Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0E017105.706ON1526125855310.0
TDEL0B021405.706ON114740911961e-141
ZYRO0B16412g5.706ON137240711931e-138
KNAG0C066305.706ON128140911711e-136
YKR096W5.706ON119540711541e-134
Skud_11.3365.706ON118840711531e-134
Smik_11.3605.706ON118040711511e-134
Suva_11.3335.706ON118740711431e-133
KAFR0H001805.706ON124140911431e-132
NCAS0A031705.706ON131941111411e-132
KLTH0E00968g5.706ON114840711191e-130
Kwal_55.196785.706ON117840711201e-130
Kpol_1043.735.706ON126040911191e-129
AFR290W5.706ON121740911111e-128
CAGL0G02541g5.706ON129540411031e-127
KLLA0A00528g5.706ON122940810711e-123
Ecym_40155.706ON125740510661e-122
TPHA0E001905.706ON136140710651e-121
Skud_9.175.706ON111840810481e-120
YIL151C5.706ON111840610451e-120
Smik_9.185.706ON111840610451e-120
Suva_9.375.706ON111740710451e-120
SAKL0E15004g5.706ON119629410031e-114
CAGL0H06611g5.706ON12824099931e-112
NDAI0E050705.706ON15562949331e-102
TPHA0D046405.706ON9622301991e-14
KAFR0H027008.624ON104179764.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0E01710
         (1526 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0E01710 Chr5 complement(411712..416292) [4581 bp, 1526 aa] {...  2135   0.0  
TDEL0B02140 Chr2 complement(380503..383946) [3444 bp, 1147 aa] {...   465   e-141
ZYRO0B16412g Chr2 (1329195..1333313) [4119 bp, 1372 aa] {ON} sim...   464   e-138
KNAG0C06630 Chr3 (1284481..1288326) [3846 bp, 1281 aa] {ON} Anc_...   455   e-136
YKR096W Chr11 (626793..630380) [3588 bp, 1195 aa] {ON} Protein o...   449   e-134
Skud_11.336 Chr11 (608311..608769,608800..608948,608994..611952)...   448   e-134
Smik_11.360 Chr11 (616879..620421) [3543 bp, 1180 aa] {ON} YIL15...   447   e-134
Suva_11.333 Chr11 (611602..612061,612092..615195) [3564 bp, 1187...   444   e-133
KAFR0H00180 Chr8 complement(20661..24386) [3726 bp, 1241 aa] {ON...   444   e-132
NCAS0A03170 Chr1 complement(621400..625359) [3960 bp, 1319 aa] {...   444   e-132
KLTH0E00968g Chr5 complement(92019..95465) [3447 bp, 1148 aa] {O...   435   e-130
Kwal_55.19678 s55 complement(75394..78930) [3537 bp, 1178 aa] {O...   436   e-130
Kpol_1043.73 s1043 (155026..158808) [3783 bp, 1260 aa] {ON} (155...   435   e-129
AFR290W Chr6 (960776..964429) [3654 bp, 1217 aa] {ON} Syntenic h...   432   e-128
CAGL0G02541g Chr7 (231428..235315) [3888 bp, 1295 aa] {ON} simil...   429   e-127
KLLA0A00528g Chr1 complement(44587..48276) [3690 bp, 1229 aa] {O...   417   e-123
Ecym_4015 Chr4 complement(34835..38608) [3774 bp, 1257 aa] {ON} ...   415   e-122
TPHA0E00190 Chr5 complement(20436..24521) [4086 bp, 1361 aa] {ON...   414   e-121
Skud_9.17 Chr9 complement(34389..37745) [3357 bp, 1118 aa] {ON} ...   408   e-120
YIL151C Chr9 complement(57338..60694) [3357 bp, 1118 aa] {ON} Pu...   407   e-120
Smik_9.18 Chr9 complement(34956..38312) [3357 bp, 1118 aa] {ON} ...   407   e-120
Suva_9.37 Chr9 complement(51993..55343) [3351 bp, 1117 aa] {ON} ...   407   e-120
SAKL0E15004g Chr5 (1246544..1250134) [3591 bp, 1196 aa] {ON} sim...   390   e-114
CAGL0H06611g Chr8 (653472..657320) [3849 bp, 1282 aa] {ON} simil...   387   e-112
NDAI0E05070 Chr5 (1159816..1164486) [4671 bp, 1556 aa] {ON} Anc_...   363   e-102
TPHA0D04640 Chr4 (1012556..1015444) [2889 bp, 962 aa] {ON} Anc_5...    81   1e-14
KAFR0H02700 Chr8 (512455..515580) [3126 bp, 1041 aa] {ON} Anc_8....    34   4.3  

