIELALSSEQKKSMDLQ 1356
            +L+ASK+ Q++L  ++NELK +   +E  L +E+ K +DL+
Sbjct: 1297 KLDASKKQQTALTNELNELKETKDKLEENLHNEESKVVDLE 1337

 Score = 77.4 bits (189), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 93/303 (30%), Positives = 140/303 (46%), Gaps = 75/303 (24%)

Query: 1488 EEFQSLKKEWEEEYEKATLERIEEAKETLKKRIRLPSETKINRVIEKRKHELENEYEVKL 1547
            E  ++LKKEW +EYE+ T++RI+EA+E LKKRIRLPSE +I ++I KRK ELE E+E KL
Sbjct: 1430 EHIEALKKEWLKEYEEETVKRIKEAEENLKKRIRLPSEERIQKIISKRKGELEQEFERKL 1489

Query: 1548 QEKLNEIEANRNSIETIDPGKLREEIKEEVKRDMLIKFENDLNEAKKKSFEEGKQQSSMK 1607
            +E         N+   +  G   EE ++E+            N   K S E    + S+ 
Sbjct: 1490 KE---------NNKSLVFSGSNEEEAEDEL-----------WNSPSKGSSE----KPSVV 1525

Query: 1608 TTLLERKISKLESQLSEAIENDKQSDKNPI-------ISDLAQTSTLASIQPPSAKKPAF 1660
            T L+++K  KL+ QL         +DK P        I D    S  A  + PS    AF
Sbjct: 1526 TDLIKQKNIKLQEQLKNVKNAVTFNDKRPKSENKENNIPD----SAAADNRVPS----AF 1577

Query: 1661 SFGGFNTTNSLNANKGFXXXXXXXXXXXKDTEIVQNPFSLGVS--QTSSSPMHFNPFS-- 1716
            SFG    +++ ++ + F                  NPF+   +   T  S   FN  S  
Sbjct: 1578 SFGKPLFSSNTSSFQSF-----------------HNPFTPSAANFSTDGSLPTFNIKSAF 1620

Query: 1717 SSATTSNVFNQNGTSKNIFGN---VMAMKPTTPTVEQAIKPLESVTPTET-----PEVPE 1768
            ++ T  N    +  + N+  N   VM +  T+       +P++S T ++       E PE
Sbjct: 1621 AAGTAGNTLKTSDPA-NVGINEAKVMEIGNTSK------RPIQSDTSSDPDSKKFKESPE 1673

Query: 1769 DDL 1771
            +DL
Sbjct: 1674 NDL 1676

>YIL149C Chr9 complement(63028..68067) [5040 bp, 1679 aa] {ON}
            MLP2Myosin-like protein associated with the nuclear
            envelope, connects the nuclear pore complex with the
            nuclear interior; involved in the Tel1p pathway that
            controls telomere length
          Length = 1679

 Score =  301 bits (770), Expect = 8e-82,   Method: Compositional matrix adjust.
 Identities = 337/1214 (27%), Positives = 608/1214 (50%), Gaps = 93/1214 (7%)

Query: 233  LSDKNNDLTKKYENSIWEIKNLKDNLLVTKDDMNKEIAMKSKLIDLLQGQLSSTQEE--L 290
            L ++N  L++  E  + E+KNLKD   V K + +KE+ ++  + DLL+ QL+S +++  L
Sbjct: 237  LLNQNKQLSQSVEEKVLEMKNLKDTASVEKAEFSKEMTLQKNMNDLLRSQLTSLEKDCSL 296

Query: 291  RQNVELNSKFTKFPDLESQNETLKSDIQDLTLKIEELQNENFNLXXXXXXXXXXXXXXXX 350
            R   + +    + P+    +  +  ++ D  L++E+ +NE   L                
Sbjct: 297  RAIEKNDDNSCRNPE----HTDVIDELIDTKLRLEKSKNECQRLQNIVMDCTKEEEATMT 352

Query: 351  XXXXXXXLPTLYSKINLLKKQVTQEKLEKKHLQTQIESFIIELENKIPIISSFQEKNQAX 410
                   +  L+S I +LK+Q+ +E+ +K  LQ Q+E FI+ELE+K P + SF+E+ ++ 
Sbjct: 353  TSAVSPTVGKLFSDIKVLKRQLIKERNQKFQLQNQLEDFILELEHKTPELISFKERTKSL 412

Query: 411  XXXXXXXXXXXXXXXXXXXXIQNKLNNYDSKLLTYQSNIKELIRQRLDLANQVKHLLLFV 470
                                 + ++ +   K+   ++NI  L++QRLDLA QVK LLL  
Sbjct: 413  EHELKRSTELLETVSLTKRKQEREITSLRQKINGCEANIHSLVKQRLDLARQVKLLLLNT 472

Query: 471  AVKNDSGGPLTREEIEFINKISNNSEDLNGSELTSQHVISERLVTFSNIEELQAKNMELL 530
            +   ++  PL+++E+  + KI  +S  +N ++  SQ +I+ERLV FSN+ ELQ KN+ELL
Sbjct: 473  SAIQETASPLSQDELISLRKILESSNIVNEND--SQAIITERLVEFSNVNELQEKNVELL 530

Query: 531  NSIRSLSENLENIENANSH--KEFQNKTIADAKEAILTLQYHNDILESKVKVLEAERDSF 588
            N IR L++ LEN E       ++ +N+TI +AK+AI+ L+  N  +E+++ +L  ERDS+
Sbjct: 531  NCIRILADKLENYEGKQDKTLQKVENQTIKEAKDAIIELENINAKMETRINILLRERDSY 590

Query: 589  KLLLNNNVSIDSSIKNDDLSSSTSPET-NEKSIEKLQTLIEELKAELKKNKDALESQIAS 647
            KLL     S + +  N +  S TS E   EK I +L+  +   K E       L  ++  
Sbjct: 591  KLL----ASTEENKANTN--SVTSMEAAREKKIRELEAELSSTKVENSAIIQNLRKELLI 644

Query: 648  FTADKSNLTISLEKEKSSNTLMAEKISLTESAFDMLKTENKELNKRFENLQNII-IKQES 706
            +   +     +LE  ++   L  EK  + E A D LK E   L K+   + + I +++E 
Sbjct: 645  YKKSQCKKKTTLEDFENFKGLAKEKERMLEEAIDHLKAE---LEKQKSWVPSYIHVEKER 701

Query: 707  KLGDIINKYITGETEISNLKTQLSIAKSEKDFLVKSQDSLNSELIKTSEEKNKLRIMLSQ 766
               ++    I    +I +L+ ++S  K E    + +++SL  +  +  +EK +L++ L +
Sbjct: 702  ASTELSQSRI----KIKSLEYEISKLKKETASFIPTKESLTRDFEQCCKEKKELQMRLKE 757

Query: 767  LQSLQNERMTLLDDTQKKFMSKIHELENNNLDLIKNLGSKMTEIQKLSISNESQCTWYQN 826
             +   NE        + ++ +KI ELENN   L  +L SK+ EI+ +    +SQ  W QN
Sbjct: 758  SEISHNENKMDFSSKEGQYKAKIKELENNLERLRSDLQSKIQEIESIRSCKDSQLKWAQN 817

Query: 827  TIDDLKKINSAIKTELTSKNSLISDLNTKIELLES-------QSYTIDTNTRCSSSGNDF 879
            TIDD +    ++ TEL++K + I  L+++IE L+        Q   +D N+  S+     
Sbjct: 818  TIDDTEMKMKSLLTELSNKETTIEKLSSEIENLDKELRKTKFQYKFLDQNSDASTLE--- 874

Query: 880  SQISKDLDITKLHLSEAYTQVEEYKQLYTSTEESLKTLESNFESVKNLMDDKI----SKL 935
              + K+L+  ++ L +A +Q++ Y+++ +S E +L  L++     K   D KI     + 
Sbjct: 875  PTLRKELEQIQVQLKDANSQIQAYEEIISSNENALIELKNELAKTKENYDAKIELEKKEK 934

Query: 936  LSENETLKASTGEYDKRISELSTDLKNEKNKYSEEIAQLNVQITRLNKFKKDSADTASEY 995
             +  E L    GE  + I  L   LK     + ++  +L  ++ R+ K            
Sbjct: 935  WAREEDLSRLRGELGE-IRALQPKLKEGALHFVQQSEKLRNEVERIQKMI---------- 983

Query: 996  EEKISKLQSQLELKAKFADNAQEKYESLLTKDNANLQSIEEFKEQIEKLNQRIVIIESDL 1055
             EKI K+ + ++L  K       +Y+S + K+N +L  +      + +L +     +++L
Sbjct: 984  -EKIEKMSTIVQLCKK---KEMSQYQSTM-KENKDLSEL------VIRLEKDAADCQAEL 1032

Query: 1056 EKKTS-------LLSENESLWKKKQDAFISDLEESKKKIDNLTNQNKLYVDQLELLNKDF 1108
             K  S       LL ++E  W +++  +  +L  + ++ ++L  +N + +++++    D 
Sbjct: 1033 TKTKSSLYSAQDLLDKHERKWMEEKADYERELISNIEQTESLRVENSVLIEKVD----DT 1088

Query: 1109 XXXXXXXXXXETKHMFNRLRADRDVLETKLSIAERDSKNNASKLESLRDELANVQMKLIS 1168
                      +   +F+ LR +R+ LETKL+  +R+      K +SL   + ++Q     
Sbjct: 1089 AANNGDKDHLKLVSLFSNLRHERNSLETKLTTCKRELAFVKQKNDSLEKTINDLQRTQTL 1148

Query: 1169 SENKLLRHSDLIENHEKIVSELNQITLFKESNETLRNQVSELNEKNKTLQTKLNEENSKL 1228
            SE +    + +I+  + I  E+ Q+ + KE+N  L+  +  + EKN+ +  +LN+   ++
Sbjct: 1149 SEKEYQCSAVIIDEFKDITKEVTQVNILKENNAILQKSLKNVTEKNREIYKQLNDRQEEI 1208

Query: 1229 SNLSMELKSVKESLGDKETDIMLIKEESNKWRLRAEELSVQIDKVDLDSVSKLSTELDAL 1288
            S L  +L   KE +      I++ + E  + + R ++LS Q        + KL+ E+  L
Sbjct: 1209 SRLQRDLIQTKEQVSINSNKILVYESEMEQCKQRYQDLSQQQKDAQKKDIEKLTNEISDL 1268

Query: 1289 KDDAETKRKQNAELEERFNLLKKQAHERLNASKEIQSSLNKQINELKASNTNIELALSSE 1348
            K    +    NA+LE +FN LKKQAHE+L+ASK+ Q++L  ++NELKA    +E  L  E
Sbjct: 1269 KGKLSSAENANADLENKFNRLKKQAHEKLDASKKQQAALTNELNELKAIKDKLEQDLHFE 1328

Query: 1349 QKKSMDLQNTLSDNEVK------------YTQKLSNIES---ELKALKTENNS------F 1387
              K +DL   L  +E++            Y   +  IES   EL+  KT N+S       
Sbjct: 1329 NAKVIDLDTKLKAHELQSEDVSRDHEKDTYRTLMEEIESLKKELQIFKTANSSSDAFEKL 1388

Query: 1388 KLSSEKEKMELTDE 1401
            K++ EKEK  + DE
Sbjct: 1389 KVNMEKEKDRIIDE 1402

 Score = 74.3 bits (181), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 37/61 (60%), Positives = 48/61 (78%)

Query: 1489 EFQSLKKEWEEEYEKATLERIEEAKETLKKRIRLPSETKINRVIEKRKHELENEYEVKLQ 1548
            + ++LKKEW +EYE  TL RI+EA+E LKKRIRLPSE +I ++I KRK ELE E+  KL+
Sbjct: 1428 DIETLKKEWLKEYEDETLRRIKEAEENLKKRIRLPSEERIQKIISKRKEELEEEFRKKLK 1487

Query: 1549 E 1549
            E
Sbjct: 1488 E 1488

>Suva_9.39 Chr9 complement(57700..62748) [5049 bp, 1682 aa] {ON}
            YIL149C (REAL)
          Length = 1682

 Score =  296 bits (759), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 329/1134 (29%), Positives = 566/1134 (49%), Gaps = 90/1134 (7%)

Query: 236  KNNDLTKKYENSIWEIKNLKDNLLVTKDDMNKEIAMKSKLIDLLQGQLSSTQEELRQNVE 295
            +N  L+   E  I EIKNLKD + + K D +KE+ ++  + DLL+ QL+S      +N  
Sbjct: 240  QNKQLSHSMEQKILEIKNLKDTVNIEKADFSKEMTLQKNMNDLLRSQLTS----FEKNYS 295

Query: 296  LNS--KFTKFPDLESQNETLKSDIQDLTLKIEELQNENFNLXXXXXXXXXXXXXX-XXXX 352
            L++  K    P   SQ+  +   + D  L++E+ ++E   L                   
Sbjct: 296  LSAREKDNDDPCKNSQHANVVDKLIDTKLQLEKSKDECQRLQNIVADCIEEDEAAFDNTH 355

Query: 353  XXXXXLPTLYSKINLLKKQVTQEKLEKKHLQTQIESFIIELENKIPIISSFQEKNQAXXX 412
                 +  ++S I  LK+Q+ +E+ +K  LQ Q+ESFI ELE K P + SF+E+ ++   
Sbjct: 356  NVDPSVNKVFSDIKALKRQLIKERNQKFQLQNQMESFIKELERKTPELISFKERTESLEQ 415

Query: 413  XXXXXXXXXXXXXXXXXXIQNKLNNYDSKLLTYQSNIKELIRQRLDLANQVKHLLLFVAV 472
                               + +L +   K+   ++NI  L++QRLDLA QVK LLL ++ 
Sbjct: 416  ELKNSTDLLETISLAKRKDEKELTSLRQKINNCEANIHSLVKQRLDLARQVKLLLLNISA 475

Query: 473  KNDSGGPLTREEIEFINKISNNSEDLNGSELTSQHVISERLVTFSNIEELQAKNMELLNS 532
                  PL+ +E+  + K+  + +  N  E  SQ +I+ERLV F+N  ELQ KNMELLN 
Sbjct: 476  VQKKASPLSNDELISLKKLLESGDVPN--EKDSQIIITERLVEFNNTNELQEKNMELLNC 533

Query: 533  IRSLSENLENIENAN--SHKEFQNKTIADAKEAILTLQYHNDILESKVKVLEAERDSFKL 590
            +R L++ LEN E     S  + +N+TI +AK+AI+ L++ N  LES++ +L  ERDS+KL
Sbjct: 534  VRVLADKLENHEGKQDKSLAKLENQTIKEAKDAIIELEHVNSTLESRIDILSRERDSYKL 593

Query: 591  LLNNNVSIDSSIKNDDLSSSTSPETNEKSIEKLQTLIEELKAELKKNKDALESQIASFTA 650
            L + N    + I  D  +++ +   N K I++L++ +   K E       L  ++ +   
Sbjct: 594  LASAN---GNKIYAD--AANKTEAANLKKIKELESELSLTKVENSAVVQRLNKELLTCKK 648

Query: 651  DKSNLTISLEKEKSSNTLMAEKISLTESAFDMLKTE-NKELNKRFENLQNIIIKQESKLG 709
             +SN  I+L++  +   L  EK +L ++  D LKT+  K+ +    ++   I  +E++L 
Sbjct: 649  SQSNGQIALQEFSNFKVLAIEKENLLQTRIDDLKTKLEKQRSSAPSSIHGSIGSEETELS 708

Query: 710  DIINKYITGETEISNLKTQLSIAKSEKDFLVKSQDSLNSELIKTSEEKNKLRIMLSQLQS 769
               NK  +   EISNL      +K   D     ++SL  +L +  +EK +L++ L++ ++
Sbjct: 709  QYKNKTKSLMCEISNL------SKKNTDLRC-MKESLTRDLERCCKEKMQLQMKLTESET 761

Query: 770  LQNERMTLLDDTQKKFMSKIHELENNNLDLIKNLGSKMTEIQKLSISNESQCTWYQNTID 829
              NE+    D  Q ++ +KI  LE N  +L   L SK+ EI+ L  S  SQ  W QNTID
Sbjct: 762  SHNEQKLKSDSKQVQYNTKIKNLEKNCEELNNRLHSKVQEIETLQTSKNSQLKWAQNTID 821

Query: 830  DLKKINSAIKTELTSKNSLISDLNTKIELLESQ------SYTIDTNTRCSSSGNDF-SQI 882
            D +K   ++ T+L+ K + I  L+ +++ LE +       Y +  N   SS  N   + +
Sbjct: 822  DTEKNMKSLSTDLSEKKTTIRKLSLEMKDLEIELQKTKLQYKLLNN---SSDANTLETAL 878

Query: 883  SKDLDITKLHLSEAYTQVEEYKQLYTSTEESLKTLESNFESVKNLMDDKISKLLSEN--- 939
             K+L+ +++ L +A++Q+E Y+++ ++ E +LK L       K  +  K   L  EN   
Sbjct: 879  KKELERSQIDLKDAHSQIEAYEEIISTDENTLKELNDQLTKTKEELKVKSQSLDEENNAK 938

Query: 940  -ETLKASTGEYDKRISELSTDLKNEKNKYSEEIAQLNVQITRLNKF--KKDSADTASEYE 996
             E +     E D+ I  L   LK    +  ++  +L  Q  R+     K D   T  E  
Sbjct: 939  EEEISFLRRELDE-IRGLQPKLKEGALRLVQQSEKLGNQTQRIQAMNEKIDKMTTIVELH 997

Query: 997  EKISKLQSQLELKAK--------FADNAQEKYESLLTKDNANLQSIEEFKEQIEKL---- 1044
            +++   Q Q +LKA           +N    Y++ L K  ++L S +E  ++ E+     
Sbjct: 998  QEVETSQYQAKLKANKDLSALVLRLENEVLDYQTELKKTKSSLHSTQELLDKHERKWMEE 1057

Query: 1045 ---NQRIVIIESDLEKKTSLLSENESLWKKKQDAFISDLEESKKKIDNLTNQNKLYVDQL 1101
                +R +I  S++E+  SL  EN +L +K               ID+ T +N    + L
Sbjct: 1058 KADYERELI--SNIEQTESLRVENSALVEK---------------IDDGTGENNGDKEYL 1100

Query: 1102 ELLNKDFXXXXXXXXXXETKHMFNRLRADRDVLETKLSIAERDSKNNASKLESLRDELAN 1161
            +L++                 +F+ LR +R+ LETKL+  +RD      K  +L   + +
Sbjct: 1101 KLVS-----------------LFSSLRHERNTLETKLTTCKRDLALAKQKNANLEKSVND 1143

Query: 1162 VQMKLISSENKLLRHSDLIENHEKIVSELNQITLFKESNETLRNQVSELNEKNKTLQTKL 1221
            +Q   + S   +   +D+I+  E I+ E+ Q+ + KE+N  L+  + ++ EKN+ +  + 
Sbjct: 1144 MQQTHLVSRKDVQCSTDIIDEFEDIMKEIAQVNILKENNTILQKSLKKVTEKNEAIYKEH 1203

Query: 1222 NEENSKLSNLSMELKSVKESLGDKETDIMLIKEESNKWRLRAEELSVQIDKVDLDSVSKL 1281
                 ++S L  +L   KE +      +++ + E  +W+ R + LS Q  +   D   KL
Sbjct: 1204 TSLQYEISQLQGDLAQTKEQVSVNANKVLVYESEIEQWKQRYDNLSQQQKETHKDETEKL 1263

Query: 1282 STELDALKDDAETKRKQNAELEERFNLLKKQAHERLNASKEIQSSLNKQINELK 1335
              E+  LK      +  NA+L ++FN LKKQAHE+L+ASK+ Q++L  +++ELK
Sbjct: 1264 FNEISDLKAKLLNAQNANADLNDKFNRLKKQAHEKLDASKKQQTALTNEVDELK 1317

 Score = 73.2 bits (178), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 76/250 (30%), Positives = 116/250 (46%), Gaps = 52/250 (20%)

Query: 1488 EEFQSLKKEWEEEYEKATLERIEEAKETLKKRIRLPSETKINRVIEKRKHELENEYEVKL 1547
            E  + LKK+W ++YE+ T+ RI+EA+E LKKRIRLPSE +I ++I KRK ELE E++ KL
Sbjct: 1429 ENMEELKKQWLKQYEEETMRRIKEAEENLKKRIRLPSEERIQKIISKRKEELEQEFQRKL 1488

Query: 1548 QEKLNEIEANRNSIETIDPGKLREEIKEEVKRDMLIKFENDLNEAKKKSFEEGKQQSSMK 1607
            +       AN  S  T+   K   E          +  E+DL  +  K   E   + S+ 
Sbjct: 1489 K-------ANSGSF-TLSSDKKENE----------VNAEDDLWNSPSKGNSE---KPSVV 1527

Query: 1608 TTLLERKISKLESQLSEAIENDKQSDKNPIIS----DLAQTSTLASIQPPSAKKPAFSFG 1663
            T L+ +K   L+ QL    +    +D  P  S    D+  ++T  +  P      AF+FG
Sbjct: 1528 TNLIRQKNLILQEQLKNPKKGIISNDSRPTSSNKENDIPGSTTAENKAP-----LAFNFG 1582

Query: 1664 GFNTTNSLNANKGFXXXXXXXXXXXKDTEIVQNPFSLGVSQ--TSSSPMHFN--PFSSSA 1719
                 ++ ++ + F                 QNPF+   +   T  SP+ FN  P  +  
Sbjct: 1583 KPLFPSNTSSFQSF-----------------QNPFTPAATSFNTGVSPV-FNIKPALAVD 1624

Query: 1720 TTSNVFNQNG 1729
             T + F   G
Sbjct: 1625 ATVDTFKTPG 1634

>Smik_9.20 Chr9 complement(40653..45701) [5049 bp, 1682 aa] {ON}
            YIL149C (REAL)
          Length = 1682

 Score =  280 bits (715), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 326/1214 (26%), Positives = 613/1214 (50%), Gaps = 92/1214 (7%)

Query: 215  KLEEATTTLKSMEAKVSVLSDKNNDLTKKYENSIWEIKNLKDNLLVTKDDMNKEIAMKSK 274
            KL +A    +S  +   +L D+N  L+   E  I EIKNLKD   + K + +KE+ ++  
Sbjct: 219  KLYQAQADRESALSYSQLLLDQNKQLSHSVEEKILEIKNLKDTACIEKTEFSKEMTLQKS 278

Query: 275  LIDLLQGQLSSTQEELRQNVEL---NSKFTKFPDLESQNETLKSDIQDLTLKIEELQNEN 331
            + DLL  QL+S + +   + E+   +    K PD    +  +  ++ +  ++ ++ Q+E 
Sbjct: 279  MNDLLSSQLASFERD-HSSGEIGKDDDNLCKDPD----HNNVTDELMNTKVQFQKSQDEC 333

Query: 332  FNLXXXXXXXXXXXXXXXXXXXXXXXLPTLYSKINLLKKQVTQEKLEKKHLQTQIESFII 391
              L                       +  L+S I +L+KQ+ +E+ +K  LQ Q+E FI+
Sbjct: 334  QRLQNIISDFVQEDKATVDTNGASHTVGKLFSDIKVLRKQLIKERSQKFQLQNQMEDFIL 393

Query: 392  ELENKIPIISSFQEKNQAXXXXXXXXXXXXXXXXXXXXXIQNKLNNYDSKLLTYQSNIKE 451
            ELE+K P + SF+E+ ++                      + +L +   K+ + ++NI  
Sbjct: 394  ELEHKTPELVSFKERTKSLEHELKRSTELLETISMAKRKDERELTSLRQKINSCEANIHL 453

Query: 452  LIRQRLDLANQVKHLLLFVAVKNDSGGPLTREEIEFINKISNNSEDLNGSELTSQHVISE 511
            L++QRLDLA QVK LLL  +    +  PL+++++  + KI  +  D+N ++  +Q +ISE
Sbjct: 454  LVKQRLDLARQVKVLLLNTSAIQKTTLPLSKDDLISLRKILESGSDVNEND--AQAIISE 511

Query: 512  RLVTFSNIEELQAKNMELLNSIRSLSENLENIENA--NSHKEFQNKTIADAKEAILTLQY 569
            RLV F+NI ELQ KN+ELL  IR+L++ LE  E     +  E + +TI +AK+AI+ L+ 
Sbjct: 512  RLVEFNNINELQEKNVELLYCIRTLADKLEFHEGKKDTTLAEVEKQTIKEAKDAIIELEN 571

Query: 570  HNDILESKVKVLEAERDSFKLLLN---NNVSIDSSIKNDDLSSSTSPETNEKSIEKLQTL 626
             N  +ES++ +L  ERDS+KLL +   NNV++++         + +  ++EK I++L+  
Sbjct: 572  TNMKMESRINILLRERDSYKLLASSKENNVNVNAK--------NFTEISHEKKIKELEAE 623

Query: 627  IEELKAELKKNKDALESQIASFTADKSNLTISLEKEKSSNTLMAEKISLTESAFDMLKTE 686
            +   K E       L  ++ ++     +  I+ +  ++   L  EK S+ E+  + LKT+
Sbjct: 624  LSSTKVESSAVIQNLRKELTTYKKLLCDKKIASQDFENFKMLAKEKESILETRVNNLKTD 683

Query: 687  NKELNKRFENLQNIIIKQESKLGDIINKYITGETEISNLKTQLSIAKSEKDFLVKSQDSL 746
               L K+  ++ + +  Q++K+ D   + +   T+   L  ++S  K E    +  ++SL
Sbjct: 684  ---LEKQKLSVPSFV--QDNKVRDS-TELLQSRTKTEILMHEISSLKKETANSMVLKESL 737

Query: 747  NSELIKTSEEKNKLRIMLSQLQSLQNERMTLLDDTQKKFMSKIHELENNNLDLIKNLGSK 806
              +L +  +EK +L++ L + +   NE+    D    K+ ++I +LE +   L   L SK
Sbjct: 738  TRDLERCCKEKIQLQMKLKESEISLNEQKVNFDSKGIKYDARIKQLEESLERLRIELKSK 797

Query: 807  MTEIQKLSISNESQCTWYQNTIDDLKKINSAIKTELTSKNSLISDLNTKIELLESQ---- 862
              EI+ L  S +SQ  W QNTIDD ++   ++ TEL+ K   +  L++KIE L+++    
Sbjct: 798  AQEIKSLQSSKDSQLKWAQNTIDDTEEKLKSVLTELSRKEKTVVTLSSKIENLDNELREN 857

Query: 863  --SYTIDTNTRCSSSGNDFSQISKDLDITKLHLSEAYTQVEEYKQLYTSTEESLKTLESN 920
               Y    NT  +S+      + K+L+ T+L L +A++QV  Y+++ ++ E++LK L S 
Sbjct: 858  KLKYEFLNNTSDASTLQ--PALRKELEQTQLELKDAHSQVRTYEEIISTNEKALKELNSQ 915

Query: 921  FESVKNLMDDKI----SKLLSENETLKASTGEYDKRISELSTDLKNEKNKYSEEIAQLNV 976
              S+K   D +I     + L+  E L     E D        ++++ + K  E    L  
Sbjct: 916  LASMKEDYDARIELECKEKLANEEELSLLRRELD--------EIRSLQPKLKEGTVCLVK 967

Query: 977  QITRLNKFKKDSADTASEYEEKISKLQSQLELKAKFADNAQEKYESLLTKDNANLQSIEE 1036
            Q  +L    ++ A+   E + KI K+   +++   +      +++S++  +    + +  
Sbjct: 968  QSEKL----RNQAEKIQEMKAKIDKMNWNVQV---YKKEKTSQFQSIMKANKELSELVTR 1020

Query: 1037 FKEQIEKLNQRIVIIESDLEKKTSLLSENESLWKKKQDAFISDLEESKKKIDNLTNQNKL 1096
             +++       +  ++S L K   LL  +E  W +++  +  +L  + ++ ++L  +N +
Sbjct: 1021 LEKEATDSQMELKKLKSSLHKTQDLLDTHEKKWMEEKADYERELISNIEQTESLRVENSV 1080

Query: 1097 YVDQLELL------NKDFXXXXXXXXXXETKHMFNRLRADRDVLETKLSIAERDSKNNAS 1150
             ++++  +      N+D+               F+ LR +R+ LETKL+  +RD      
Sbjct: 1081 LIEKIGSVTEGSDGNEDYLKLVS---------FFSNLRHERNSLETKLTTCKRDLALVKQ 1131

Query: 1151 KLESLRDELANVQMKLISSENKLLRHSDLIENHEKIVSELNQITLFKESNETLRNQVSEL 1210
            K  SL   + ++Q+   +S+ +L   + +I+    I  E+ Q+ L KE+N  L+  +  +
Sbjct: 1132 KNASLEKNINDLQIDQPASQTELQCSAVIIDEFNDITKEIAQVNLLKENNAILQKSLKNV 1191

Query: 1211 NEKNKTLQTKLNEENSKLSNLSMELKSVKESLGDKETDIMLIKEESNKWRLRAEELSVQI 1270
             EKN+ +  +L     ++S L  +L   KE +      I++ + E ++ + R  +LS Q 
Sbjct: 1192 TEKNREIYEELTIRQEEVSQLKSDLIKTKEQVSVNANKILIYESEMDQCKQRYHDLSTQQ 1251

Query: 1271 DKVDLDSVSKLSTELDALKD---DAETKRKQNAELEERFNLLKKQAHERLNASKEIQSSL 1327
             +V   ++ KL++E+   K    DAE  +    ELE +FN LKKQAHE+L+ASK+ Q++L
Sbjct: 1252 REVQKKTIEKLNSEISDFKAKLLDAENTK---TELENKFNRLKKQAHEKLDASKKQQTAL 1308

Query: 1328 NKQINELKASNTNIELALSSEQKKSMDLQ-----------NTLSDNE----VKYTQKLSN 1372
              ++ ELKA    +E  L+S+  K++DL            + L D E    +   +++ +
Sbjct: 1309 TNELKELKAVRDKLEQDLNSKNFKTVDLDTEPKEHTVQSGDLLRDQEKVASLPLIEEIES 1368

Query: 1373 IESELKALKTENNS 1386
            ++ EL+  K  NNS
Sbjct: 1369 LKRELQVFKNANNS 1382

 Score = 75.5 bits (184), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 37/62 (59%), Positives = 49/62 (79%)

Query: 1488 EEFQSLKKEWEEEYEKATLERIEEAKETLKKRIRLPSETKINRVIEKRKHELENEYEVKL 1547
            E  ++LKKEW +EYE+ T+ RI EA+E LKKRIRLPSE +I ++I KRK ELE E++ KL
Sbjct: 1430 ENIETLKKEWLKEYEEETIRRIREAEENLKKRIRLPSEERIQKIISKRKEELEEEFQRKL 1489

Query: 1548 QE 1549
            +E
Sbjct: 1490 KE 1491

>NCAS0G00230 Chr7 complement(33629..38836) [5208 bp, 1735 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1735

 Score =  231 bits (588), Expect = 5e-60,   Method: Compositional matrix adjust.
 Identities = 281/1027 (27%), Positives = 504/1027 (49%), Gaps = 86/1027 (8%)

Query: 367  LLKKQVTQEKLEKKHLQTQIESFIIELENKIPIISSFQEKNQAXXXXXXXXXXXXXXXXX 426
            LLK+Q+ +EK +K +LQ Q+E F+IELEN++P ++S +++NQ                  
Sbjct: 361  LLKEQLIKEKRQKDYLQEQVELFVIELENQLPTVNSLKDRNQTLEQELMQITGLLEETER 420

Query: 427  XXXXIQNKLNNYDSKLLTYQSNIKELIRQRLDLANQVKHLLLFVAVKNDSGGPLTREEIE 486
                   +L   + +L     NI  L+ QR+DLA+QV+ LLL + +K      LT +EI 
Sbjct: 421  ESDIRIKELTTENRRLKEQTENINVLMSQRVDLAHQVQFLLLNLDLKKHQQHLLTPDEIT 480

Query: 487  FINKISNNSEDLNGSELTSQHVISERLVTFSNIEELQAKNMELLNSIRSLSENLENIENA 546
            F+ KI  +    N S+  SQ +ISERLV F +I  LQ +NMELL + R+L+E LE    +
Sbjct: 481  FLRKIIKSRNSQNDSD--SQKIISERLVKFHDISVLQKQNMELLTTTRNLAEQLE----S 534

Query: 547  NSHKEFQNKTIADAKEAILTLQYHNDILESKVKVLEAERDSFKLLLNNNVSIDSSIKNDD 606
            +  K  Q  T  ++KE I  LQ   + L SK++ L+ E+D++KLL   N         ++
Sbjct: 535  SDTKSVQKITRNESKEKIAKLQESINGLTSKLEKLQKEKDAYKLLSLQNTG--EQTPTEE 592

Query: 607  LSSS-TSPETNEKSIEKLQTLIEELKAELKKNKDALESQIASFTADKSNLTISLEKEKSS 665
            L S     E     +E++ +L   L  E  K    L   I     +K +L  ++ KE S 
Sbjct: 593  LRSQLQKKEEQLTKLERMSSLDSHLAEEKAK---VLNQSIIKLKKEKYDLNNAIIKETSQ 649

Query: 666  NTLMAEKISLTESAFDMLKTENKELNKRFENLQNIIIKQESKLGDIINKYITGETEISNL 725
              +  +K  + E + ++L  +     K++E+ + +       L D   + I    E    
Sbjct: 650  RAIAEKKSKMLEDSLELLHKKYDLAVKKYEHYETL-------LNDHNAENIKHSRENETT 702

Query: 726  KTQLSIAKSE-----KDFLVKSQDSLN--SELIKTSEEKNKLRIMLSQLQSLQNERMTLL 778
            + ++SI + E     ++ L  S+D+ N  S+L   ++EK  L   LS +++   +++ L+
Sbjct: 703  QAKISILQKEIESYKQNLLQYSKDNENTLSKLAAATQEKETLGSRLSTVKNELEQKINLM 762

Query: 779  DDTQKKFMSKIHELENNNLDLIKN---LGSKMTEIQKLSISNESQCTWYQNTIDDLKKIN 835
             + +  +  K H+  +  L L K+   L  K+ E++       SQ  WYQ  +D L   N
Sbjct: 763  QERETYY--KEHDSISERL-LKKSKIQLEDKIKEVKDFEAKKNSQINWYQKRLDSLTTTN 819

Query: 836  SAIKTELTSKNSLISDLNTKIELLESQSYTIDTNTRCSSSGNDFSQISKDLDITKLHLSE 895
              ++ EL  + + I+    KI  LE    T+  NT  SSS     ++ +D +  K  L E
Sbjct: 820  DKLQVELNKELTKINIQRLKISDLEK---TLSQNTNGSSS---LPRVDQDFEKLKNELKE 873

Query: 896  AYTQVEEYKQLYTSTEESLKTLESNFESVKNLMDDKISKLLSENETLKASTGEYDKRISE 955
               ++ +Y+ L    EE+   L+ +    + ++DD +       E L     E  +  S 
Sbjct: 874  KQLEINQYRDLLNLAEETKNRLQKDLNKQRQIVDDAMEG----KEQLDQQLAELTQECSS 929

Query: 956  LSTDLKNEKNKYSEEIAQLNVQITRLNKFKKDSADTASEYEEKISKLQSQLELKAKFADN 1015
            +++ L+ +K K  ++   +  + T     K    ++ S  E KI+ L++++         
Sbjct: 930  MNSLLQKQKAKCEDDQKIIQDKATETENLK----NSLSSLENKITTLENEM--------- 976

Query: 1016 AQEKYESLLTKDNANLQSIEEFKEQIEKLNQRIVIIES----DLEKKTSL--LSENESLW 1069
              EK +S   K+N        +KEQ+ KL++   +IE     +   KTSL  L  N + +
Sbjct: 977  -VEKTKSFEEKENT-------YKEQLHKLSESSTLIEKMEAENKAYKTSLDGLKANIAAY 1028

Query: 1070 KKKQDAFISDL-----------EESKKKIDNLTNQNKLYVDQLELLNKDFXXXXXXXX-- 1116
            +    A+   L           +E K+ IDNL  Q  +   +   +  +           
Sbjct: 1029 EDAISAYRQKLLDEKFNHELQVDEFKETIDNLNFQIHIQKGKRSFITSEGSTTSNDTDET 1088

Query: 1117 ----XXETKHMFNRLRADRDVLETKLSIAERDSKNNASKLESLRDELANVQMKLISSENK 1172
                  +   +   LR +RD L+ KL I++R+  +   ++E+L++ L   +      E++
Sbjct: 1089 VVNDTSDKNELILALRRERDGLDIKLDISQREVYSLREQVENLKNSLDETRQSFKGLESE 1148

Query: 1173 LLRHSDLIENHEKIVSELNQITLFKESNETLRNQVSELNEKNKTLQTKLNEENSKLSNLS 1232
            +       E H++ V +LN++   KE+NE L+ ++ E +++N  + TKL    ++++ L 
Sbjct: 1149 VSGEMTTTEQHKEAVKQLNELNTLKETNEQLQQKLRENDKENNIIHTKLELLKNEMNPLK 1208

Query: 1233 MELKSVKESLGDKETDIMLIKEESNKWRLRAEELSVQIDKVDLDSVSKLSTELDALKDDA 1292
             +++ +K S+ +K+  + L+ EE+ +W+LR+ E+ ++  +VDL+  +KL  EL  LK   
Sbjct: 1209 DKVERLKNSIMEKDQQLTLLSEENERWKLRSREILMKRQQVDLEEHNKLMEELSTLKTQL 1268

Query: 1293 ETKRKQNAELEERFNLLKKQAHERLNASKEIQSSLNKQINELKASNTNIELALSSEQKKS 1352
            +TK K N +L +RFN LKKQAHE+L+A+K   +SL  +I +L  + + +E+ L  E+K+ 
Sbjct: 1269 DTKTKDNEDLNDRFNRLKKQAHEKLDAAKAQNASLTAEITDLIDAKSKLEIDLDEERKRI 1328