>TBLA0E01710 Chr5 complement(411712..416292) [4581 bp, 1526 aa] {ON}
            Anc_5.706 YIL151C
          Length = 1526

 Score = 2135 bits (5531), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1070/1258 (85%), Positives = 1070/1258 (85%)

Query: 269  LIQKLQNIYKLIVSQELELQDKCNKLSTSQSTKLKYLWSIYKLNHDLINNYILFILTSLS 328
            LIQKLQNIYKLIVSQELELQDKCNKLSTSQSTKLKYLWSIYKLNHDLINNYILFILTSLS
Sbjct: 269  LIQKLQNIYKLIVSQELELQDKCNKLSTSQSTKLKYLWSIYKLNHDLINNYILFILTSLS 328

Query: 329  PSQSINDQLIGKEILEIYKIERRLWIYGTITFLDILKNFANFMDPEILSQFITHVFESIS 388
            PSQSINDQLIGKEILEIYKIERRLWIYGTITFLDILKNFANFMDPEILSQFITHVFESIS
Sbjct: 329  PSQSINDQLIGKEILEIYKIERRLWIYGTITFLDILKNFANFMDPEILSQFITHVFESIS 388

Query: 389  NMISDLPIDFINPWYQRLGDLSRMAIALYPSNFIDWKLSSEYWYIESMKFTFSHGKLYYH 448
            NMISDLPIDFINPWYQRLGDLSRMAIALYPSNFIDWKLSSEYWYIESMKFTFSHGKLYYH
Sbjct: 389  NMISDLPIDFINPWYQRLGDLSRMAIALYPSNFIDWKLSSEYWYIESMKFTFSHGKLYYH 448

Query: 449  ISTVQQNPLEAFVNLGKSVFCFDTFIPSQRYMQLVIDNIYQRAFIERXXXXXXXXXXXXX 508
            ISTVQQNPLEAFVNLGKSVFCFDTFIPSQRYMQLVIDNIYQRAFIER             
Sbjct: 449  ISTVQQNPLEAFVNLGKSVFCFDTFIPSQRYMQLVIDNIYQRAFIERNSNSSSSNNAGSS 508

Query: 509  XXXXHFMTSSFAKNFQQRFLIEYLKHSEVMLLPNFLENDHLKTVVLNYFTNSFGKIAIQX 568
                HFMTSSFAKNFQQRFLIEYLKHSEVMLLPNFLENDHLKTVVLNYFTNSFGKIAIQ 
Sbjct: 509  SNPNHFMTSSFAKNFQQRFLIEYLKHSEVMLLPNFLENDHLKTVVLNYFTNSFGKIAIQS 568

Query: 569  XXXXXXXXXXXXXXXXXXXXXXQANIENINNGHNIPSSSNVITSESLQINAINLFNFRNI 628
                                  QANIENINNGHNIPSSSNVITSESLQINAINLFNFRNI
Sbjct: 569  NLSDPSNPNLNTNSGSNTSISGQANIENINNGHNIPSSSNVITSESLQINAINLFNFRNI 628

Query: 629  FKQKNSDILKYFFKNSATFAESHILQLIGFGDPKNPFALLFQLPKYLKEXXXXXXXXXXX 688
            FKQKNSDILKYFFKNSATFAESHILQLIGFGDPKNPFALLFQLPKYLKE           
Sbjct: 629  FKQKNSDILKYFFKNSATFAESHILQLIGFGDPKNPFALLFQLPKYLKERKTKRKSKASN 688