Query: 1353 MDLQNTL 1359
             ++++ L
Sbjct: 1329 QEVESQL 1335

 Score =  108 bits (269), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 102/265 (38%), Positives = 136/265 (51%), Gaps = 52/265 (19%)

Query: 1489 EFQSLKKEWEEEYEKATLERIEEAKETLKKRIRLPSETKINRVIEKRKHELENEYEVKLQ 1548
            + + +K EWEE+ E+  ++RI +A+E LKKRIRLPSE KINRVIEKR+ ELE EYE KL+
Sbjct: 1468 DIEKMKSEWEEKQEEIIMQRIADAEENLKKRIRLPSEEKINRVIEKRRKELEEEYEKKLK 1527

Query: 1549 EKLNEIEANRNSIETIDPGKLREEIKEEVKRDMLIKFENDLNEAKKKSFEEGKQQSSMKT 1608
             +    E    +IE        EE+++EV+R++ +KF+N+L E KKK+F EGKQQS MKT
Sbjct: 1528 RQGLTTET---AIE--------EELRKEVERELRVKFDNELAEVKKKAFLEGKQQSQMKT 1576

Query: 1609 TLLERKISKLESQLSEAIENDKQSDK-----------------NPIISDLAQTSTLASIQ 1651
            TLLERK+SKLESQ S +   D +S +                 N +   ++ T      Q
Sbjct: 1577 TLLERKLSKLESQASPSRTPDLESSQKENTEGATKTTLGPSKINLLPFSMSNTDDSIEKQ 1636

Query: 1652 PPSAKK----------PAFSFGGFNTTNSLNANKG---FXXXXXXXXXXXKDTEIVQNPF 1698
             P  +K          P  SFG  N       NK    F               I ++PF
Sbjct: 1637 VPQGEKVLQINRRSLEP--SFGSSNPFTLPTQNKPAFLFASNNHSQTKKQDGLPINKSPF 1694

Query: 1699 SLGVSQTSSSPMHFNPFSSSATTSN 1723
               +         F PFSS  TT N
Sbjct: 1695 QTTL---------FAPFSSKTTTPN 1710

>KAFR0D02220 Chr4 complement(443928..448952) [5025 bp, 1674 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1674

 Score =  217 bits (553), Expect = 5e-56,   Method: Compositional matrix adjust.
 Identities = 267/1023 (26%), Positives = 491/1023 (47%), Gaps = 107/1023 (10%)

Query: 378  EKKHLQTQIESFIIELENKIPIISSFQEKNQAXXXXXXXXXXXXXXXXXXXXXIQNKLNN 437
            +K +L+TQ+E+FI ELE K+P+I S ++KN+                      ++ +  +
Sbjct: 312  QKDYLETQVENFITELEIKVPVIDSLEKKNKDLEKELSDVTSLVDRISIERESLEKEFQS 371

Query: 438  YDSKLLTYQSNIKELIRQRLDLANQVKHLLLFVAVKNDSGGPLTREEIEFINKISNNSED 497
            +  K       I+ L  QR DLA+Q++ LLL +  +  +   L+++E +FI +++ N  D
Sbjct: 372  FKRKSEHNDGMIQTLTTQRSDLAHQIQFLLLILGEQATTNALLSKDETDFIRRLTEN--D 429

Query: 498  LNGSELTSQHVISERLVTFSNIEELQAKNMELLNSIRSLSENLENIENANS--HKEFQNK 555
                   SQ +ISERL+ F++I ELQ +NM++L ++R L+  LE  E      H   + K
Sbjct: 430  TYARNNDSQSIISERLLKFADITELQKQNMDILATVRHLAGQLEEQEKLRQADHHTIERK 489

Query: 556  TIADAKEAILTLQYHNDILESKVKVLEAERDSFKLLLNNNVSIDSSIKNDDLSSSTSPET 615
            T+ +AK+A+L LQ + + LE K++    ERD +KLL                S   SP +
Sbjct: 490  TLEEAKKALLDLQEYTNSLERKLETFRKERDVYKLL----------------SKGKSPSS 533

Query: 616  NEKS----IEKLQTLIEELKAELKKNKDALESQIASFTA-------DKSNLTISLEKEKS 664
            N+ S    I+K  T   +L+ EL++ ++ L  +I   T         K  L  S++K +S
Sbjct: 534  NKPSECNDIDKHTT--GKLQNELQQTREYLTKEIEKLTRTNKDILNKKKELEYSMKKMES 591

Query: 665  SNTLMAEKISLTESAFDMLKTENKELNKRFENLQNIIIKQESKLGDIINKYITGETEISN 724
            +      K  L E+   ML+   K + ++ ++LQ ++ ++E+KL ++        ++ + 
Sbjct: 592  AKEYAEGKAELIENNLLMLQENRKSVLEQNDHLQQLLSQKEAKLAELTQDLHELTSQYNL 651

Query: 725  LKTQLSIAKSEKDFLVKSQDSLNSELIKTSEEKNKLRIMLSQLQSLQNERMTLLDDTQKK 784
            L+ + +  +S+ + L     +   EL +  EEKN L++ + +L+  +NE   +    + K
Sbjct: 652  LQIRFTDTQSQSNSLRTQHQTTQKELFEVVEEKNALKVKIHELEISRNECKGIQATVELK 711

Query: 785  FMSKIHELENNNLDLIKNLGSKMTEIQKLSISNESQCTWYQNTIDDLKKINSAIKTELTS 844
               ++ E + +  DL+K +  +  +I+ + +    +  WYQ      K   +  +TE+  
Sbjct: 712  LNERLTEYQLHEQDLLKIIEKQEDQIRDMEVKRAEELNWYQ------KNFPTQTETEI-- 763

Query: 845  KNSLISDLNTKIEL-LESQSYTIDTNTRCSSSGNDF---SQISKDLDITKLHLSEAYTQV 900
               L  D+  + E   +S   T+++    S    D    S + K   +  + +     + 
Sbjct: 764  --GLPVDMKKEGETGRQSNRDTLESQKSGSPGFTDLGTDSSVRKSTSLPVMQVGRTEEES 821

Query: 901  EEYKQLYTSTEES-LKTLESNFESVKNLMDDKISKLLSENETLKASTGEYDKRISELSTD 959
            +E K+    T+ S +  L  N    +  +  +I +L S+ + LK S          L   
Sbjct: 822  KEAKKCDALTDSSQVVGLPENVTKKEKDLIAQIEQLASDKKELKTSLQAIRAEYQHLHDQ 881

Query: 960  LKNEKNKYSEEIAQLNVQITRLNKFKKDSADTASEYEEKISKLQSQLELKAKFADNAQEK 1019
            L+ EKN +  E A LN ++ ++ +    +       E+ +  ++ +LE         ++K
Sbjct: 882  LQLEKNSFDTEKASLNNELDKIMENNSLTEVAKKSLEDDLHDVEMKLE-------EERQK 934

Query: 1020 YESLLTKDNANLQSIEEFKEQIEKLNQRIVIIESDLEKKTSLLSENESLWKKKQDAFISD 1079
            +E    + NA L   E      EK+ + I     +L K   +  +   +   ++   + D
Sbjct: 935  HE----ETNATLSEKELL---CEKMIEEISGYREELSKSAEMQVD---IQHTRELEDLLD 984

Query: 1080 LEESKKKIDNLTNQNKLYVDQL-------ELLNKDFXXXXXXXXXXETKHMFNRLRADRD 1132
            L  + K+ID+L  QN L  +QL       +  NKD           + K +   ++ +RD
Sbjct: 985  L--ANKRIDDLCTQNNLLHEQLNATLDLEDTQNKD-----------DIKDIIVCMKRERD 1031

Query: 1133 VLETKLSIAERDSKNNASKLESLRDELANVQMKLISSENKLLRH----SDLIENHEKIVS 1188
             L+ KL+I ER+        E LR+  A ++ +L +       H    S+L+  HEKI+ 
Sbjct: 1032 TLQKKLAIVEREG-------EVLRERCAGLKSELDAVSKGQQWHNLPLSNLLTGHEKILD 1084

Query: 1189 ELNQITLFKESNETLRNQVSELNEKNKTLQTKLNEENSKLSNLSMELKSVK----ESLGD 1244
            EL ++ L +E+N +L  +V++L   N      LN+E S++  LS  L+  K        +
Sbjct: 1085 ELKEVHLLRENNVSLLTEVNQLKHDN----CILNDELSQVRKLSGPLQDQKNNTERYFKE 1140

Query: 1245 KETDIMLIKEESNKWRLRAEEL-SVQIDKVDLDSVSKLSTELDALKDDAETKRKQNAELE 1303
            K+ +I L K+E  +W+ R +++   Q D + L+  +    E+D+LK   E + K+  +L 
Sbjct: 1141 KDQEISLYKDEIERWKKRWQQMVHRQDDTLGLE--ANFKNEIDSLKGLIEERTKEKEKLS 1198

Query: 1304 ERFNLLKKQAHERLNASKEIQSSLNKQINELKASNTNIELALSSEQKKSMDLQNTLSDNE 1363
            E+F LLKKQAHE+L+A+K    +LN  ++E+KASN  +E  +  + KK  +++ TL +N 
Sbjct: 1199 EKFQLLKKQAHEKLDANKIHIQTLNNDLSEIKASNLQLEEVMKEKDKKIREIELTLKENL 1258

Query: 1364 VKY 1366
             K+
Sbjct: 1259 EKF 1261

 Score =  116 bits (291), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 89/278 (32%), Positives = 139/278 (50%), Gaps = 59/278 (21%)

Query: 1491 QSLKKEWEEEYEKATLERIEEAKETLKKRIRLPSETKINRVIEKRKHELENEYEVKLQEK 1550
            Q L+K+WEE+    TL+RIEEAKE LK+ IRLPSE KI R+IEKR+ ELE++++ +++EK
Sbjct: 1374 QELRKDWEEQ----TLQRIEEAKENLKRHIRLPSEEKIQRIIEKRRAELESDFDKRVEEK 1429

Query: 1551 LNEIEANRNSIETIDPGKLREEIKEEVKRDMLIKFENDLNEAKKKSFEEGKQQSSMKTTL 1610
             N I     +   + P +L+++++ E++  +    +  L   + K+FEEGK+Q+ MKTTL
Sbjct: 1430 ANLIALADKA--DMSPDELKQKVRRELEHAIEQDLQAKLETIRTKAFEEGKRQAEMKTTL 1487

Query: 1611 LERKISKLESQLS-----------------------------------EAI--------- 1626
            LERK+SKLESQ++                                   EA+         
Sbjct: 1488 LERKLSKLESQVAKDNESGSKVRKSISGLTKIDVNSPQLYKDNTGTRTEAVLKLRPTAKV 1547

Query: 1627 --ENDKQSDKNPIIS---DLAQTSTLASIQPPSAKKPAFSFGGFNTTNSLNA--NKGFXX 1679
                D  +D NP  S   +L+++++ A++ P     P FSF    +T ++N   NK    
Sbjct: 1548 DSGKDVSNDSNPFTSPTQELSKSNSPAAL-PIVHMAPTFSFTPGKSTGTVNKELNKTAQA 1606

Query: 1680 XXXXXXXXXKDTEIVQNPFSLGVSQTSSSPMHFNPFSS 1717
                       T      FS G  +T++    F PF +
Sbjct: 1607 TFGAPTFSNFGTSTAFGGFS-GFGKTTNDQSGFKPFEA 1643

>KNAG0C06590 Chr3 (1276738..1281693) [4956 bp, 1651 aa] {ON} Anc_5.702
            YIL149C
          Length = 1651

 Score =  187 bits (475), Expect = 9e-47,   Method: Compositional matrix adjust.
 Identities = 252/998 (25%), Positives = 465/998 (46%), Gaps = 74/998 (7%)

Query: 365  INLLKKQVTQEKLEKKHLQTQIESFIIELENKIPIISSFQEKNQAXXXXXXXXXXXXXXX 424
            I++L  ++ +E L K+ L+ Q+  F+ ELE   PII SF++K++                
Sbjct: 292  ISILSNRLKRETLSKQKLEKQVHKFVTELEQTAPIIKSFKQKSEQSDAQIHKLQLHLEHV 351

Query: 425  XXXXXXIQNKLNNYDSKLLTYQSNIKELIRQRLDLANQVKHLLLFVAVKNDSGGPLTREE 484
                  I  ++  Y  +L       K L R+R DLA Q+++LLL   VK DS  PLT  E
Sbjct: 352  TKDKETIFQEVEQYKKQLEQISGQDKILRRERFDLARQLQYLLLNGFVK-DSDDPLTSSE 410

Query: 485  IEFINKISN-NSEDLNGSELTSQHVISERLVTFSNIEELQAKNMELLNSIRSLSENLENI 543
              +I +I N + E+ N S   SQ +IS+R++ F +I ELQ +N+ LL+++R+LS+  E +
Sbjct: 411  FSYIKEILNTDPEEGNTSSTDSQLIISKRMLKFKSIVELQQQNINLLSAVRTLSDRAETL 470

Query: 544  ENA-NSHKEFQNKTIADAKEAILTLQYHNDILESKVKVLEAERDSFKLLLNNNVS--IDS 600
            E    S    +   I +AK+ +L LQ +N  LE+KV+ L     + KL  N + +   D 
Sbjct: 471  ERKLESGDSIE--AINEAKQTLLDLQQYNSSLEAKVESL-----TNKLKANEHFTSIGDG 523

Query: 601  SIKNDDLSSSTSPETNEKSIEKLQTLIEELKAELKKNKDALESQIASFTADKSNLTISLE 660
               N DLS   +       I+ L+   + L AE  +    L SQI +    KS+L    E
Sbjct: 524  EFGNSDLSDGNN-------IQALKNKYDSLMAESSETIGHLYSQINNLQQSKSDLAKECE 576

Query: 661  KEKSSNTLMAEKISLTESAFDMLKTENKELNKRFENLQNIIIKQESKLGDIINKYITGET 720
               +S  L+ +++ +T+   D+ K EN  L  R +N    + ++E +    I KY+    
Sbjct: 577  SLINSKHLIEDRLKITQDMLDLSKNENSTLRNRIKNTSQALKEREVETSQTIKKYLDCVA 636

Query: 721  EISNLKTQLSIAKSEKDFLVKSQDSLNSELIKTSEEKNKLRIMLSQLQSLQNERMTLLDD 780
            ++  ++ QL     EKD L  +Q S+ ++L +  +E+N  + ++ QL++LQ  +   L D
Sbjct: 637  KLDVIQRQLENTLVEKDILQNAQSSIENKLNQALKERNNFQGLIPQLRALQKNQDEQLKD 696

Query: 781  TQKKFMSKIHELENNNLDLIKNLGSKMTEIQKLSISNESQCTWYQNTIDDLKKINSAIKT 840
             Q    +KI +LE  N +L   + +K T       + +++  WYQ   D L   N A+  
Sbjct: 697  IQVSLQNKIDDLELENTELRNKIDTKETSPSSALTNPKAELEWYQTKFDSLSGSNDAL-- 754

Query: 841  ELTSKNSLISDLNTKIELLESQSYTIDTNTRCSSSGNDFSQISKDLDITKLHLSEAYTQV 900
                 N  + +  + IE L  ++ T+D   + ++S N   +  + +D          T++
Sbjct: 755  -----NEKMIECASTIETLTVKTQTLDILLQEANSKNKLLEARETVDDVNKLTGALETEL 809

Query: 901  EEYKQLYTSTEESLKTLESN----FESVKNLMDDKISKLLSENETLKASTGEYDKRISEL 956
               +   T T   L+ + SN    ++S   +++++ S+L +EN+ L+         ++  
Sbjct: 810  ATSRTRLTDTSRELE-ISSNTIRQYQSEIKVLNERQSELENENKHLRDEIAILRDELTHN 868

Query: 957  STDLKNEKNKYSEEIAQLNVQITRLNKFKKDSADTASEYEEKISKLQSQLELKAKFADNA 1016
              + + EK    ++++ L ++   L K ++D       Y  +I KL+  L+ +A      
Sbjct: 869  GGEFEREKEALMKKLSNLEIRQAELTKLEED-------YTAEIEKLKLDLDKQAMLGKEI 921

Query: 1017 QEKY-ESLLTKDNANLQSIEEFKEQIEKLNQRIVII--ESDLEKKTSLLSENESLWKKKQ 1073
            +  + E +    N N ++     E +E + Q  V +  E +LE +  +L+E         
Sbjct: 922  KLAHDEEVREVQNRNTETYRNELELVE-IRQTKVFVEKEKELESRIKILNEQ-------- 972

Query: 1074 DAFISDLEESKKKIDNLTNQNKLYVDQLELL-NKDFXXXXXXXXXXETKHMFNRLRADRD 1132
                  +E  K+++   +++  L  +Q++LL ++            E   +  +L  ++ 
Sbjct: 973  ------IELDKERMKQFSDEESLLREQVKLLADEKASDLVDAGVSPEYTDLVRKLSDEKK 1026

Query: 1133 VLETKLSIAERDSKNNASKLESLRDELANVQMKLISSENKLLR----HSDLIENHEKIVS 1188
             LE+KL  ++ +      +L     E+A + M    ++ ++       S   E H     
Sbjct: 1027 NLESKLFASQSEKNRLREQLTKTESEIAVLNMNYEQAKKEVAAEVNNESGRAEEH----- 1081

Query: 1189 ELNQITLFKESNETLRNQVSELNEKNKTLQTKLNEENSKLSNLSMELKSVKESLGDKETD 1248
             + Q+   KESN +L N+V     +N  +  +LNE  +K  ++  +L   +  L  K+  
Sbjct: 1082 -IAQLESLKESNMSLTNEVKLAQMRNGEIIAELNELKTKFKSVESQLDEARNVLSSKDMK 1140

Query: 1249 IMLIKEESNKWRLRAEELSVQIDKVDLDS----VSKLSTELDALKDDAETKRKQNAELEE 1304
            +M ++ E ++ +  + ++    +K   DS    V  L + +  L +  +  +  N ELE+
Sbjct: 1141 LMELQTECSRLKATSHDMPQNGNK---DSSSELVGALQSSVATLTEQVDNLKHANTELED 1197

Query: 1305 RFNLLKKQAHERLNASKEIQSSLNKQINELKASNTNIE 1342
            RF  LK+QA ERL+ASK   +SL   +  L    T ++
Sbjct: 1198 RFGRLKRQARERLDASKVTINSLRDNVETLTKDKTALQ 1235

 Score = 55.5 bits (132), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 43/143 (30%), Positives = 80/143 (55%), Gaps = 35/143 (24%)

Query: 1479 ARTDQSIKIEEFQSLKKEWEEEYEKATLERIEEAKETLKKRIRLPSETKINRVIEKRKHE 1538
            AR+D    + + ++L+K+WE                + K+R+ L  + K ++++  +  E
Sbjct: 1393 ARSD----VPDIETLQKQWEA---------------SNKERLVLLYKEKSDQMMRAKMDE 1433

Query: 1539 LENEYEVKLQEKLNEIEANRNSIETIDPGKLREEIKEEVKRDMLIKFENDLNEAKKKSFE 1598
            LE +++ +++ K  E+ A            L++EI+E+ K       E+ L   KK++FE
Sbjct: 1434 LEEQFQNRVRNKEKELNA------------LKDEIEEKCK----TGHEDTLIAVKKRAFE 1477

Query: 1599 EGKQQSSMKTTLLERKISKLESQ 1621
            EGKQQ++MK ++LERKI+KLE++
Sbjct: 1478 EGKQQATMKMSILERKIAKLEAE 1500

>KNAG0L02140 Chr12 (381286..386112) [4827 bp, 1608 aa] {ON} Anc_5.702
            YIL149C
          Length = 1608

 Score =  173 bits (438), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 317/1232 (25%), Positives = 557/1232 (45%), Gaps = 149/1232 (12%)

Query: 215  KLEEATTTLKSMEAKVSVLSDKNNDLTKKYENSIWEIKNLKDNLLVTKDDMNKEIAMKSK 274
            KL+++ + +K++    S L D    + ++  +     K L D L   + D  +E+A + K
Sbjct: 161  KLDQSLSEIKALRDSNSALLDSLERINRELTDKAALNKTLSDQLSSQRHDFERELATRDK 220

Query: 275  LIDLLQGQLSSTQEELRQNVELNSKFTKFPDLESQNETLKSDIQDLTLKIEELQNENFNL 334
            L  +L+ Q++S   EL    E  +          Q+   + +I +   ++EEL       
Sbjct: 221  LNAVLKKQVNSLHSELGNGGETPAHAEPNDQFAKQSSQHEEEISNYKEQVEEL------- 273

Query: 335  XXXXXXXXXXXXXXXXXXXXXXXLPTLYSKINLLKKQVTQEKLEKKHLQTQIESFIIELE 394
                                   L      I  L+K + +E+ E   L+ Q+ESF+IELE
Sbjct: 274  --------------------LGILGQGAPSIAHLRKLLLKERKENVSLKKQMESFVIELE 313

Query: 395  NKIPIISSFQEKNQAXXXXXXXXXXXXXXXXXXXXXIQNKLNNYDSKLLTYQSNIKELIR 454
            +++P +   +++N+                       Q +L++   K+        +L  
Sbjct: 314  HRLPGLQILEKQNKEVQQKLHAATNKMIEESKAKIRTQRELSSSRQKVDHLNQIFHKLRV 373

Query: 455  QRLDLANQVKHLLLFVAVKNDSGGPLTREEIEFINKISNNSEDLNGSELTSQHVISERLV 514
            QR DLA+Q++ LL      N S   L   E+ FI  I  N E+ +  +  SQ ++S+RL+
Sbjct: 374  QRSDLAHQIQFLLTV----NSSDTVLPPSELSFIKTIIEN-ENWDAYK-DSQRIVSDRLL 427

Query: 515  TFSNIEELQAKNMELLNSIRSLSENLENIENANSHKEFQNKTIADAKEAILTLQYHNDIL 574
             F NI ELQ +NM+L++++RSL + +E+ E  N        T+  AK  I  L+  N  L
Sbjct: 428  RFDNIPELQEQNMKLVSTVRSLVDKVESWEADNDS----GLTLEAAKLQISKLEQSNAQL 483

Query: 575  ESKVKVLEAERDSFKLLLNNNVSIDSSIKNDDLSSSTSPETNEKSIEKLQTLIEELKAEL 634
            ES+VK  EA  ++ K    +  S+DS I             N   +E+ Q  IEEL+++L
Sbjct: 484  ESEVKNWEALMETLK----DGDSLDSKI-------------NVTMVEQ-QKKIEELESKL 525

Query: 635  KKNKDALESQIASF-----TADKSNLTISLEKEKSSNTLMAEKISLTESAFDMLKTENKE 689
                D  ES +        T D++  TI++  E+  NT+ ++  + +E      K EN  
Sbjct: 526  T---DVGESHVQKINVLNKTIDRNQSTINMLNEQIKNTVKSDMNAKSE--LIACKRENLS 580

Query: 690  LNKRFENLQNIIIKQESKLGDIINKYITGETEISNLKTQLSIAKS----------EKDFL 739
            L ++    QN + +  SK       Y   + +I+ L    +  KS          EK  +
Sbjct: 581  LTQQISTKQNELDELNSKSAQKERDY---QLKIAELSVAANKCKSWENSFHLLTEEKTQM 637

Query: 740  VKSQDSLNSELIKTS------EEKNK-LRIMLSQLQSLQNERMTLLDDTQKKFMSKIHEL 792
             + Q SL  ++ + S      E +NK L + +S  + L  +R      +++   SKI  L
Sbjct: 638  EQKQRSLFDKIQQESKKLLQLETRNKELEVKISG-KELHRKR------SEETLSSKITFL 690

Query: 793  ENNNLDLIKNLGSKMTEIQKLSISNESQCTWYQNTIDDLKKINSAIKTELTSKNSLISDL 852
               N  L  +L  K  E+++    +E Q  WYQ  ID+L + N        +K++ I +L
Sbjct: 691  SEENKSLHNDLAFKEEEVKQFIEKSEKQIKWYQQNIDELSEQNK-------NKSNKIIEL 743

Query: 853  NTKIELLESQSYTIDTNTRCSSSGNDFSQISKDLDITKLHLSEAYTQVEEYKQLYTSTEE 912
            N K+ LL  +S +     +    G +  ++  +L+  K  L  + +Q   YK        
Sbjct: 744  NDKLRLLSEKSLS----NKPYPVGTELKELQNELNGMKAALEVSESQATLYKD------- 792

Query: 913  SLKTLE--SNFESVKNL-MDDKISKLLSENETLKASTGEYDKRISELSTDLKNEK----- 964
               TLE   NF +   L   + IS+L S+NE L         +I+E     K  +     
Sbjct: 793  ---TLERNQNFYNNSTLSFQNTISELQSKNEALSKQHETLQNQITETENQSKGIQLEHQT 849

Query: 965  --NKYSEEIAQLNVQITRLNKFKKDSADTASEYEEKISKLQSQLELKAKFADNAQEKYES 1022
              ++ + E   L  ++  L+  ++  A+   EY+ +I K++S L++++    N    +ES
Sbjct: 850  IIDRLTSEKTALEEKLNSLSHSEEKIAEMKGEYDAQIQKIESNLKIQSDTRLN----FES 905

Query: 1023 LLTKDNANLQSIEEFKEQIEKLNQRIVIIESDLEKKTSLLSENESLWKKKQDAFISDLEE 1082
             LT     L S   +  QIE+LN  I  + SD+   T      ++L K++ D+   +L+ 
Sbjct: 906  ALTSKEKELTS---YAVQIEQLNTEIAKLNSDIAALTEPAEARKTLIKER-DSLGQELKL 961

Query: 1083 SKKKIDNLTNQNKLYVDQLELLNKDFXXXXXXXXXXETKHMFNRLRADRDVLETKLSIAE 1142
            + ++I++L  QN +  D    +              + +++   LR +RD+ +++ + A+
Sbjct: 962  ANQRIESLAAQNSILYDTFSGMRH---VDADAEPNEDLRNLVINLRIERDMHQSQETTAQ 1018

Query: 1143 RDSKNNASKLESLRDELANVQMKLISSENKLLRHSDLIENHEKIVSELNQITLFKESNET 1202
            RD K     L+ + ++LA    ++    N       L   HEKI+ EL  +T  KE N  
Sbjct: 1019 RDVKLLKKNLKEITEKLAITCPEIDEPTNTEKDDFSLTVTHEKIMRELEGLTNTKEENLY 1078

Query: 1203 LRNQVSELNEKNKTLQTKLNEENSKLSNLSMELKSVKESLGDKE--TDIMLIKEESNKWR 1260
            L   +  LNE  +TLQ    EE S+L       K    ++ ++E    I   ++ES KW+
Sbjct: 1079 LDESIKSLNEDKRTLQ----EEVSRLRESEELAKKNSSAISEQEWQQKIETYQQESEKWK 1134

Query: 1261 LRAEELSVQIDKVDLDSVSKLSTELDALKDDAETKRKQNAELEERFNLLKKQAHERLNAS 1320
            L  +++S          +  L  +L+  K D + K ++N +L +RF  LKKQAHE+LNAS
Sbjct: 1135 LMCQQMSENT----ATEIQNLQQQLETFKADIQLKTQENDDLNDRFTRLKKQAHEKLNAS 1190

Query: 1321 KEIQSSLNKQINELKASNTNIELALSSEQKKSMDLQNTLSDNEVKYTQKLSNIESELKAL 1380
            K    SL  +++ELK  N  ++  L++++  S+D     S++      +L     + K+L
Sbjct: 1191 KATSDSLAIELSELKTVNDALQEKLNNQETNSVD-----SESNAALILQLKEENKQAKSL 1245

Query: 1381 KTENNSFKLSSEKEKMELTDEVDSLKKSLVEA 1412
            + E      SSEK   ++T E+ +LK++ ++ 
Sbjct: 1246 ELELRHSVDSSEKLIADMTKELTTLKENPIQG 1277

 Score =  131 bits (330), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 103/303 (33%), Positives = 147/303 (48%), Gaps = 82/303 (27%)

Query: 1490 FQSLKKEWEEEYEKATLERIEEAKETLKKRIRLPSETKINRVIEKRKHELENEYEVKLQE 1549
             + L+K  EEE+E+ TL+RIEEAKE LKK IRLP+E KI RVI KRK +LE +++ K+ E
Sbjct: 1328 LEELRKPLEEEWERKTLQRIEEAKENLKKHIRLPTEEKIERVIAKRKAQLEEQFQTKVAE 1387

Query: 1550 KLNEIEANRNSIETIDPGKLREEIKEEVKRDMLIKFENDLNEAKKKSFEEGKQQSSMKTT 1609
            + N ++ +  S +T D  +L +E++EE+K     + E D    KKK+FEEG+QQ+SMKTT
Sbjct: 1388 QANLLKLSELSNKTAD--ELEKEVREEIK----TRLEEDFELLKKKAFEEGRQQASMKTT 1441

Query: 1610 LLERKISKLESQL------------------------SEAIENDKQSDKNPIISDLAQTS 1645
            LLERKI+KLE++L                        +  + N+   D+ P     A T+
Sbjct: 1442 LLERKIAKLEARLQGGTGPLKSANGLNKINIDSPLMVAGPLTNEPVLDEKPNAFAGATTT 1501

Query: 1646 TLA---------------------SIQPP--SAKKPAFSFGGFNTT--------NSLNAN 1674
            T++                       QP   S  +PAFSFG FN T        NS+ A 
Sbjct: 1502 TISQPTSTTAKDSANAFSFNAQKVPAQPAFSSRAQPAFSFGSFNKTSFSDLSHKNSVGAA 1561

Query: 1675 KGFXXXXXXXXXXXKDTEIVQNPFSLGVSQTSSSPMHFNPFSSSATTSNVFNQNGTSKNI 1734
             G                    PF  G +  S+ P  F   + + T +   +Q   SK +
Sbjct: 1562 SG-------------------TPFRFGFA--SNPPTPFQNTAENGTDAKRKSQTEASKEV 1600

Query: 1735 FGN 1737
              N
Sbjct: 1601 EDN 1603

>KAFR0H00210 Chr8 complement(27128..31492) [4365 bp, 1454 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1454

 Score =  172 bits (436), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 228/887 (25%), Positives = 420/887 (47%), Gaps = 87/887 (9%)

Query: 223  LKSMEAKVSVLSDKNNDLTKKYENSIWEIKNLKDNLLVTKDDMNKEIAMKSKLIDLLQGQ 282
            L+    K + L  +N +L+K     I EIK+L+++L  +  D   E  ++ +LI+ LQ Q
Sbjct: 183  LRMTNGKNAELFKRNEELSKDLRGKISEIKSLENSLKTSNGDFLSEKQLQDQLINALQNQ 242

Query: 283  LSSTQEELRQNVELNSKFTKFPDLESQ----NETLKSDIQDLTLKIEELQNENFNLXXXX 338
            + + QE+L    +      KF D  +Q    +E L+  I++L  K+E  + E  +L    
Sbjct: 243  IKTLQEQLESLSD-----EKFDDPGTQKLDKHELLRQ-IKNLNEKLEISERERLSLVHSM 296

Query: 339  XX-----XXXXXXXXXXXXXXXXXLPTLYSKINLLKKQVTQEKLEKKHLQTQIESFIIEL 393
                                      +L   +N+L+K   +E+ +K+ L+ Q+   + EL
Sbjct: 297  EEFQNIPEEESSSVSSHASGRNNSALSLSGDVNILRKHFLKERQQKRQLEEQMRQILQEL 356

Query: 394  ENKIPIISSFQEKNQAXXXXXXXXXXXXXXXXXXXXXIQNKLNNYDSKLLTYQSNIKELI 453
            E  +P +SS++E++                          +L   +S+    +S+I  L 
Sbjct: 357  ERNMPSLSSYKERSTFLEKELNSSNILLEHIKKENLDKSAELEKKESECSNLRSSINSLA 416

Query: 454  RQRLDLANQVKHLLLFVAVKNDSGGPLTREEIEFINKI--SNNSEDLNGSELTSQHVISE 511
             QR  LA QVK+LLL +      G  L R+++E + +   +N +E ++ SE     ++ E
Sbjct: 417  FQRTVLARQVKYLLLIIQNNETLGSSLGRKDLELLGQYLAANTAEAMSDSE----KILLE 472

Query: 512  RLVTFSNIEELQAKNMELLNSIRSLSENLENIENANSHK--EFQNKTIADAKEAILTLQY 569
            RL  F N++ELQ +NM+LL   R L+   E +E  N  +    +++TI DAKEAIL LQ 
Sbjct: 473  RLAQFKNVKELQNRNMQLLQVSRELASKAEKLEKVNLKQISSEEDETINDAKEAILVLQE 532

Query: 570  HNDILESKVKVLEAERDSFKLLLNNNVSIDSSIKNDDLSSSTSPETNEKSIEKLQTLIEE 629
            ++  LES++K L  E    K       SI +  K +D +SS + +           L ++
Sbjct: 533  YSQKLESQIKELSDELAVQKKEKTEKESISAMSKIEDDASSHTID-----------LGKQ 581

Query: 630  LKAELKKNKD---ALESQIASFTADKSNLTISLEKEKSSNTLMAEKISLTESAFDMLKTE 686
            L A LK +KD   AL S+I +     +++ ISL+KEKS+  L  ++ +L E    +LK+E
Sbjct: 582  LSANLKHSKDIIDALNSEIENLHQANTDVNISLDKEKSARKLAEDRYNLLEYNVSLLKSE 641

Query: 687  NKELNKRFENLQNIIIKQESKLGDIINKYITGETEISNLKTQLSIAKSEKDFLVKSQDSL 746
             +EL +    LQ  I+ +E +       YI+ ++++S  + +++  ++E +  +++Q +L
Sbjct: 642  KEELQEEVNKLQQNILDKEKQFSYSSRDYISCKSKLSTAEAEITSLRAENELSIETQTTL 701

Query: 747  NSELIKTSEEKNKLRIMLSQLQSLQNERMTLLDDTQKKFMS--KIHELE----NNNLDLI 800
             ++      E+N LR+ ++Q+ SL NE  TLL +T+  +    KI  L+    NN L L+
Sbjct: 702  RTKKEALLNERNNLRMTVTQMNSLNNELQTLLKETKSGYDDKLKISALKCTQTNNQLQLV 761

Query: 801  KNLGSKMTEIQKLSISNESQCTWYQNTIDDLKKINSAIKTELTSKNSLISDLNTKIELLE 860
            +    +M+E++     N+S+  WY+ TIDDLK     +  EL  K   I + +  +E ++
Sbjct: 762  QQ---RMSELKS---QNDSEIKWYKATIDDLKANVFELNEELKQKEEKIEEFSKTLENVQ 815

Query: 861  SQSYTIDTNTRCSSSGNDFSQ----ISKDLDITKLHLSEAYTQVEEYKQLYTSTEESLKT 916
                    N    ++  D S+    + K+L   K  L ++  +V+EY+ + ++++ S + 
Sbjct: 816  --------NELTLANSKDVSEEKRALEKELSEVKSQLEKSNLEVKEYENVISTSKRSFEN 867

Query: 917  LESNFESVKNLMDDKISKLLSENETLKASTGEYDKRISELSTDLKNEKNKYSEEIAQLNV 976
                +E     +  K+   L E  TL+ +      R+     +L +  N  SE     + 
Sbjct: 868  KSIQYEDRIKALASKLDSELRERTTLQENLSTLQARMVVQQDELTSNNNTLSELRVSYDS 927

Query: 977  QITRLNKFKKDSADTASEYEEKISKLQSQLELKAKFADNAQEKYESLLTKDNANLQSIEE 1036
             +     FK   A+           L+S + +K    D+  + YE ++ +++   + +E 
Sbjct: 928  LLLEQKTFKDKEAE-----------LRSVIAVKTGNYDSLSKSYERIMQENSELSKVVEL 976

Query: 1037 FKEQI-------EKLNQRIVIIESDLEKKTSLLSENESLWKKKQDAF 1076
             +E++       EK        E DLE   S++ + + +W +++  F
Sbjct: 977  LREEVKNRTSNGEK--------EGDLEDTESIIKKGQDVWDEEKKVF 1015

 Score = 90.1 bits (222), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 63/143 (44%), Positives = 88/143 (61%), Gaps = 17/143 (11%)

Query: 1481 TDQSIKIEEFQSLKKEWEEEYEKATLERIEEAKETLKKRIRLPSETKINRVIEKRKHELE 1540
            TD   K+ EF      +EEE +K    ++ +A+E LKKRIRLP+E KIN +IEKRK ELE
Sbjct: 1214 TDNERKLREF------YEEEIQK----KVSQAEENLKKRIRLPTEEKINGIIEKRKSELE 1263

Query: 1541 NEYEVKLQEKLNEIEANRNSIETIDP--GKLREEIKEEVKRDMLIKFENDLNEAKKKSFE 1598
            + +E K++E     EA    + + D    K+ +EI+E  +  +  +F+  LN  +KK+FE
Sbjct: 1264 SSFEQKIKE-----EAKSLLLHSDDDKIKKIYKEIEESGRETLQQEFDEQLNIVRKKAFE 1318

Query: 1599 EGKQQSSMKTTLLERKISKLESQ 1621
            EGKQ   MK+  LERKIS LE Q
Sbjct: 1319 EGKQHVLMKSAFLERKISMLEGQ 1341

>Kpol_1043.70 s1043 (147247..151212) [3966 bp, 1321 aa] {ON}
           (147247..151212) [3966 nt, 1322 aa]
          Length = 1321

 Score =  149 bits (375), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 127/401 (31%), Positives = 225/401 (56%), Gaps = 16/401 (3%)

Query: 447 SNIKELIRQRLDLANQVKHLLLFVAVKNDSGGPLTREEIEFINKISNNSEDLNGSELTSQ 506
           S+I+ L  QR DLA+Q+++LL+  +++ND+ GPL++ EI F+  + N  +    S++  Q
Sbjct: 279 SSIEALDIQRTDLAHQLQYLLIHSSIQNDNNGPLSKSEILFMQNLINKDKQRLSSDV--Q 336