Query: 689  XXXXXXXXXXXXXXISSNTIPSSDVSMKYETXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 748
                          ISSNTIPSSDVSMKYET                             
Sbjct: 689  SNSNMNTNTTVNANISSNTIPSSDVSMKYETNSDSSNPTNSKSSLYKSSNSNIVMSSSTT 748

Query: 749  XXXXXXXXXXXXXXXXMDVDTELQNNGMEDEDEMLDNLSPQDFFNNLESLKLSFFLPNSL 808
                            MDVDTELQNNGMEDEDEMLDNLSPQDFFNNLESLKLSFFLPNSL
Sbjct: 749  SFATAISTTNNSISSNMDVDTELQNNGMEDEDEMLDNLSPQDFFNNLESLKLSFFLPNSL 808

Query: 809  EIWNESLKYINIISLNCSIIVLKKFLNGPLFVSLPHMLPWSYFIISLALRIESLENIESR 868
            EIWNESLKYINIISLNCSIIVLKKFLNGPLFVSLPHMLPWSYFIISLALRIESLENIESR
Sbjct: 809  EIWNESLKYINIISLNCSIIVLKKFLNGPLFVSLPHMLPWSYFIISLALRIESLENIESR 868

Query: 869  IFWLQFIRKIFPWNSIVSYLNVIISVLLDNCYENSMITKLINNYSNKNLDELLVEFNENE 928
            IFWLQFIRKIFPWNSIVSYLNVIISVLLDNCYENSMITKLINNYSNKNLDELLVEFNENE
Sbjct: 869  IFWLQFIRKIFPWNSIVSYLNVIISVLLDNCYENSMITKLINNYSNKNLDELLVEFNENE 928

Query: 929  YELPEVWKCYGSLWFDVIAENYQIYSRDCSKNISMKDTKCLNYPIDGLPFDEMEENGTNF 988
            YELPEVWKCYGSLWFDVIAENYQIYSRDCSKNISMKDTKCLNYPIDGLPFDEMEENGTNF
Sbjct: 929  YELPEVWKCYGSLWFDVIAENYQIYSRDCSKNISMKDTKCLNYPIDGLPFDEMEENGTNF 988

Query: 989  WKRSCRLIFLFKTMITRFNGFGGLTISSNTSVYCNRSDIPNNHILRTFAFKLLPDDDNYM 1048
            WKRSCRLIFLFKTMITRFNGFGGLTISSNTSVYCNRSDIPNNHILRTFAFKLLPDDDNYM
Sbjct: 989  WKRSCRLIFLFKTMITRFNGFGGLTISSNTSVYCNRSDIPNNHILRTFAFKLLPDDDNYM 1048

Query: 1049 NNSNKNSHGPDNSSNQNTTTDVMVHINQDDSSIVVDEDNVMSMLDSNLDKLDSFXXXXXX 1108
            NNSNKNSHGPDNSSNQNTTTDVMVHINQDDSSIVVDEDNVMSMLDSNLDKLDSF      
Sbjct: 1049 NNSNKNSHGPDNSSNQNTTTDVMVHINQDDSSIVVDEDNVMSMLDSNLDKLDSFNSNNNA 1108

Query: 1109 XXXXXXXXXXXXXXXXXXXXTIQNVIINDSNTERNIDTWIPFEKNSIQNTDLNCEPGLSL 1168
                                TIQNVIINDSNTERNIDTWIPFEKNSIQNTDLNCEPGLSL
Sbjct: 1109 INGNIMNNNGSISIDNSDENTIQNVIINDSNTERNIDTWIPFEKNSIQNTDLNCEPGLSL 1168