Query: 507 HVISERLVTFSNIEELQAKNMELLNSIRSLSENLENIEN--ANSHKEFQNKTIADAKEAI 564
            VIS+RL+ F +I  LQ KNMEL  SIR+L+ +LE+ E+   NS + + N TI +AKE I
Sbjct: 337 SVISDRLIKFKDIVSLQEKNMELTKSIRNLAFSLESKESEIKNSRENYDNDTINEAKETI 396

Query: 565 LTLQYHNDILESKVKVLEAERDSFKLLLNNNVSIDSSIKNDDLSSSTSPETNEKSIEKLQ 624
           L+LQ +N++L+ ++  L+++    +          SSI N   S       +   ++ L+
Sbjct: 397 LSLQEYNNVLKLEIGTLQSKISELQ----------SSIPNSKESEKQHFNYHSNLVKDLE 446

Query: 625 TLIEELKAELKKNKDALESQIASFTADKSNLTISLEKEKSSNTLMAEKISLTESAFDMLK 684
           + + +L A  +   + L   I +   +++++ I+LEKEKSS  L  EK++L ++++D+L 
Sbjct: 447 SKLSKLSAYSQSTIENLNKDIQNLYNERTDILINLEKEKSSTILANEKLTLLQNSYDLLT 506

Query: 685 TENKELNKRFENLQNIIIKQESKLGDIINKYITGETEISNLKTQLSIAKSEKDFLVKSQD 744
            EN+EL+ +   L+  + ++E  L  ++N YI  +T + +   +L++  + K  L +  +
Sbjct: 507 LENEELSSKNSMLEQQLNEEEKNLNSVLNDYIKCKTNLLDFTNRLTLLNNNKLGLEEENN 566

Query: 745 SLNSELIKTSEEKNKLRIMLSQL-QSLQNERMTLLDDTQKKFMSKIHELENNNLDLIKNL 803
           SL  E+    E+   L      L QSL+NE ++   D  K+    I +L    L L + L
Sbjct: 567 SLKQEIKSNYEQIKDLDSKSKHLEQSLENE-ISKYTDKVKELELNISKLNEQKLILERKL 625

Query: 804 GSKMTEIQKLSISNESQCTWYQNTIDDLKKINSAIKTELTS 844
            +K  EI  L+ SN  Q +WYQ  +D  +K    +++ L +
Sbjct: 626 QNKNIEIDDLNSSNYDQISWYQKKLDQYEKTIKTLESRLPA 666

 Score = 97.8 bits (242), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 78/206 (37%), Positives = 109/206 (52%), Gaps = 45/206 (21%)

Query: 1488 EEFQSLKKEWEEEYEKATLERIEEAKETLKKRIRLPSETKINRVIEKRKHELENEYEVKL 1547
            EE + LK E+E + +K    R+ EA+E LK++IRLPSE KIN +IE +  +LE +Y+ KL
Sbjct: 1090 EELKVLKTEYEGDIQK----RVAEAEEALKRKIRLPSEEKINTIIESKVADLEEDYKKKL 1145

Query: 1548 QEKLNEIEANRNSIETIDPGKLREEIKEEVKRDMLIKFENDLNEAKKKSFEEGKQQSSMK 1607
            +           S E+ D  K+++E            FE++L  AKKK+FEEGKQQ+SMK
Sbjct: 1146 ETV---------SAESTDIEKIKQE------------FEDNLVNAKKKAFEEGKQQASMK 1184

Query: 1608 TTLLERKISKLESQL--SEAIENDKQSD--------KNPIISDLAQTSTLASIQPPSAKK 1657
            T  LE KI+KLESQL  +E+   DK+++         NP + D  +     +  PP    
Sbjct: 1185 TKFLENKIAKLESQLQNNESDVTDKEAEVKTTDNEKSNPEL-DKQEAKPSFTFSPPPNSN 1243

Query: 1658 P---------AFSFGGFNTTNSLNAN 1674
            P           S  G   T SL AN
Sbjct: 1244 PFTTTQDTDSPVSVFGIKPTFSLGAN 1269

 Score = 40.4 bits (93), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 87/368 (23%), Positives = 162/368 (44%), Gaps = 74/368 (20%)

Query: 1079 DLEESKKKIDNLTNQNKLYVDQLELLNKDFXXXXXXXXXXETKHMFNRLRADRDVLETKL 1138
            +LE++K ++ NL  QN+L +++LE                E   +F  LR +RD L  ++
Sbjct: 727  ELEDTKVRVQNLATQNRLLLEKLE-----------RSANLEVDDIFVSLRYERDTLSDQV 775

Query: 1139 SIAERDSKNNASKLESLRDELANVQMKLISSENK---LLRHSDLIENHEKIVSELNQITL 1195
               E+D +   + LES++ EL     ++++ EN+   +  H     N E ++ +L ++  
Sbjct: 776  VNYEKDMQVILADLESVQSELNAANSQILNFENQRAMVQDHKKGNVNEETLIEKLTELDE 835

Query: 1196 FKESNETLRNQVSELNEKNKTLQTKLNEENSKLSNLSMELKSVKESLGDKETDIMLIKEE 1255
             KE N  L  ++  LNE N  L+ +L E   +L  L  ++  +   + DK+  I +  E+
Sbjct: 836  LKERNMELTQEIHALNENNIALKCQLEESLERLKPLETKISELNILIEDKDNIINVSNEK 895

Query: 1256 SNKWRLRAEELSVQI---DKVDLDSVSK-----------LSTELDALKDDAETK------ 1295
            +  W+ R  EL++     D  DL ++ K           LS   + LK  A  +      
Sbjct: 896  AENWKTRFNELTLSAKNNDNEDLINLQKQVEEKSKENEELSDRFNRLKKQANERLHASKV 955

Query: 1296 ------------RKQNAELE-------ERF-----------------NLLKKQAHERLNA 1319
                        + +N +LE       ERF                   LK+Q    L+ 
Sbjct: 956  AQNNLTEQSNELKARNTDLERNLSEQMERFKELENSISLKDQELGSIGDLKEQLANALDK 1015

Query: 1320 SKEIQSSLNKQINELKA--SNTNIELALSSEQKKSMDLQNTLSDNEVKYTQK--LSNIES 1375
            SK+ +  L K ++E ++  S+   E+   +E+ KS +    L ++E++  +K  ++ +E 
Sbjct: 1016 SKKFEEELIKTVSESESLVSDLKNEIESLNEKLKSKESSVGLQESEIENAKKILIAELEE 1075

Query: 1376 ELKALKTE 1383
            +L   K+E
Sbjct: 1076 KLNKTKSE 1083

>NDAI0F00290 Chr6 complement(60327..64991) [4665 bp, 1554 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1554

 Score = 99.4 bits (246), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 85/189 (44%), Positives = 112/189 (59%), Gaps = 20/189 (10%)

Query: 1479 ARTDQSIKIEEFQSLKKEWEEEYEKATLERIEEAKETLKKRIRLPSETKINRVIEKRKHE 1538
            A   +S  IEE +   +E +E      L+RI EA+E LKKR+RLPSE KIN VIEKR+  
Sbjct: 1339 ANGQESANIEELKKKWEEEQEAL---ILKRITEAEENLKKRMRLPSEEKINAVIEKRRKV 1395

Query: 1539 LENEYEVKLQE-KLNEIEANRNSIETIDPGKLREEIKEEVKRDMLIKFENDLNEAKKKSF 1597
            LE E+E KL+E  LN   A+ N + T    ++ +E++E        KF  +L E KKK+F
Sbjct: 1396 LEQEFETKLRELGLN---ADGNGVVTDTRAQIEKELRE--------KFNLELAEIKKKAF 1444

Query: 1598 EEGKQQSSMKTTLLERKISKLESQ-LSEAIENDKQSDKNPIISDLAQTSTLASIQPPSAK 1656
            EEGKQQS MK+TLLERK+SKLESQ LS    ND    + P   +L   S + S  PP  +
Sbjct: 1445 EEGKQQSMMKSTLLERKLSKLESQTLSPTKNNDSNETQVPSKINL---SNINSSSPPLGE 1501

Query: 1657 KP-AFSFGG 1664
            K    ++G 
Sbjct: 1502 KVLQLNYGA 1510

 Score = 83.2 bits (204), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 59/181 (32%), Positives = 106/181 (58%)

Query: 1181 ENHEKIVSELNQITLFKESNETLRNQVSELNEKNKTLQTKLNEENSKLSNLSMELKSVKE 1240
            E+ E+++    ++   +ESN  L  +V    + N+TL ++L +   KL  L  E+  +K 
Sbjct: 1057 EDKEEVMENTTKLLALEESNAKLIKEVENCTKVNETLSSQLADMQVKLEPLEQEINELKL 1116

Query: 1241 SLGDKETDIMLIKEESNKWRLRAEELSVQIDKVDLDSVSKLSTELDALKDDAETKRKQNA 1300
             + +KE  + + +EE  +W+LR++ +  Q   V+ ++  K   ++  L++  ET R +NA
Sbjct: 1117 KVAEKEQHLNICQEELERWKLRSQTILQQGKIVEEEAHMKSLEKIKTLEEQLETVRTENA 1176

Query: 1301 ELEERFNLLKKQAHERLNASKEIQSSLNKQINELKASNTNIELALSSEQKKSMDLQNTLS 1360
            +L +RF+ LKKQAHE+L+A+K +Q +L  QINEL  +  N+E +L  E +K+    N  +
Sbjct: 1177 QLTDRFDRLKKQAHEKLDAAKTMQINLTTQINELNETKVNLEKSLQQEIEKNNQSGNGAA 1236

Query: 1361 D 1361
            D
Sbjct: 1237 D 1237

>TPHA0E00230 Chr5 complement(28358..32212) [3855 bp, 1284 aa] {ON}
           Anc_5.702 YIL149C
          Length = 1284

 Score = 89.4 bits (220), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 124/478 (25%), Positives = 232/478 (48%), Gaps = 31/478 (6%)

Query: 367 LLKKQVTQEKLEKKHLQTQIESFIIELENKIPIISSFQEKNQAXXXXXXXXXXXXXXXXX 426
           +LKK++ + + ++  LQ ++E  I ELEN  P +++  +K                    
Sbjct: 300 ILKKEIQKLEGQRDLLQEKLEYLIHELENHAPELNNQYDKINELELLLSKEKNTSEHFKT 359

Query: 427 XXXXIQNKLNNYDSKLLTYQSNIKELIRQRLDLANQVKHLLLFVAVKNDSGGPLTREEIE 486
               I+N+  N  S+L      I+ L  +  DL NQ++ +L+  +++ND  G LT  EI+
Sbjct: 360 TIKEIENEKKNIISRLKLSDDKIETLREENNDLTNQIQFMLISNSIQNDKYGELTENEIK 419

Query: 487 FINKISNNSEDLNGSEL-TSQHVISERLVTFSNIEELQAKNMELLNSIRSLSENLENIEN 545
           FI  +     + + +EL  SQ +IS+RL+ F ++  LQ KNMEL+ ++R +++ L+N E+
Sbjct: 420 FIKALREKGTETSFNELYNSQDIISDRLIRFESVISLQQKNMELIKTLRLITKKLDNQEH 479

Query: 546 ANSHK-EFQNKTIA-DAKEAILTLQYHNDILESKVKVLEAERDSFKLLLNNNVSIDSSIK 603
               K E +N  +  +AKE IL +   +D L+ K+  L+ +       LN N  + S  K
Sbjct: 480 ELRAKWEAENDDVLNEAKEEILKVVSESDKLKEKISELQQQ-------LNANRPV-SHEK 531

Query: 604 NDDLSSSTSPETNEKSIEKLQTLIEELKAELKK-NKDALESQIASFTADK------SNLT 656
           N      +    N+   E  + +++ELK  + +  K A  S I S   D+       NL 
Sbjct: 532 N---GHESVLAENKLYTEGDRLILDELKNNIPEFTKQA--SNIISMNFDQLTSLYNKNLE 586

Query: 657 ISLEKEKS--SNTLMAEKISLTESAFDMLKTENKELNKRFENLQNIIIKQESKLGDIINK 714
           ++ ++ K+  S  +  +K+ L +  +D L   N++L +  E +++ I +++  L   I  
Sbjct: 587 LTADRLKAYQSRDITQKKLDLLQDKYDYLSISNEKLKEHMEVIKDTIRRKDETLNSTIAN 646

Query: 715 YITGETE---ISNLKTQLSIAKSEKDFLVKSQDSLNSELIKTSEEKNKLRIMLSQLQSLQ 771
           ++  +     ++N    L     E  +L   Q  + +EL     E+ +L++ L  ++++Q
Sbjct: 647 HVDCKASLLSVTNDMNSLMTKYDELKYLKDQQSRITNEL---KMEREQLKMELLNIKTVQ 703

Query: 772 NERMTLLDDTQKKFMSKIHELENNNLDLIKNLGSKMTEIQKLSISNESQCTWYQNTID 829
            +      + +    SKI++LE  N +L K+L +K  E+Q    +   +  WYQ   D
Sbjct: 704 IQSDLESAEYKASVASKINDLEITNSNLSKDLRTKEQELQDFISTKNRELDWYQKKFD 761

 Score = 59.7 bits (143), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 46/128 (35%), Positives = 73/128 (57%), Gaps = 9/128 (7%)

Query: 1208 SELNEKNKTLQTKLNEENSKLSNLSMELKSVKESLGDKETDIMLIKEESNKWRLRAEELS 1267
            S L + N+ LQ KLN+    +  + ME+K + +S+ + + + + I  E    R R +EL 
Sbjct: 902  SSLMKSNRQLQEKLNDSEKHIEQMDMEIKKLNDSILEYQKNTLNITSEITLLRNRCKELE 961

Query: 1268 VQIDKVDLDSVSKLSTELDALKDDAETKRKQNAELEERFNLLKKQAHERLNASKEIQSSL 1327
             ++ +  L S           K+  E K K+N E  +RFN LKKQA+ RL++SKE Q++L
Sbjct: 962  NKLKEASLQS---------DFKEKYEMKSKENDENIDRFNRLKKQANARLHSSKEEQNAL 1012

Query: 1328 NKQINELK 1335
            N+QI+ LK
Sbjct: 1013 NEQISSLK 1020

>TPHA0D04610 Chr4 (1006833..1010384) [3552 bp, 1183 aa] {ON}
           Anc_5.702 YIL149C
          Length = 1183

 Score = 80.1 bits (196), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 64/215 (29%), Positives = 115/215 (53%), Gaps = 17/215 (7%)

Query: 365 INLLKKQVTQEKLEKKHLQTQIESFIIELENKIPII---SSFQEKNQAXXXXXXXXXXXX 421
           I+ +K ++ +EK EK  L+ +   F+ ++E+K+P +   S   E N              
Sbjct: 283 IDDIKTELIKEKYEKSLLEKKFNDFLFDIESKLPYLQNNSVENETNNGNKIEEQKIIHEH 342

Query: 422 XXXXXXXXXIQNKLNNYDSKLLTYQSNIKELIRQRLDLANQVKHLLLFVAVKN-DSGGPL 480
                    ++ KLN++       +S +K L++QR DL +Q+ +LL+  +  N D+   L
Sbjct: 343 DSLKLENQSLKIKLNDF-------ESTVKTLLQQRSDLGHQINYLLITQSYLNEDNNKIL 395

Query: 481 TREEIEFINKISNNSEDLNGSELTSQHVISERLVTFSNIEELQAKNMELLNSIRSLSENL 540
           T  E+ FI  +   ++  N     +Q++ISERL+ FSN+ +L AKN++L++ +R L+  +
Sbjct: 396 TENELNFIRNLV--AQPTNTWSTETQNIISERLLKFSNVSDLTAKNIKLISLVRELTNKM 453

Query: 541 ENIENANSHK----EFQNKTIADAKEAILTLQYHN 571
           E+IE  NS K    E   K+I +AK+ ++ L+  N
Sbjct: 454 ESIEKQNSQKFGDLEMDFKSIDEAKQRMIVLKEEN 488

 Score = 42.7 bits (99), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 62/264 (23%), Positives = 110/264 (41%), Gaps = 86/264 (32%)

Query: 1492 SLKKEWEEEYEKATLERIEEAKETLKKRIRLPSETKINRVIEKRKHELENEYEVKLQEKL 1551
            ++K+ WE+EY+     RIE+A+               N+ + + + ELE EYE +L ++ 
Sbjct: 944  TMKEAWEKEYQHILKIRIEDAE---------------NQAMARTRKELEKEYEERLSKES 988

Query: 1552 NEIEANRNSIETIDPGKLREEIKEEVKR-------DMLIKFENDLNEAKKKSFEEGKQQS 1604
             ++    N        KL++++ EE+ +       ++  K +N+ +E+KK+ F++     
Sbjct: 989  EKLSDQYN-------NKLKDDLSEELLKIDKKYAMELETKLKNETDESKKE-FQDALGTE 1040

Query: 1605 SMKTTLLERKISKLESQLSEAIENDKQSDKNPIISD--LAQTSTLASIQPPSAKKPAFSF 1662
              K  +L +KI  LE+Q+ E  +   +   NP+ SD  +  T+ L++          F+F
Sbjct: 1041 QTKNKILSKKIEFLETQIKELKDEQTKHHSNPMKSDEKIPSTTNLST---------NFAF 1091

Query: 1663 GGFNTTNSLNANKGFXXXXXXXXXXXKDTEIVQNPFSLGVSQTSSSPMHFNPFSSSATTS 1722
            G                               QNPF   VS  S +    N F S +   
Sbjct: 1092 G-------------------------------QNPF---VSNASQNAYMSNVFLSGSP-- 1115

Query: 1723 NVFNQNGTSKNIFGNVMAMKPTTP 1746
              F++N   K       A K +TP
Sbjct: 1116 --FSRNAPEK-------AFKHSTP 1130

>Skud_12.393 Chr12 complement(689954..692695) [2742 bp, 913 aa] {ON}
            YLR309C (REAL)
          Length = 913

 Score = 47.4 bits (111), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 76/274 (27%), Positives = 135/274 (49%), Gaps = 60/274 (21%)

Query: 1135 ETKLSIAERDSKNNASKLESLRDELANVQMKLISSENKL--------------------L 1174
            ETK S+ E++S+     LE +RD L  V  +L+ +++++                    L
Sbjct: 382  ETKKSLKEKNSE-----LEEVRDMLRVVGNELVDAKDQIKESTNKQFEEVKAVKLELDNL 436

Query: 1175 RH--SDLIENHEKIVSEL-NQITLFKESNETLRNQVSELNEKNKTLQ---TKLNEENSKL 1228
            RH  + +IE +E  + EL N+I    +  E L+   +E  E++  LQ    KLNEE S+L
Sbjct: 437  RHKNASMIEAYETKIIELKNKIDSLNKEAEHLKTSSAEKEEEHAVLQKKVAKLNEEISQL 496

Query: 1229 ----SNLSMELKSVKESLGDKETDIMLIKEESNKW---RLRAEELSVQIDKVDLDSVSKL 1281
                SNL+ EL S++ S   K+  +  ++E+  ++   +  AE+ + Q+ K ++    K+
Sbjct: 497  TCERSNLTKELTSLRISYKQKDKTVGYLEEQVKQFSEQKDAAEKSTEQLQKENV----KM 552

Query: 1282 STELDALKDDAETKR--------------KQNAELEERFNLLKKQAHERLNASKEIQSSL 1327
            S +LD LK + ET                K+N +L ER N+L     E+ N  + ++S+ 
Sbjct: 553  SNKLDLLKKENETLHNDIAKNGNSYEMYLKENGKLSERLNIL----QEKYNTLQNVKSNS 608

Query: 1328 NKQINELKASNTNIELALSSEQKKSMDLQNTLSD 1361
            N+ I+ +K     + + L    KK + L++ LS+
Sbjct: 609  NEHIDTIKRQCEELNVKLKESTKKILSLEDELSE 642

>ZYRO0D11902g Chr4 complement(1008230..1009561) [1332 bp, 443 aa] {ON}
            highly similar to uniprot|Q99312 Saccharomyces cerevisia
            YOR155C ISN1 Inosine 5'-monophosphate (IMP)- specific 5'-
            nucleotidase
          Length = 443

 Score = 42.4 bits (98), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 30/84 (35%), Positives = 49/84 (58%), Gaps = 10/84 (11%)

Query: 1495 KEWEEEYEKATLERIEEAKETLKKRIRLPSETKINR------VIEKRKHE--LENEYEVK 1546
            K WE++Y + TL+  E+   TLK+R++LPSE  I R      ++   K +   + + +VK
Sbjct: 275  KSWEDKYMEQTLDFAEKILHTLKQRLKLPSEAPIIRKKRAVGIVPGEKFDPVTQRQVQVK 334

Query: 1547 LQ-EKLNEIEAN-RNSIETIDPGK 1568
            LQ E+L EI    ++S+ET  P +
Sbjct: 335  LQREQLEEIVLTLQSSLETFLPAR 358

>Skud_15.362 Chr15 (651999..654488) [2490 bp, 829 aa] {ON} YOR195W
           (REAL)
          Length = 829

 Score = 41.2 bits (95), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 103/397 (25%), Positives = 185/397 (46%), Gaps = 86/397 (21%)

Query: 574 LESKVKVLEAERDSFKLLLNNNVSIDSSIKNDDLSSSTSPETNEKSIEKLQTLIEELKAE 633
           L +++KVL + +   +   +N+++  + +KND  +++   + NEK++ +    +E++K E
Sbjct: 391 LNTEIKVLNSNQKILQEKFDNSINELNQVKNDQYNTNNILQRNEKNLNEKNAELEKIKKE 450

Query: 634 LKKNKDALESQIASFTADKSNLTISLEKEKSSNTLMAEKISLTESAFDMLKTENKELNKR 693
           L                              S TL  EK+S +++  +            
Sbjct: 451 L------------------------------STTL--EKLSESQTTLN------------ 466

Query: 694 FENLQNIIIKQESKLGDIINKYITGETEISNLKTQLSIAKSEKDFLVKSQDSLNSELIKT 753
             +L + I +  SK+GD  +  I+ E+E++NLK  L      K+ L  S+DS +S+LI  
Sbjct: 467 --DLNSCIAQLNSKVGDTNSVLISKESELNNLKISL------KETLSISKDSNDSDLIAQ 518

Query: 754 SEE----KNKLRIMLSQLQSLQNERMTLLDDTQKKFMSKIHELENNNLDLIKNLGSKMTE 809
             E    KN L+  L  L +L ++ +  L   Q+K M     L   + + I +L S++ E
Sbjct: 519 LNELISAKNSLQQKLDDLSNLNDDNLKKL---QEKLMEDETALRRKDAE-INSLNSELEE 574

Query: 810 IQKLSISNESQC-TW---YQNTIDDLKKINSAIKTELTSKNSLISDLNTKIELLESQSYT 865
           ++K  IS +++  TW   Y+N ++D  KI +A  TELT     I DL       ES+ + 
Sbjct: 575 LKKHVISKDNEFETWKSKYEN-VEDEAKIRNAEVTELTRD---IDDLK------ESKVHL 624

Query: 866 IDTNTRCSSSGNDFSQISKDLDITKLHLSEAYTQVEEYKQLYTST--EESLKTLESNFES 923
            +T T      N   ++  D D+ K    +   ++E   QL  S    E +K LE+  E+
Sbjct: 625 QETITELE---NHVHKLENDYDLEKEKFEKTSLELESL-QLKNSNIQAEHIKELENLHEN 680

Query: 924 VKNLMD------DKISKLLSENETLKASTGEYDKRIS 954
           + +L D      ++++ L  ENETLK +    +K ++
Sbjct: 681 LLSLQDELKISSERVTALTKENETLKQNNDNNNKSVT 717

>YLR309C Chr12 complement(749034..751769) [2736 bp, 911 aa] {ON}
            IMH1Protein involved in vesicular transport, mediates
            transport between an endosomal compartment and the Golgi,
            contains a Golgi-localization (GRIP) domain that
            interacts with activated Arl1p-GTP to localize Imh1p to
            the Golgi
          Length = 911

 Score = 40.8 bits (94), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 89/356 (25%), Positives = 165/356 (46%), Gaps = 81/356 (22%)

Query: 1132 DVLETKLSIAERDSKNNASKLESLRDELANVQMKLISSENKL------------------ 1173
            ++++TK S+ E++S+     LE +RD L  V  +L+ +++++                  
Sbjct: 377  ELIDTKKSLKEKNSE-----LEEVRDMLRTVGNELVDAKDEIKESSSKQNEEVKTVKLEL 431

Query: 1174 --LRH--SDLIENHEKIVSEL-NQITLFKESNETLRNQVSELNEKNKTLQ---TKLNEEN 1225
              LRH  + +IE +E   +EL ++I L  +  E L+N  +E  ++  T Q    KLNEE 
Sbjct: 432  DDLRHKNATMIEAYEAKNTELRSKIELLSKKVEHLKNLCTEKEKEQTTSQNKVAKLNEEI 491

Query: 1226 SKL----SNLSMELKSVKESLGDKETDIMLIKEESNKWRLR---AEELSVQIDKVDLDSV 1278
            S+L    SN++ EL S++ S   KE  +  ++E+  ++  +   AE+ + Q+ K      
Sbjct: 492  SQLTYEKSNITKELTSLRTSYKQKEKTVSYLEEQVKQFSEQKDVAEKSTEQLRK----DH 547

Query: 1279 SKLSTELDALKDDAETKR--------------KQNAELEERFNLLKKQAHERLNASKEIQ 1324
            +K+S  LD LK + ET                K+N +L ER N+L     E+ N  + ++
Sbjct: 548  AKISNRLDLLKKENETLHNDIAKNSNSYEEYLKENGKLSERLNIL----QEKYNTLQNVK 603

Query: 1325 SSLNKQINELKASNTNIELALSSEQKKSMDLQ-----------------NTL----SDNE 1363
            S+ N+ I+ +K     + + L    KK + L+                 NTL    SD++
Sbjct: 604  SNSNEHIDSIKRQCEELNVKLKESTKKILSLEDELNEYANIVQDKTREANTLRRLVSDSQ 663

Query: 1364 VKYTQKLSNIESELKALKTENNSFKLSSEKEKMELTDEVDSLKKSLVEAQSKLSAI 1419
               + K   +E++L  L  E N  +   + +      E+   K ++ E +S++ A+
Sbjct: 664  TDDSSKQKELENKLAYLTDEKNKLEAELDLQTSRKATELQEWKHTVTELKSEIHAL 719

>KAFR0F03020 Chr6 (595158..597632) [2475 bp, 824 aa] {ON} Anc_4.46
            YLR309C
          Length = 824

 Score = 40.4 bits (93), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 39/146 (26%), Positives = 87/146 (59%), Gaps = 12/146 (8%)

Query: 1149 ASKLESLRDELANVQMKLISSENKLLRHSDLIENHEKIVSE----LNQITLFKESNETLR 1204
            +S++E +RD L +V  +L+ +++K+   +     +++++S+     N+IT  KE N+ ++
Sbjct: 299  SSEVEEVRDMLRDVGNELVEAKDKIKEFNQSSNANDELISKNSNLENEITRIKEENDNVK 358

Query: 1205 NQVSELNEKNKTLQTKLNEENSKLSNLSMELKSVKESLGDKETDIMLIKEESNKWRLRAE 1264
            N++S   ++N+ L+T+++   +   NL+  ++S+K      E +I L+K+E++K      
Sbjct: 359  NEISAARQENENLKTEISTLKTDTDNLNGHIQSIKNDNNKLENEIQLVKKENSKL----- 413

Query: 1265 ELSVQIDKVDLDSVSKLSTELDALKD 1290
            E  V+  K + D   KLS++L+ +K+
Sbjct: 414  ETEVKTSKNETD---KLSSQLNQVKN 436

>Suva_8.377 Chr8 (666400..671106) [4707 bp, 1568 aa] {ON} YOR326W
            (REAL)
          Length = 1568

 Score = 39.7 bits (91), Expect = 0.091,   Method: Compositional matrix adjust.
 Identities = 54/168 (32%), Positives = 84/168 (50%), Gaps = 23/168 (13%)

Query: 1251 LIKEESNKWRLR---AEELSVQIDKVDLDSVS-KLSTELDALKDDAETKRKQNAELEERF 1306
            LI+  + + RLR   ++  SV      L  VS KL  ++  L  +  +K K+N E+ ER 
Sbjct: 915  LIRRRAAQGRLRQLKSDAKSVH----HLKEVSYKLENKVIELTQNLASKVKENKEMTERI 970

Query: 1307 NLLKKQAHERLNASKEIQSSLNKQINELKASNTNIELALSSEQKKSMDLQNTLSDNEVKY 1366
              L+ Q  E    S ++Q +L    N  K    NI+    +++ K M+LQ T+ DN    
Sbjct: 971  KELQVQVEE----SAKLQETLE---NMKKEHLVNID----NQKNKDMELQKTIEDNLQST 1019

Query: 1367 TQKLSNIESELKALKTENNSFKLSSEKEKMELTDEVDSLKKSLVEAQS 1414
             Q L N + EL+ +  ++N  K  S K+     DE+D  KK+LVE Q+
Sbjct: 1020 EQNLKNAQLELEEMVKQHNELKEESRKQ----LDELDETKKALVEHQT 1063

>Kpol_2001.75 s2001 (206286..209306) [3021 bp, 1006 aa] {ON}
            (206286..209306) [3021 nt, 1007 aa]
          Length = 1006

 Score = 38.5 bits (88), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 30/88 (34%), Positives = 48/88 (54%)

Query: 1281 LSTELDALKDDAETKRKQNAELEERFNLLKKQAHERLNASKEIQSSLNKQINELKASNTN 1340
            L  + + LK   E K K+  E  ++F+ LK+QA+ERLNASK  Q  L+  +  L+   TN
Sbjct: 646  LKNDYENLKKSFEEKSKEVEEANDKFSRLKRQANERLNASKTTQKELSDNVKSLEDERTN 705

Query: 1341 IELALSSEQKKSMDLQNTLSDNEVKYTQ 1368
             +  +S  +    +L N L + E K ++
Sbjct: 706  FKEHISKLEVDINNLNNALVEAEKKLSE 733

 Score = 33.9 bits (76), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 24/93 (25%), Positives = 47/93 (50%)

Query: 367 LLKKQVTQEKLEKKHLQTQIESFIIELENKIPIISSFQEKNQAXXXXXXXXXXXXXXXXX 426
           +LKK +  EK     LQ ++ S ++EL  K+P ++S +EKN                   
Sbjct: 211 VLKKLLVHEKNSNLKLQEELNSILLELNFKLPSLTSLKEKNHELQSVFENIISSNEELLQ 270

Query: 427 XXXXIQNKLNNYDSKLLTYQSNIKELIRQRLDL 459
                 +K+ + ++K++ Y+ ++K+L+ QR +L
Sbjct: 271 QFHSNTDKIASMNNKIVDYEQSLKQLLSQRTNL 303

>Suva_8.251 Chr8 (451862..454351) [2490 bp, 829 aa] {ON} YOR195W
           (REAL)
          Length = 829

 Score = 38.5 bits (88), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 128/497 (25%), Positives = 213/497 (42%), Gaps = 100/497 (20%)

Query: 514 VTFSNIEELQAKNMELLNSIRSLSENLENIENANSHKEFQNKTIADAKEAILTLQYHNDI 573
           +   N + +  +N EL + I  L++NL ++ + N    FQ + ++   + ++      D 
Sbjct: 309 IRHDNFQIVAKRNEELTDQIYQLNQNLNSLISKNESISFQYEKLSKNHQHLI------DS 362

Query: 574 LESKVKVLEAERDSFKLLLNNNVSIDSSIKNDDLSSSTSPETNEKSIEKLQTLIEELKAE 633
              K++ L  ER+            +  IK                +EK +  I+EL  E
Sbjct: 363 STEKIERLSTERE------------NGVIK----------------VEKFKKRIKELNTE 394

Query: 634 LK---KNKDALESQIASFTADKSNLTISLEKEKSSNTLMAEKISLTESAFDMLKTENKEL 690
           +K    N+  L+ +      D   L    E EK+ N     +  L E   + L+   +EL
Sbjct: 395 IKVLNSNQKILQEKFDDSITDLDQLKN--EHEKTVNNFQRNEKLLNEKNVE-LENMKEEL 451

Query: 691 NKRFE----------NLQNIIIKQESKLGDIINKYITGETEISNLKTQLSIAKSEKDFLV 740
           +   E          +L + + +   K+GDI N     E E++NLK  L      K+ L 
Sbjct: 452 SINLEKLSESQVKINDLNSCVAQLNDKIGDIHNTLDCKEDELNNLKLSL------KETLS 505

Query: 741 KSQDSLNSELIKTSEE----KNKLRIMLSQLQSLQNERMTLLDDTQKKFMSKIHELENNN 796
            S+D  +++LI    E    KN L+  ++ L SL ++ +  L+D  K+          N 
Sbjct: 506 MSKDFDDADLITQLNELISTKNSLQQKINDLGSLNDDNLKSLNDELKE--------NKNT 557

Query: 797 LDL----IKNLGSKMTEIQK-LSISNESQCTWYQN--TIDDLKKINSAIKTELTSKNSLI 849
           L L    I +L  ++ E++K + + +E   TW+ N   ++D  KI SA  TEL   N  I
Sbjct: 558 LSLKDSEINSLNDEINELKKQIDLKDEEFKTWHNNYENVEDEAKIRSAEVTEL---NKDI 614

Query: 850 SDLN-TKIELLESQSYTIDTNTRCSSSGN----DFSQISKDLDITKLHLSEAYTQVEEYK 904
            DL  +K++L+E+ S   +   +  +  N     F + S  L++  L L  +  Q E  K
Sbjct: 615 EDLKESKLQLVETISELENKVLKVENEYNLEKEKFEKTS--LELESLQLKNSNIQAEHIK 672

Query: 905 QLYTSTEESLKTLESNFESVKN---LMDDKISKLLSENETLKASTGEYDKRISELSTDLK 961
           +        L+ L  N  S++N   +  D+IS L  ENETLK    E +   +       
Sbjct: 673 E--------LENLHENLVSLQNELGISSDRISLLTKENETLK----EQNSSTTSSVAVSN 720

Query: 962 NEKNKYSEEIAQLNVQI 978
           N+KNK  E I  L  QI
Sbjct: 721 NQKNKDDEHIKLLERQI 737

>Ecym_8356 Chr8 (713086..718521) [5436 bp, 1811 aa] {ON} similar to
            Ashbya gossypii ADL022C
          Length = 1811

 Score = 38.1 bits (87), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 50/167 (29%), Positives = 81/167 (48%), Gaps = 27/167 (16%)

Query: 1244 DKETDIMLIKEESNKWRLRAEELS-----VQIDKVDLDS-VSKLSTELDALKDDAETKRK 1297
            DK+ DI+L+ EE NK   +  ++S     ++     LD  VS LS+E  +L +  E    
Sbjct: 326  DKDRDIVLLLEEGNKLEAKIRQMSEDYKTLEFKSGQLDGQVSILSSEKRSLNEKVEELSS 385

Query: 1298 QNAELEERFNLLKKQAHERLNASK---EIQ---SSLNKQINELKASNTNIELALSSEQKK 1351
            Q    +   N LK +   +++ ++   EIQ   + LNKQ+NELK  N          ++K
Sbjct: 386  QLQSSKAEINTLKGELSSKIDDAEKRDEIQQELTLLNKQLNELKFENEAF-------KQK 438

Query: 1352 SMDLQNTLSDNEV--------KYTQKLSNIESELKALKTENNSFKLS 1390
            ++ L   L+D +          +  KLS +  +L+ L TEN + KLS
Sbjct: 439  NITLTIQLADQDAVVGKSFNDTFKSKLSALNGQLEELVTENQTLKLS 485

>KNAG0J01910 Chr10 complement(346989..349280) [2292 bp, 763 aa] {ON}
            Anc_8.704 YPL174C
          Length = 763

 Score = 36.6 bits (83), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 33/125 (26%), Positives = 63/125 (50%), Gaps = 12/125 (9%)

Query: 1293 ETKRKQNAELEERFNLLKKQAHERLNASKEIQSSLNKQ------INELKASNTNIELALS 1346
            ET  ++N  L E     K Q H +     E+   L+ Q      +  L  +N+ +   + 
Sbjct: 170  ETLIRENKRLGEAVAAAKSQLHTQQTCIAELSKQLDSQEYRDDIVVHLTETNSQLTTHVQ 229

Query: 1347 SEQKKSMDLQNT---LSDNEVKYTQKLSNIESELKALKTENNSFKLSSEKEKME---LTD 1400
            S Q++   L++    L   E KY  +++++E +L  L+TE ++FK+S ++ + E   L+ 
Sbjct: 230  SLQQELSGLEHLSARLESMESKYKSRIADLEDQLDRLQTELSTFKMSQQRAQAEADTLSS 289

Query: 1401 EVDSL 1405
            ++DSL
Sbjct: 290  QLDSL 294

>NCAS0E01920 Chr5 (368382..371894) [3513 bp, 1170 aa] {ON} Anc_7.186
          Length = 1170

 Score = 36.6 bits (83), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 51/200 (25%), Positives = 98/200 (49%), Gaps = 29/200 (14%)

Query: 1177 SDLIENHEKIVSELNQITLFKESNETLRNQVSELNEKNKTLQTKLNEENSKLSNLSMELK 1236
            SD+  N   I   +  +T  +E  +    ++  LN +  T+QTKLNEE  +L ++  EL+
Sbjct: 833  SDISANETAIEQVITALTTLEEERQQTEKKLDNLNAEISTVQTKLNEEKRRLLDIDDELR 892

Query: 1237 SVKESLGDKETDIMLIKEES-NK--WRLRAEELSVQIDKVDLDS------VSKLSTELDA 1287
             ++           LIKE++ NK  W L  + L+ ++DK   ++      +S L TE + 
Sbjct: 893  ELEN----------LIKEKNENKANWELEQQRLTHELDKNKSNTNSLQKRISDLLTEQEW 942