Query: 1169 IENESLFEYEGYKRFIPDFSNFDKNGELISTSLYTSTIIDXXXXXXXXXXXXXXXXXXXX 1228
            IENESLFEYEGYKRFIPDFSNFDKNGELISTSLYTSTIID                    
Sbjct: 1169 IENESLFEYEGYKRFIPDFSNFDKNGELISTSLYTSTIIDTINGSSSNANIINTTTNAND 1228

Query: 1229 XXXXXXXXXXGSNQNKESSNSTTNIDNKELFLMEKEIFNKILDPDYKNIDEIWRGEMFHD 1288
                      GSNQNKESSNSTTNIDNKELFLMEKEIFNKILDPDYKNIDEIWRGEMFHD
Sbjct: 1229 ESNNDSSATAGSNQNKESSNSTTNIDNKELFLMEKEIFNKILDPDYKNIDEIWRGEMFHD 1288

Query: 1289 TSIQFSDTYFVLDATSWLRHFAHVYKLATNGILKFAICLTTFQELRFLRKSKDENVMEAA 1348
            TSIQFSDTYFVLDATSWLRHFAHVYKLATNGILKFAICLTTFQELRFLRKSKDENVMEAA
Sbjct: 1289 TSIQFSDTYFVLDATSWLRHFAHVYKLATNGILKFAICLTTFQELRFLRKSKDENVMEAA 1348

Query: 1349 TRAIITLRQLYSEKRLLPLRFTGNIATHIEEHLEFEEQITWRSHVDEFVIEAIKRAQLKR 1408
            TRAIITLRQLYSEKRLLPLRFTGNIATHIEEHLEFEEQITWRSHVDEFVIEAIKRAQLKR
Sbjct: 1349 TRAIITLRQLYSEKRLLPLRFTGNIATHIEEHLEFEEQITWRSHVDEFVIEAIKRAQLKR 1408

Query: 1409 RDNRNQEDXXXXXXXXXXXXXXXXXXXXXXVTDMIFVLVTDDISMIKKRQEEKSDNDIIT 1468
            RDNRNQED                      VTDMIFVLVTDDISMIKKRQEEKSDNDIIT
Sbjct: 1409 RDNRNQEDSNVTSSNNNPIINNNENNGNLNVTDMIFVLVTDDISMIKKRQEEKSDNDIIT 1468

Query: 1469 FSTKFVFSLCNMLVNKFNYPREMTPMSNNNPIDGGIHQSQESDITIASPAITNKVCIN 1526
            FSTKFVFSLCNMLVNKFNYPREMTPMSNNNPIDGGIHQSQESDITIASPAITNKVCIN
Sbjct: 1469 FSTKFVFSLCNMLVNKFNYPREMTPMSNNNPIDGGIHQSQESDITIASPAITNKVCIN 1526

 Score =  313 bits (801), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 166/202 (82%), Positives = 166/202 (82%)

Query: 1   MFKSIFPNDQSXXXXXXXXXXXXSITKATTTKNNFLNNIAMVTTPISKSKLNTNSNTFGT 60
           MFKSIFPNDQS            SITKATTTKNNFLNNIAMVTTPISKSKLNTNSNTFGT
Sbjct: 1   MFKSIFPNDQSVNVNLFHNNHNNSITKATTTKNNFLNNIAMVTTPISKSKLNTNSNTFGT 60

Query: 61  AANSSKRQHSTSINSDVKRRTPKKIEDLTSASQFAISSRSNSLFNKTXXXXXXXXXXXXX 120
           AANSSKRQHSTSINSDVKRRTPKKIEDLTSASQFAISSRSNSLFNKT             
Sbjct: 61  AANSSKRQHSTSINSDVKRRTPKKIEDLTSASQFAISSRSNSLFNKTQSQLQLQLQMQLQ 120

Query: 121 XXXXXXXXXXXDISRDTSNNDATTNNIFFAKDKVKEIEKTVPDDKVNTTLNPMHNFSSPN 180
                      DISRDTSNNDATTNNIFFAKDKVKEIEKTVPDDKVNTTLNPMHNFSSPN
Sbjct: 121 IQSQSQSQSQSDISRDTSNNDATTNNIFFAKDKVKEIEKTVPDDKVNTTLNPMHNFSSPN 180