Query: 1288 LKDD-------AETKRKQNAELEERFNLLKKQAHERLNASKEIQSSLNKQINELKASNTN 1340
            L+D+        E +    AE  ER N L+++ HE     ++I  ++   I  ++   + 
Sbjct: 943  LRDNDLVEGIIQENRGVNLAEYRERGNQLEEKFHE---MRRKINPNIMSMIENVEKKESA 999

Query: 1341 IELALSSEQKKSMDLQNTLS 1360
            +++ + + +K  + +Q T+S
Sbjct: 1000 LKVMIRTIEKDKVKIQETIS 1019

>KLTH0D09504g Chr4 (783223..785379) [2157 bp, 718 aa] {ON} weakly
            similar to uniprot|Q08581 Saccharomyces cerevisiae
            YOR195W SLK19 Kinetochore-associated protein required for
            normal segregation of chromosomes in meiosis and mitosis
            component of the FEAR regulatory network which promotes
            Cdc14p release from the nucleolus during anaphase
            potential Cdc28p substrate
          Length = 718

 Score = 36.6 bits (83), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 74/297 (24%), Positives = 146/297 (49%), Gaps = 36/297 (12%)

Query: 1124 FNRLRADRDVLETKLSIAERDSKNNASKLESLRDELANVQMKLISSENKLLRHSDLIENH 1183
            +  LRA + V + +     R+ +  +++  SL + ++ ++++L  + N++     +I  +
Sbjct: 242  YEMLRASQSVRDDQWQTQNREIEKLSTEKTSLEERVSRLKLRLSEARNEM----KMINQN 297

Query: 1184 EKIVSELNQITLFKESNETLRNQVSELNEKNKTLQTKL-NEENSKLSNLSMELKSVKESL 1242
             +I+ E  Q  +  + NE L+NQVSEL +    L+  + N  NSK        K V+E +
Sbjct: 298  SQILQEKFQTQI--QQNERLQNQVSELEDSENQLRVHIENTTNSK--------KRVEEEI 347

Query: 1243 GDKETDIMLIKEESNKWRLRAEELSVQIDKVD--LDSVSKLSTELDA-LKDDAETKRKQN 1299
                 ++ L+ E   K +   E+L + + K    L   +K   EL A L+   +TK+K  
Sbjct: 348  ERTRAELALLTEGKFKTQSENEDLKLSVSKAQTLLAEKTKFIEELQANLRASHDTKQKST 407

Query: 1300 AELEERFNLLKKQAHERLNASKEIQSSLNKQI----NELKASNTNIELALSSEQKKSMDL 1355
             ELE+R N L  + +E +   +++ S+L  +I    NE+++  T ++       +  + L
Sbjct: 408  IELEQRINDLTLEKNELVRELEDM-STLRSKIEESENEIQSVKTELD-------RTQVAL 459

Query: 1356 QNTLSDNEVKYTQKLSNIESELKA----LKTENNSFKLSSEKEKMELTDEVDSLKKS 1408
            Q+ L +   +  +   ++E+ELK     L+T N+   + S  E +EL  +V  L++ 
Sbjct: 460  QH-LKEEHSELREHCRSLEAELKTSHQKLETANDQLAIKS-AEVVELGHDVKELRQG 514

>KNAG0B03860 Chr2 (740115..741533) [1419 bp, 472 aa] {ON} Anc_5.501
            YOR155C
          Length = 472

 Score = 36.2 bits (82), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 28/83 (33%), Positives = 45/83 (54%), Gaps = 10/83 (12%)

Query: 1496 EWEEEYEKATLERIEEAKETLKKRIRLPSETKINR------VIEKRKHE--LENEYEVKL 1547
            EW+E   KATL+  E+   TLK+R+ LP E  I R      ++  +K +     EY V+L
Sbjct: 305  EWDEADIKATLDFAEKTLNTLKRRLMLPKEAPIMRKKWAVGIVPGKKTDPSTGREYNVRL 364

Query: 1548 -QEKLNEIEAN-RNSIETIDPGK 1568
             +E+L EI    ++++E   P +
Sbjct: 365  SREQLEEIVLTLQSTLENFPPAR 387

>YOR195W Chr15 (712866..715331) [2466 bp, 821 aa] {ON}
            SLK19Kinetochore-associated protein required for normal
            segregation of chromosomes in meiosis and mitosis;
            component of the FEAR regulatory network, which promotes
            Cdc14p release from the nucleolus during anaphase;
            potential Cdc28p substrate
          Length = 821

 Score = 36.2 bits (82), Expect = 1.00,   Method: Compositional matrix adjust.
 Identities = 49/164 (29%), Positives = 91/164 (55%), Gaps = 17/164 (10%)

Query: 911  EESLKTLESNFESVKNLMDDKISKLLSENETLKASTGEYDKRISELSTDLKNEKNKYSEE 970
            EE+LK  E+  +S+ + MD+   ++ S+++  K    +Y+         +++E    + E
Sbjct: 547  EETLKLKEAEIDSLNSEMDELKKQITSKDDEFKMWQSKYET--------VEDEAKIRNAE 598

Query: 971  IAQLNVQITRLNKFKKDSADTASEYEEKISKLQSQLEL-KAKFADNAQEKYESLLTKDNA 1029
            + +LN  I  L + K    +T +E E K+ KL+++ EL K KF   + E  ESL  K N+
Sbjct: 599  VTELNGDIEDLKESKLHLEETITELENKVHKLENECELEKQKFEKTSLE-LESLQLK-NS 656

Query: 1030 NLQSIEEFKEQIEKLNQRIVIIESDL----EKKTSLLSENESLW 1069
            N+Q+ E  KE +E L++ ++ ++++L    ++ T+L  ENE L 
Sbjct: 657  NIQA-EHIKE-LENLHENLISLQNELKISSDRITTLTKENEVLM 698

>CAGL0E03454g Chr5 complement(316082..318685) [2604 bp, 867 aa] {ON}
            similar to uniprot|Q06704 Saccharomyces cerevisiae
            YLR309c IMH1
          Length = 867

 Score = 35.8 bits (81), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 43/185 (23%), Positives = 96/185 (51%), Gaps = 28/185 (15%)

Query: 1190 LNQITLFKESNETLRNQVSELNEKNKTLQTKLNEENSKLSNLSMELKSVKESLGDKETDI 1249
            LNQ T+ KE     ++ + +L+++NKTL+ +L + N           ++K +L  +E  I
Sbjct: 435  LNQTTILKEKEIASKDAIEKLSDENKTLKAQLKDIN-----------AIKLTLTQREKTI 483

Query: 1250 MLIKEESNKWRLRAEELSVQIDKVDLDSVSK------LSTELDALKDDAETKR------- 1296
              ++E+  ++  +   +   I+K++ +  SK      +  E ++LK +A+T         
Sbjct: 484  GYLEEQVKQYNEKNAVVQATIEKLEKELKSKESQLTTIQNENESLKKEAKTNVVSLENYL 543

Query: 1297 KQNAELEERFNLLKKQAHERLNASKEIQSSLNKQINELKASNTNIELALSSEQKKSMDLQ 1356
            K+N +L ER ++L     E+ + ++ ++S+ N+Q++ +K     + + L    K+ M L+
Sbjct: 544  KENGKLSERLSIL----QEKYDTAQNLKSNSNEQVDSIKRQCNELNVKLKESNKRIMSLE 599

Query: 1357 NTLSD 1361
            + L++
Sbjct: 600  DELNE 604

>KAFR0G02090 Chr7 complement(437389..439587) [2199 bp, 732 aa] {ON}
            Anc_8.604 YOR195W
          Length = 732

 Score = 35.8 bits (81), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 113/433 (26%), Positives = 196/433 (45%), Gaps = 80/433 (18%)

Query: 666  NTLMAEKISLTESAFDMLKTENKELNKRFENLQNIIIKQE----------SKLGDIINKY 715
            NTL A + SL +S +D L +EN  L K  E L N+ I+ E          ++  ++ N+ 
Sbjct: 307  NTLNANQ-SLLKSKYDNLISENDALKKNKELLNNLSIENEKLINQGKNWETRFSELENEK 365

Query: 716  ITGETEISNLKTQLSIAKSEKDFLVKSQDSLNSELIKTSEEKNKLRIMLSQLQSLQNERM 775
             + + + + +K Q S   S  + L      LN EL+  ++E+NK   +L+++ SLQ ER 
Sbjct: 366  DSADEKFAQIKEQFSELTSRNESLENQITELN-ELLSVAKEENKNSDLLNEVNSLQEERK 424

Query: 776  TLLDDTQKKFMSKIHELENNNLDLIKNLGSKMTEIQKLSISNESQCTWYQNTIDDLKKIN 835
             L    QKK + KI   + N + ++++  S + E    +IS+   C   Q  I++L    
Sbjct: 425  EL----QKK-LEKIELDKENEVSILESKISALNE----TISSLQSC---QKEIENLNSTK 472

Query: 836  SAIKTELTSKNSLISDLNTKIELLESQSYTIDTNTRCSSSGND-----FSQISKDLDITK 890
            + ++ +LT+  S   ++N    +  ++   +++        ND      S++ ++++I K
Sbjct: 473  TNLENDLTALKSKFEEVNDNSSIRTAEVTELNSQIESLRESNDQLQELNSKLDEEIEILK 532

Query: 891  LHLSEAYTQVEEYKQLYTSTE-----------------ESL-KTLESNFESVKNLMDDKI 932
               SE+  Q EEYK++    E                 ESL KT++S  +S+K   D+ I
Sbjct: 533  ---SESLKQDEEYKKVSIELESIQLKNKNVEVERNDELESLHKTVDSLEKSLKGGYDE-I 588

Query: 933  SKLLSENETLKA-------STGEYDKRISELSTDLKNEKNKYSEEIAQLNVQIT------ 979
            ++L   NE LK+       +T E    +  L  D + +     E+I  L  QIT      
Sbjct: 589  TQLKKVNEQLKSQLESFEQNTHEDHSAVETLKKDFELKDKDSQEQIKALESQITSWRQKM 648

Query: 980  ---------RLNKFKKD-SADTASEYEEKISKLQSQLELKAKFADNAQEKYESLLTKDNA 1029
                     RL     D     +S++E+K+ KL     LK  +    Q + E L  ++  
Sbjct: 649  EHNERDITQRLKNLADDLYVKYSSKHEQKV-KL-----LKKSYESKYQSEIERLSLENKG 702

Query: 1030 NLQSIEEFKEQIE 1042
              Q IE+  +QIE
Sbjct: 703  FNQEIEQLNKQIE 715

>CAGL0D00924g Chr4 (108341..114283) [5943 bp, 1980 aa] {ON} similar to
            uniprot|P25386 Saccharomyces cerevisiae YDL058w USO1
            intracellular protein transport protein
          Length = 1980

 Score = 35.4 bits (80), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 98/409 (23%), Positives = 200/409 (48%), Gaps = 54/409 (13%)

Query: 879  FSQISKDLDITKLHLSEAYTQVEEYKQLYTSTEESLKTLESNFESVKNL---MDDKISKL 935
            F ++       K HLSE   Q  E +   +  E+ +K+L SNFE+ + L   ++DK+S +
Sbjct: 699  FEEVQNQCTSLKSHLSELEIQSSEKR---SQLEKQIKSLTSNFEASEQLKKELEDKLSTI 755

Query: 936  LSENETLKASTGEYDKRISELSTDLKNEKNKYSEEIAQLNVQITRLNK-FKKDSADTASE 994
              + +TL++   E  K ++E++ +        +  + QLN Q  +L +  KK  ADT   
Sbjct: 756  SEKQQTLESEYEEKKKELAEITAN--------NTSLEQLNTQKEKLTEELKKQLADT--- 804

Query: 995  YEEKISKLQSQLELKAKFADNAQEKYESLLTKDNANLQSIEEFKEQIEKLNQRIVIIESD 1054
             +EK+++++ Q+    K     +EK E  + K N +L S++  K+++E+ N++    + D
Sbjct: 805  -KEKLTQMEKQV----KELSEHKEKNEQGINKMNRDLFSLQREKQKLEEDNKQS---KKD 856

Query: 1055 LEKKTSLLSENESLWKKKQDAFISDLEESKKKIDNLTNQNKLYVDQLELLNKDFXXXXXX 1114
            LEK  +  ++ E+  K +  A    ++E+ +K++  T Q+K Y D+++ +  +       
Sbjct: 857  LEKTKNDFTKQETKLKDQIKAKEILIKETTEKLNEATTQSKEYHDKIQNITSEMNEWQAK 916

Query: 1115 XXXXET------------KHMFNRLRADRDVLETKLSIAERDSKNNASKLESLRDELANV 1162
                +T               F  L+A+RD ++++L    ++   N + + S +  L  +
Sbjct: 917  YKSHDTFVAKLTEKLKALATSFKELQAERDTIKSELEKITQERDTNIAAITSEKKSLEEL 976

Query: 1163 QMKLISSENKLLRH-SDL---IENHEK--------IVSELNQITL----FKESNETLRNQ 1206
               + S ++ LL+  ++L   IE+  K        + SE  ++TL    FK + E L  +
Sbjct: 977  YKNMESEKDGLLKKITELETGIESDNKKFEDEKSALESETKRLTLEIAEFKSNAEKLDTE 1036

Query: 1207 VSELNEKNKTLQTKLNEENSKLSNLSMELKSVKESLGDKETDIMLIKEE 1255
               L    ++ + KLNE NS +   + +L ++++ +   +++I  +K E
Sbjct: 1037 RERLQTLTESYKEKLNEANSSIDEKNKDLNNIQQQIEGSQSEISTLKAE 1085

>NDAI0E01450 Chr5 (288999..290555) [1557 bp, 518 aa] {ON} Anc_8.636
           YOR216C
          Length = 518

 Score = 35.0 bits (79), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 54/200 (27%), Positives = 99/200 (49%), Gaps = 27/200 (13%)

Query: 795 NNLDLIKNLGSKMTEIQK-LSISN------ESQCTWYQNTIDDLKKINSAIKTELTSKNS 847
           N +  +KN+ +KM E Q+ L I        ESQ    +N ++ + K  + + T + + N 
Sbjct: 176 NRISSMKNVFNKMKESQRDLEIVQDQVAEYESQNLKLKNKVELITKEKTELATTMVTLNK 235

Query: 848 LISDLNTKIELLESQSYTIDTNTRCSSSGNDFSQISKDLDITKLHLSEAYTQVEEYKQLY 907
            +S L  K E LE++S   +   +      DF +  K+   T  H  E Y + +E   L 
Sbjct: 236 ELSSLEDKYEALENKSMKYEKQLK------DFKRQEKENSNTYTHQLEGYRKEKEL--LD 287

Query: 908 TSTEESLKTLESNFESVKNLMDDK--ISKLLSENETLKASTGEYDKRISELSTDLKNEKN 965
           T  +E L  L++N + + NL D+K  + + L  +E  K +   +++ + +LS+ L+ ++N
Sbjct: 288 TQLQELLIILDNNKQDIVNLKDEKEEMKQALHASENEKTA---FEESLQQLSSKLEEQEN 344

Query: 966 KY-------SEEIAQLNVQI 978
            Y       ++EI  L+VQ+
Sbjct: 345 DYAQSLREKAQEIKALSVQL 364

>Kpol_363.1 s363 complement(438..1724) [1287 bp, 428 aa] {ON}
            complement(438..1724) [1287 nt, 429 aa]
          Length = 428

 Score = 34.7 bits (78), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 26/84 (30%), Positives = 46/84 (54%), Gaps = 10/84 (11%)

Query: 1495 KEWEEEYEKATLERIEEAKETLKKRIRLPSETKINR------VIEKRKHELENEYEVKL- 1547
            K+W++    ATL+  E    TLK+R++LP ET + R      ++   K +L +   V++ 
Sbjct: 273  KDWQDHDINATLDFAERTLITLKERLKLPVETVLVRKPRAVGLVPGEKSDLTSGKPVRVL 332

Query: 1548 --QEKLNEIEAN-RNSIETIDPGK 1568
              +E+L EI    ++S+ET  P +
Sbjct: 333  LSREQLEEIVLTIQHSLETFKPAR 356

>Smik_12.393 Chr12 complement(687243..689975) [2733 bp, 910 aa] {ON}
            YLR309C (REAL)
          Length = 910

 Score = 35.0 bits (79), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 46/85 (54%), Gaps = 7/85 (8%)

Query: 1259 WRLRAEELSVQIDKVDLDSVSKLSTELDALK-------DDAETKRKQNAELEERFNLLKK 1311
            WRL+ EE+  ++        S+L+   + LK       D  ++ +++N+ELEE  ++L+ 
Sbjct: 344  WRLKYEEMEAELKNTKESGASQLAKSAEELKTLNTELSDTKKSLKEKNSELEEVRDMLRT 403

Query: 1312 QAHERLNASKEIQSSLNKQINELKA 1336
              +E ++A  EI+   +KQ  E KA
Sbjct: 404  VGNELVDAKDEIKGFSSKQTEEAKA 428

>NCAS0A14940 Chr1 (2941337..2945347) [4011 bp, 1336 aa] {ON} Anc_7.488
            YBL047C
          Length = 1336

 Score = 35.0 bits (79), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 20/46 (43%), Positives = 30/46 (65%), Gaps = 4/46 (8%)

Query: 1182 NHEKIVSELNQITL----FKESNETLRNQVSELNEKNKTLQTKLNE 1223
            N+  I S+LN++T      +ESN  L++Q++ LN    TLQT+LNE
Sbjct: 658  NYHAIESKLNELTTELTTAQESNTNLKDQIANLNSMTATLQTQLNE 703

>YOR162C Chr15 complement(639560..641992) [2433 bp, 810 aa] {ON}
           YRR1Zn2-Cys6 zinc-finger transcription factor that
           activates genes involved in multidrug resistance;
           paralog of Yrm1p, acting on an overlapping set of target
           genes
          Length = 810

 Score = 34.7 bits (78), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 47/183 (25%), Positives = 86/183 (46%), Gaps = 34/183 (18%)

Query: 577 KVKVLEAERDSFKL-LLNNNVSIDSSIKNDDLSSSTSPETNEKSIEKL------------ 623
           KV+ +E++ ++F+L L+N ++ ++++I+   +  +  PE  E S   L            
Sbjct: 545 KVRNIESKNNTFQLVLINFSIIVNTTIRCYRIDKALYPEKFEASNPHLPPHMALSMSLTA 604

Query: 624 ----QTLIE-----ELKAELKKNKDALESQIASFTADKSNLTISLEKEKSSNTLMAEKIS 674
               +TL+        K  L +N   L + +    +D + LT+ L+K+ S  T M    S
Sbjct: 605 GLFSKTLVFFCSLIYFKLTLFENGLCLSNDMEVGWSDLTKLTVPLDKDLSLGTAM----S 660

Query: 675 LTESAFDMLKT-ENKELNKRFENLQNIIIK------QESKLGDIIN-KYITGETEISNLK 726
           L  S FD L T  NKEL +        +I+        + LG++I  + +T ET ++ +K
Sbjct: 661 LYSSIFDRLFTVGNKELIRTMHRSSQFVIELAIERTYRTILGNVIEFRKLTEETWLAQIK 720