Query: 181 DFQTTTFQDNHPQGTSQSIPAH 202
           DFQTTTFQDNHPQGTSQSIPAH
Sbjct: 181 DFQTTTFQDNHPQGTSQSIPAH 202

>TDEL0B02140 Chr2 complement(380503..383946) [3444 bp, 1147 aa] {ON}
           Anc_5.706 YIL151C
          Length = 1147

 Score =  465 bits (1196), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 232/409 (56%), Positives = 283/409 (69%), Gaps = 76/409 (18%)

Query: 269 LIQKLQNIYKLIVSQELELQDKCNKLSTSQSTKLKYLWSIYKLNHDLINNYILFILTSLS 328
           L+QKLQ+IYK+IV QE+ELQ++C++L+ SQ+T+LK LW IYK+N DLINNY+ FI T+L 
Sbjct: 240 LVQKLQDIYKVIVKQEIELQERCSQLTNSQTTELKQLWVIYKVNSDLINNYVTFITTALL 299

Query: 329 PSQSINDQLIGKEILEIYKIERRLWIYGTITFLDILKNFANFMDPEILSQFITHVFESIS 388
           P QS  D  IG+EI+EIY+IERRLW+YGTITFLD+LKNF+NFMDPE+ +QFITHVF SIS
Sbjct: 300 PPQSDQDLAIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCAQFITHVFISIS 359

Query: 389 NMISDLPIDFINPWYQRLGDLSRMAIALYPSNFIDWKLSSEYWYIESMKFTFSHGKLYYH 448
           NM++D+P  +  PWYQRLGDLSRMAIALYPS FIDWKLS+E+WY+E+MK+ + HGKLYYH
Sbjct: 360 NMLADIPSRYAIPWYQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKYIYGHGKLYYH 419

Query: 449 ISTVQQNPLEAFVNLGKSVFCFDTFIPSQRYMQLVIDNIYQRAFIERXXXXXXXXXXXXX 508
           +STVQQN LEAFVNLGKSVFC DTF PSQ+YMQLVIDNIYQRAF+ER             
Sbjct: 420 MSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRAFVERNN----------- 468

Query: 509 XXXXHFMTSSFAKNFQQRFLIEYLKHSEVMLLPNFLENDHLKTVVLNYFTNSFGKIAIQX 568
                        N +   LIEYLKHSEVMLLP+FLE+  L+ VVL YF + FG      
Sbjct: 469 ------------GNHRNSQLIEYLKHSEVMLLPSFLESTDLQQVVLIYFRDKFG------ 510

Query: 569 XXXXXXXXXXXXXXXXXXXXXXQANIENINNGHNIPSSSNVITSESLQINAINLFNFRNI 628
                                                         +  N  N+F+ R +
Sbjct: 511 ----------------------------------------------MDTNENNIFDTRQM 524

Query: 629 FKQKNSDILKYFFKNSATFAESHILQLIGFGDPKNPFALLFQLPKYLKE 677
           F Q N D LKYFF+++  FAESHILQL+GFGDPKNPFALLF+LP+ LK+
Sbjct: 525 FDQ-NPDQLKYFFRHAPAFAESHILQLVGFGDPKNPFALLFELPRCLKD 572

 Score =  266 bits (680), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 130/279 (46%), Positives = 185/279 (66%), Gaps = 10/279 (3%)

Query: 767  VDTELQNNGMEDEDEMLD-----NLSPQDFFNNLESLKLSFFLPNSLEIWNESLKYINII 821
            V TE  +    DE+E +D         Q FF+N++SL   +  P SLE+WN SLKY+NI 
Sbjct: 586  VTTETSSAMAIDEEEYIDSSFSLGAQVQQFFDNIDSLTSPYLFPPSLEVWNCSLKYLNIT 645

Query: 822  SLNCSIIVLKKFLNGPLFVSLPHMLPWSYFIISLALRIESLENIESRIFWLQFIRKIFPW 881
            SL+CS+IVLKKFL GP+ V+LPH+LPW+YFII++  +++ + +  SR FWL+ + +IFPW
Sbjct: 646  SLHCSMIVLKKFLEGPMVVALPHLLPWAYFIIAVVSKVQHITDGASREFWLELVNRIFPW 705

Query: 882  NSIVSYLNVIISVLLDNCYENSMITKLINNYSNKNLDELLVEFNENEYELPEVWKCYGSL 941
            N+IV++LNV+I+  LDN + +  I  L    S   LD+L+  FN NE +LPEVWKC+G L
Sbjct: 706  NTIVNFLNVLIAYTLDNIHPSLPIDPLCEELSTMGLDQLVEHFNNNE-DLPEVWKCWGLL 764

Query: 942  WFDVIAENYQIYSRDCSKNISMKDTKCLNYPIDGLPFDEMEENGTNFWKRSCRLIFLFKT 1001
            WFD I +  ++   D  ++  +KD   L+ PIDG+ FD  +E+G  FWKR+CR+IFLFK 
Sbjct: 765  WFDAICDKDKV-QMDSYESAGIKDHMFLDLPIDGIGFDRDDESGIKFWKRACRVIFLFKR 823

Query: 1002 MITRFNGFGGLTISSNTSVYCNRSDIPNNHILRTFAFKL 1040
            +   F     L +SS   V+C R+D P NH+L++F FKL
Sbjct: 824  IAENFQ--TRLVVSSQAQVHCRRTD-PMNHVLKSFCFKL 859

 Score =  232 bits (592), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 119/201 (59%), Positives = 143/201 (71%), Gaps = 32/201 (15%)

Query: 1286 FHDTSIQFSDTYFVLDATSWLRHFAHVYKLATNGILKFAICLTTFQELRFLRKSKDENVM 1345
            F +  +   DT+FVLDATSWLRHFAHVYKLA+N +L+FAICLTTFQELRFLRKSKDENV+
Sbjct: 973  FPECKMNGKDTFFVLDATSWLRHFAHVYKLASNQVLQFAICLTTFQELRFLRKSKDENVV 1032

Query: 1346 EAATRAIITLRQLYSEKRLLPLRFTGNIATHIEEHLEFEEQITWRSHVDEFVIEAIKRAQ 1405
            EAATRA+IT+RQLY+E R+LPLRFTGN+ATHIEEHLEFEEQITWRSHVDEFV EAIK+AQ
Sbjct: 1033 EAATRAVITVRQLYTENRILPLRFTGNVATHIEEHLEFEEQITWRSHVDEFVFEAIKKAQ 1092

Query: 1406 LK-RRDNRNQEDXXXXXXXXXXXXXXXXXXXXXXVTDMIFVLVTDDISMIKKRQEEKSDN 1464
             +  ++NR+                               VLVTDD +M +K Q+     
Sbjct: 1093 ARLSQENRDFHH---------------------------VVLVTDDANMRRKAQQHA--- 1122

Query: 1465 DIITFSTKFVFSLCNMLVNKF 1485
             I T ST+FVF+ CN + N+ 
Sbjct: 1123 -IHTLSTRFVFATCNAVGNRL 1142

 Score = 67.4 bits (163), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 30/55 (54%), Positives = 39/55 (70%)

Query: 1150 FEKNSIQNTDLNCEPGLSLIENESLFEYEGYKRFIPDFSNFDKNGELISTSLYTS 1204
            FE+ S  N D+   P LS++ENES+F Y GYKR + D S +D+ GE +STSLYTS
Sbjct: 877  FEEGSDANKDMQMTPQLSVLENESIFGYVGYKRLLSDLSCYDRGGEFVSTSLYTS 931

>ZYRO0B16412g Chr2 (1329195..1333313) [4119 bp, 1372 aa] {ON}
           similar to uniprot|P36168 Saccharomyces cerevisiae
           YKR096W Hypothetical ORF
          Length = 1372