Query: 727 TQL 729
            +L
Sbjct: 721 QEL 723

>KLLA0E15511g Chr5 (1388626..1391343) [2718 bp, 905 aa] {ON} similar
            to uniprot|P50090 Saccharomyces cerevisiae YGR238C KEL2
            Protein that functions in a complex with Kel1p to
            negatively regulate mitotic exit interacts with Tem1p and
            Lte1p localizes to regions of polarized growth potential
            Cdc28p substrate AND similar to YHR158C uniprot|P38853
            Saccharomyces cerevisiae YHR158C KEL1 Protein required
            for proper cell fusion and cell morphology functions in a
            complex with Kel2p to negatively regulate mitotic exit
            interacts with Tem1p and Lte1p localizes to regions of
            polarized growth potential Cdc28p substrate
          Length = 905

 Score = 34.7 bits (78), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 69/279 (24%), Positives = 136/279 (48%), Gaps = 52/279 (18%)

Query: 1158 ELANVQMKLISSENKLLRHSDLIENHEKIVSELNQITLFKESNETLRNQVSELNEKNKTL 1217
            EL N ++K +   N+L   +D+I++  +++++L      KE    L ++   L+EK ++L
Sbjct: 659  ELENTELKQL---NQLSHLNDMIKHQTEVIAKLQSEVDNKEKYVDLESKYIVLSEKYESL 715

Query: 1218 QTKLNEENSKLSNLSMELKSVKESLGDKETDIMLIKEESNKWRL-RAEELSVQIDK---- 1272
              +L+   SK   ++  +K   ESL D   D M  K+++++  + R +E    +D+    
Sbjct: 716  TKELD---SKKQFINENIKKCSESL-DTLLDGMRQKQKAHETVVTRHKETMTGLDRKLSE 771

Query: 1273 VDLD------SVSKLSTELDALKDDAETKRKQNAELEERFNLLKKQAHERLNASKEIQSS 1326
            V L       S  +L TE   LKD+  +K ++  ++E  +  +    H   NA +++Q+ 
Sbjct: 772  VILQNKELTTSRDQLFTEYSKLKDEHASKHEELTKMEREYRSVIDSVHNSGNAMEKLQN- 830

Query: 1327 LNKQINELKASNTNIELALSSEQKKSMDLQNTL---------SDNEVKYTQKLSNIESEL 1377
               +I +L+  N+ ++           DL+NT+         S N+  Y  K++++ +EL
Sbjct: 831  ---EIIKLRQENSRLK----------SDLENTINQEADDSSGSLNDAHYQLKINDLRAEL 877

Query: 1378 KALKTENNSFKLSSEKEKMELTDEVDSLKKSLVEAQSKL 1416
              +K E +S K           D+V +LKK L+ +++ L
Sbjct: 878  FIIKQERDSLK-----------DDVMTLKKKLLHSEATL 905

>KAFR0J01770 Chr10 (339037..339522) [486 bp, 161 aa] {ON} Anc_2.215
           YNL079C
          Length = 161

 Score = 33.1 bits (74), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 46/153 (30%), Positives = 77/153 (50%), Gaps = 10/153 (6%)

Query: 621 EKLQTLIEELK---AELKKNKDALESQIASFTADKSNLTISLEKEKSSNTLMAEKISLTE 677
           E  Q   EELK    EL++     E+QI S T     L   +E  +S    +AE   L E
Sbjct: 16  ETWQDKYEELKDQYKELEQGNTEKENQIKSLTVKNEQLETEVENLESQ---LAESKQLGE 72

Query: 678 SAFDMLKTENKELNKRFENLQNIIIKQESKLGDIINKYITGETEISNLKTQLSIAKSEKD 737
            + ++  T N+ LNK+ E L+N + + +SKL + I K    +  +  L+ +L   ++EKD
Sbjct: 73  DSTNLQST-NENLNKKNETLENDLEETDSKLKETIEKLRDADLRVEQLEKRLVALENEKD 131

Query: 738 FLVKSQDSLNSELIKTSEEKNKLRIMLSQLQSL 770
            L +    L S+ ++    KN+L  + + L++L
Sbjct: 132 QLEEKNQELESQYLQA---KNELDEIANSLENL 161

>ZYRO0C05676g Chr3 complement(434420..436297) [1878 bp, 625 aa] {ON}
            weakly similar to uniprot|Q01649 Saccharomyces cerevisiae
            YMR198W CIK1 is important for proper organiziation of
            microtubule arrays and establishment of a spindle is
            essential for karyogamy and expression is regulated by
            KAR4 and mating spindle pole body associated protein and
            to uniprot|Q12045 YPL253C VIK1 Protein that forms a
            complex with Kar3p at the spindle pole body, possible
            regulator of Kar3p function in microtubule- mediated
            processes; required for sister chromatid cohesion
          Length = 625

 Score = 34.3 bits (77), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 61/222 (27%), Positives = 104/222 (46%), Gaps = 35/222 (15%)

Query: 1192 QITLFKESNETLRNQVSELNEKNKTLQTKLNEENSKLSNLSMELKSVKESLGDKETDIML 1251
            +IT+  E  + L  QVS+L+ K   ++     E   +SNL +     K S+  +E +  L
Sbjct: 115  RITMCSELQKELSQQVSQLDLKEGEIEMLRRNEEMNISNLHL-----KWSVELQELETQL 169

Query: 1252 IKEESNKWRLRAEELSVQIDKVDLDSVSKLSTELDALKDDAETKRKQNAELEERFNLLKK 1311
             KE+ ++ RL+ E+  +Q++ +  D   K+  E+  LK +        A++EE++  L+K
Sbjct: 170  RKEQDDR-RLKWEKQLLQLENLKPD--EKIEQEIRQLKTEM-------AQVEEKWQELRK 219

Query: 1312 QAHERLN-ASKEIQSSLNKQINELKASNTNIELALSSE---QKKSMDLQNT--------- 1358
            Q  +R N  SKE+   L K    LKA   +  +   +E   +K+ +D Q+          
Sbjct: 220  QNQDRCNEYSKELDQELEK-FKSLKAGPMDELIKEQTELKNKKQDLDSQHQSLVQKMETC 278

Query: 1359 ------LSDNEVKYTQKLSNIESELKALKTENNSFKLSSEKE 1394
                  L D  V+  QK+  IE   K LK E ++  +  E E
Sbjct: 279  DKDCRELEDGVVQIEQKILEIEEHNKPLKEEVDTLLIEYELE 320

>Suva_2.528 Chr2 (942956..945790) [2835 bp, 944 aa] {ON} YDR356W
            (REAL)
          Length = 944

 Score = 33.9 bits (76), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 83/340 (24%), Positives = 153/340 (45%), Gaps = 69/340 (20%)

Query: 709  GDIINKYITGETEISNLKTQLSIAKSEKDFLVKSQ--DSL----NSELI--------KTS 754
             D +N Y   E E+ +L+ +L   + EKD   K++  DS     +S  I        K +
Sbjct: 180  NDSLNNYDNLEQEMDDLRNKLQ--ELEKDLAAKNKLVDSRKEEDHSACIEERERIERKLN 237

Query: 755  EEKNKLRIMLSQLQSLQN---ERMTLLDDTQ---KKFMSKIHELENNNLDLIKNLGSKMT 808
            + ++KL+ M  Q+  L+N    + +LL+  +   +K   ++ ELEN        L SK  
Sbjct: 238  DSESKLKTMKGQVHELENSANRKSSLLESKENELRKVKDQLKELENKADATCSQLDSKKN 297

Query: 809  EIQKLSISNESQCTWYQNTIDDLKKINSAIKTELTSKNSLISDLNTKIELLESQSYTIDT 868
            E++KL+           + +++L+   +   ++L SK S +  L  ++  LE+       
Sbjct: 298  ELRKLT-----------DQLNELENQANEKDSQLKSKESELKKLTNQLNELEN------- 339

Query: 869  NTRCSSSGNDFSQISKDLDITKLHLSEAYTQVEEYKQLYTSTEESLKTLESNFESVKNLM 928
              + + +G+  S    +L  +K+ ++E   ++ E     T+ E  LKTL +    ++  M
Sbjct: 340  --KVNQNGSQSSAKESELKKSKIQITELEEKINEKNSQLTAKENELKTLVAQLNQLEIKM 397

Query: 929  DDKISKLLSENETLKA--------------STGEYDKRISELSTDLKNEKNKYSEEIAQL 974
            + K S+L S+ E LKA               T   D+RIS+L T           ++  L
Sbjct: 398  NQKDSQLGSKEEELKAINEKLNADIKIARQQTASRDQRISDLQT-----------KVQDL 446

Query: 975  NVQITRLNKFKKDSADTAS-EYEEKISKLQSQLELKAKFA 1013
               ++R+ K   D+   A+ E E K+  +++ LE+  K A
Sbjct: 447  ENDLSRMEKTHNDTKSVANIELETKVKMIKT-LEIDLKLA 485

>Kpol_483.11 s483 complement(25219..32859) [7641 bp, 2546 aa] {ON}
           complement(25219..32859) [7641 nt, 2547 aa]
          Length = 2546

 Score = 34.3 bits (77), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 30/92 (32%), Positives = 48/92 (52%)

Query: 722 ISNLKTQLSIAKSEKDFLVKSQDSLNSELIKTSEEKNKLRIMLSQLQSLQNERMTLLDDT 781
           I  L+ +L   K  KD      + +N EL   S+EK +LRI   +L+    E++++ +D+
Sbjct: 812 IEKLENELKEVKERKDNAENGVNKMNKELSNLSKEKEQLRIEQGKLEKKIQEQISVYEDS 871

Query: 782 QKKFMSKIHELENNNLDLIKNLGSKMTEIQKL 813
           + KF  ++   E    DL  NL SK TE+  L
Sbjct: 872 KIKFNQELESTEKQITDLQSNLESKNTELDNL 903

>TBLA0C03290 Chr3 complement(799041..800804) [1764 bp, 587 aa] {ON}
           Anc_5.308 YHR037W
          Length = 587

 Score = 33.5 bits (75), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 28/113 (24%), Positives = 50/113 (44%), Gaps = 4/113 (3%)

Query: 519 IEELQAKNMELLNSIRSLSENLENIENANSHKEFQNKTIADAKEAILTLQYHNDILESKV 578
           + E   KN  L+++  ++S+++  ++      E+Q +  +      +      + L   +
Sbjct: 323 VGETGGKNFHLIHNSANISDSV--LQTIRGSFEYQGQKCSATSRVYIPKSKSKEFLTDLL 380

Query: 579 KVLEAERDSFKLLLNNNVSIDSSIKNDDLSSSTSPETNEKSIEKLQTLIEELK 631
            +L    +  KLL  N  S  SSI   DL     P  NE+S  KL  +IE+ K
Sbjct: 381 GLLNEPGEKSKLLPRNTGS--SSIGGGDLHGFIGPVINEQSFNKLTKVIEQAK 431

>ZYRO0B12144g Chr2 complement(976039..982056) [6018 bp, 2005 aa] {ON}
            similar to uniprot|P25386 Saccharomyces cerevisiae
            YDL058W USO1 involved intracellular protein transport
            coiled-coil protein necessary for protein transport from
            ER to Golgi Integrin analogue gene
          Length = 2005

 Score = 33.9 bits (76), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 69/251 (27%), Positives = 125/251 (49%), Gaps = 25/251 (9%)

Query: 1178 DLIENHEKIVSELNQIT-LFKESNETLRNQVSELNEKNKTLQTKLNE--ENSKLSNLSME 1234
            DL     K+ SELNQ+T  FKE ++  +  +  L E+ K +  +  E  +NSK     M+
Sbjct: 1373 DLEGKETKLSSELNQLTNKFKEDSKKNQENIQHLEEEKKIITDQRAELQKNSK-----MD 1427

Query: 1235 LKSVKESLGDKETDIMLIKEESNKWRLRAEELSVQIDKVDLDSVSKLSTELDALKDDAET 1294
            L+  ++ + D E  +  I  E +K      + S Q DK +++SV K       L++  + 
Sbjct: 1428 LEKKEKKIRDLENSVKRISSELSKL-----QKSSQNDKEEVESVKK------DLQEKVQA 1476

Query: 1295 KRKQNAELEERFNLLKKQAHERLNASKEIQSSLNKQINELKASNTNIELALSSEQKKSMD 1354
              K+   L E  + + KQ  ER+     ++  +++   E++  N  +E A S+  + S +
Sbjct: 1477 FEKERKLLNEGSDAVTKQYSERITV---LEDKVHQTELEVQRKNKELESAKSAADEASGE 1533

Query: 1355 LQNTLSDNEVKYTQKLSNIESELKALKTENNSFKLSSE---KEKMELTDEVDSLKKSLVE 1411
            L+N L +  V+ +   S I  + KA+K   +    S E   K+  +L  E+++LKK+L +
Sbjct: 1534 LRNQLEEKVVEVSSLKSTIGEQEKAIKKLESDLTDSRESGNKKIEDLNGELEALKKALSD 1593

Query: 1412 AQSKLSAIGSD 1422
             Q+++ A  SD
Sbjct: 1594 KQAEIEANKSD 1604

>NDAI0B05050 Chr2 complement(1235335..1236342) [1008 bp, 335 aa]
           {ON} Anc_1.278 YKR022C
          Length = 335

 Score = 33.1 bits (74), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 25/72 (34%), Positives = 39/72 (54%), Gaps = 7/72 (9%)

Query: 711 IINKYITGETEISNLKTQLSIAKSEKDFLVKSQDSLNSELIKTSEEKNKLRIMLSQL--- 767
           I++K + G+        QL I   + +F    +DSL+SEL KT  E  K+R+ L+ +   
Sbjct: 256 IVSKVVGGDILKDTYAMQLPILLRDNEF---EEDSLSSELFKTKLETKKVRLQLTGMKKE 312

Query: 768 -QSLQNERMTLL 778
            +SL N+R  LL
Sbjct: 313 KESLDNKRDILL 324

>KAFR0J00360 Chr10 (64813..66516) [1704 bp, 567 aa] {ON} Anc_5.308
           YHR037W
          Length = 567

 Score = 33.1 bits (74), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 31/118 (26%), Positives = 48/118 (40%), Gaps = 16/118 (13%)

Query: 519 IEELQAKNMELLNSIRSLSENLENIENA-----NSHKEFQNKTIADAKEAILTLQYHNDI 573
           + E   KN  L++       N  NI NA         E+Q +  + A    L     N+ 
Sbjct: 305 VGETGGKNFHLVH-------NTANIPNAIFNTIRGAFEYQGQKCSAASRLYLPESVSNEF 357

Query: 574 LESKVKVLEAERDSFKLLLNNNVSIDSSIKNDDLSSSTSPETNEKSIEKLQTLIEELK 631
           L + + +L      FK +   N S  S++   DL     P  +E+S +KL  +IE  K
Sbjct: 358 LTNMIGILNESNSKFKPV---NTSA-SALNGGDLHGFIGPVIHERSYDKLVNVIETAK 411

>NCAS0A12860 Chr1 complement(2536095..2538725) [2631 bp, 876 aa] {ON}
            Anc_2.590
          Length = 876

 Score = 33.1 bits (74), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 26/79 (32%), Positives = 44/79 (55%), Gaps = 8/79 (10%)

Query: 1016 AQEKYESLLTKDNANLQSIEEFKEQIEKLNQRIVIIESDLEKKTSLLSENESLWKKKQDA 1075
            AQ+++E LL + N    SI++  E IE    +I   + D+E +     EN    K+++DA
Sbjct: 547  AQDEHEGLLQEKNDIGTSIDKLHESIESHKAKIAGYQKDIEGQ-----ENR---KEREDA 598

Query: 1076 FISDLEESKKKIDNLTNQN 1094
             + DL E+KK+++   N N
Sbjct: 599  KLEDLTENKKELETTVNDN 617

>NCAS0C01350 Chr3 complement(246839..248806) [1968 bp, 655 aa] {ON}
           Anc_8.678
          Length = 655

 Score = 33.1 bits (74), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 52/210 (24%), Positives = 90/210 (42%), Gaps = 45/210 (21%)

Query: 545 NANSHKEFQNKTIADAKEAILTLQYHNDILESKVKVLEAERDSFKLLLNN--------NV 596
           N N H  +++  +      IL      D + + +  ++ +++S    LN         NV
Sbjct: 397 NGNGHIPYRDSKLTR----ILQPALSGDSIVTTICTIDTQKESAAETLNTLRFASRAKNV 452

Query: 597 SIDSSIKNDDLSSSTSPETNEKSIEKLQTLIEE---LKAELKKNKD----ALESQIASFT 649
           S+   +    L +ST     ++ I KL  +IEE   L ++LK N       L   +   T
Sbjct: 453 SLH--VNRKPLMNSTDGNDKDQRIAKLNKIIEEQQQLISQLKTNGGNKSVGLGLGLGVST 510

Query: 650 ADKSNLTISLEKEKSSNTLMAEKISLTESAFDMLKTENKELNKRFENLQNIIIK-----Q 704
           A  S + ++ E       +M   I+L       L+ ENK L  + EN + ++ K     Q
Sbjct: 511 AHGSGVRVTKE-------IMNPNITL-------LRAENKVLKYKLENCEKLLDKDTLELQ 556

Query: 705 ESKLGDIINKYITG-----ETEISNLKTQL 729
           +S L +I++    G     ET+I  L++QL
Sbjct: 557 DSDLTEIVDMLPAGVGSLLETKIQGLQSQL 586

>KLLA0C02299g Chr3 complement(194267..196243) [1977 bp, 658 aa] {ON}
            similar to uniprot|P17065 Saccharomyces cerevisiae
            YNL272C SEC2 Guanyl-nucleotide exchange factor for the
            small G-protein Sec4p located on cytoplasmic vesicles
            essential for post-Golgi vesicle transport
          Length = 658

 Score = 32.7 bits (73), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 66/128 (51%), Gaps = 12/128 (9%)

Query: 1134 LETKLSIAERD---SKNNASKLESLRDELANVQMKLISSENKLLRHSDLIENHEKIVSEL 1190
            LE +L +A++     +N A+    L+ EL +++++  + + K  +  ++  + EK V+ L
Sbjct: 31   LEEQLLVAKKTISTQQNIANSYNELKQELQSLKLQYETDKTKFKKQEEICADAEKKVATL 90

Query: 1191 NQ------ITLFKESNETLRNQVSELNEK---NKTLQTKLNEENSKLSNLSMELKSVKES 1241
            NQ       +LF E+N  + +   E N     N  L+ +L E++  L  LSM+LK++K  
Sbjct: 91   NQEIEDLTASLFDEANNMVADARKEQNAVEILNSKLKEQLKEKDLLLDTLSMQLKNLKNV 150

Query: 1242 LGDKETDI 1249
            L   E D 
Sbjct: 151  LYKFENDF 158

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.304    0.122    0.309 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 179,617,236
Number of extensions: 8512462
Number of successful extensions: 79558
Number of sequences better than 10.0: 4516
Number of HSP's gapped: 69122
Number of HSP's successfully gapped: 10243
Length of query: 1820
Length of database: 53,481,399
Length adjustment: 124
Effective length of query: 1696
Effective length of database: 39,262,815
Effective search space: 66589734240
Effective search space used: 66589734240
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 43 (21.9 bits)
S2: 73 (32.7 bits)