 Score =  464 bits (1193), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 236/407 (57%), Positives = 286/407 (70%), Gaps = 76/407 (18%)

Query: 269 LIQKLQNIYKLIVSQELELQDKCNKLSTSQSTKLKYLWSIYKLNHDLINNYILFILTSLS 328
           L+QKLQ+IYK+IV QE+ELQ++C++L+TSQ+T+LK LW+IYK+N DLINNY+ F+ T+L 
Sbjct: 417 LVQKLQDIYKVIVKQEIELQERCSQLTTSQTTELKNLWTIYKINSDLINNYVTFLTTALL 476

Query: 329 PSQSINDQLIGKEILEIYKIERRLWIYGTITFLDILKNFANFMDPEILSQFITHVFESIS 388
           PSQ+  D LIG+EI+EIY+IERRLW+YGTITFLDI KNF+NFMDPE+  QFITHVF SIS
Sbjct: 477 PSQTEQDILIGEEIVEIYRIERRLWVYGTITFLDIFKNFSNFMDPEVCCQFITHVFISIS 536

Query: 389 NMISDLPIDFINPWYQRLGDLSRMAIALYPSNFIDWKLSSEYWYIESMKFTFSHGKLYYH 448
           NM+ D+P  +  PW QRLGDLSRMAIALYPS FIDWKLS+E+WY+E+MKFT+SHGKLYYH
Sbjct: 537 NMLGDIPPKYGIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKFTYSHGKLYYH 596

Query: 449 ISTVQQNPLEAFVNLGKSVFCFDTFIPSQRYMQLVIDNIYQRAFIERXXXXXXXXXXXXX 508
           +STVQQN LEAFVNLGKSVFC DTFIPSQ+YMQLVIDNIYQRAF+ER             
Sbjct: 597 MSTVQQNTLEAFVNLGKSVFCQDTFIPSQQYMQLVIDNIYQRAFVERNN----------- 645

Query: 509 XXXXHFMTSSFAKNFQQRFLIEYLKHSEVMLLPNFLENDHLKTVVLNYFTNSFGKIAIQX 568
                        N +   LIEYLKHSEVMLLP+FLE+  L+ VVL YF   FG      
Sbjct: 646 ------------GNHRNTQLIEYLKHSEVMLLPSFLESADLQQVVLIYFKAKFGC----- 688

Query: 569 XXXXXXXXXXXXXXXXXXXXXXQANIENINNGHNIPSSSNVITSESLQINAINLFNFRNI 628
                                                S+NV           N+F+ R +
Sbjct: 689 ------------------------------------DSNNV-----------NIFDTRKM 701

Query: 629 FKQKNSDILKYFFKNSATFAESHILQLIGFGDPKNPFALLFQLPKYL 675
           F Q N D L+YFF+++  FAESHILQL+GFGDPKNPFALLF+LP++L
Sbjct: 702 FCQ-NPDYLRYFFRHAPAFAESHILQLVGFGDPKNPFALLFELPRFL 747

 Score =  288 bits (736), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 135/269 (50%), Positives = 194/269 (72%), Gaps = 5/269 (1%)

Query: 779  EDEMLDNLS-PQDFFNNLESLKLSFFLPNSLEIWNESLKYINIISLNCSIIVLKKFLNGP 837
            EDE  D +S P+ FF N+E+L+  + +P++LEIWNESL YIN+ SL CS++VL+KFL GP
Sbjct: 777  EDEQSDRMSTPEGFFGNIETLRFPYSVPSNLEIWNESLNYINMTSLKCSMVVLQKFLKGP 836

Query: 838  LFVSLPHMLPWSYFIISLALRIESLENIESRIFWLQFIRKIFPWNSIVSYLNVIISVLLD 897
            L V+LPH +PW+YFIISLA +I+ L +  SR FW++F+ +IFPWN+IVS+LNV+I+ +LD
Sbjct: 837  LVVALPHFMPWTYFIISLAYKIKDLNHESSRKFWVEFVDRIFPWNTIVSFLNVLIAYMLD 896

Query: 898  NCYENSMITKLINNYSNKNLDELLVEFNENEYELPEVWKCYGSLWFDVIAENYQIYSRDC 957
            N +++S++  L   YS+  L++LL  FN NE  LPEVWKC+G+LWFD I    Q +  D 
Sbjct: 897  NSWKSSLVDSLCGQYSSMGLEDLLDYFNNNEV-LPEVWKCWGTLWFDTICNKEQSHVEDL 955

Query: 958  SKNISMKDTKCLNYPIDGLPFDEMEENGTNFWKRSCRLIFLFKTMITRFNGFGGLTISSN 1017
             +++ +K+   L+ PIDG+ FD  +E+G NFWKR+CR+IFLFK +   F    G+T+S  
Sbjct: 956  -ESVGIKNHMFLDAPIDGIAFDANDESGENFWKRACRIIFLFKGLAENFP--IGITLSPV 1012

Query: 1018 TSVYCNRSDIPNNHILRTFAFKLLPDDDN 1046
              VYC R+D+   HIL++F+FKL    D+
Sbjct: 1013 APVYCRRNDVSPYHILKSFSFKLRRGSDS 1041

 Score =  280 bits (716), Expect = 5e-76,   Method: Compositional matrix adjust.
 Identities = 158/332 (47%), Positives = 202/332 (60%), Gaps = 40/332 (12%)

Query: 1150 FEKNSIQNTDLNCEPGLSLIENESLFEYEGYKRFIPDFSNFDKNGELISTSLYTSTIIDX 1209
            FE+ S +N  ++  P LS+IE ES+F+Y GY+R  PD+ ++DKNGE +S SLYTS   + 
Sbjct: 1068 FEEASWENIHMDTIPMLSVIEGESIFDYAGYRRLHPDYFSYDKNGEFLSASLYTSWYANN 1127

Query: 1210 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXGSNQNKESSNSTTNIDNKELFLMEKEIFNKI 1269
                                         GS+ + +     +        + E  IFN+I
Sbjct: 1128 NTNNTGVIPAH------------------GSDVDSQRDAVQS--------VQEMHIFNQI 1161

Query: 1270 LDPDYKN--IDEIWRGEMFHDTSIQFSDTYFVLDATSWLRHFAHVYKLATNGILKFAICL 1327
            ++P Y     D+++  +  + T+   S TYFVLD T+WLRHF H+YKLA++G+LKFAICL
Sbjct: 1162 MEPGYCGGFADDLFLRDALYQTA-HSSTTYFVLDTTTWLRHFGHIYKLASSGVLKFAICL 1220

Query: 1328 TTFQELRFLRKSKDENVMEAATRAIITLRQLYSEKRLLPLRFTGNIATHIEEHLEFEEQI 1387
            TTF ELRFLRK KDENV+EAATRAIIT+RQLYSE +LLPLRFTGN+ATHIEEHLEFEE+I
Sbjct: 1221 TTFHELRFLRKPKDENVVEAATRAIITVRQLYSEGKLLPLRFTGNVATHIEEHLEFEEKI 1280

Query: 1388 TWRSHVDEFVIEAIKRAQLKRRDNRNQEDXXXXXXXXXXXXXXXXXXXXXXVTDMIFVLV 1447
            TWRSHVDEFVIEA+ +AQ K ++    +                             VLV
Sbjct: 1281 TWRSHVDEFVIEAVYKAQSKFQEMNQLQLEQEEQQHQLRAHDDRSGLK-------FVVLV 1333

Query: 1448 TDDISMIKKRQEEKSDNDIITFSTKFVFSLCN 1479
            TDD +M KK Q    D D+ TFSTKFVFSLCN
Sbjct: 1334 TDDSNMRKKAQ----DQDVRTFSTKFVFSLCN 1361

>KNAG0C06630 Chr3 (1284481..1288326) [3846 bp, 1281 aa] {ON}
           Anc_5.706 YIL151C
          Length = 1281

 Score =  455 bits (1171), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 231/409 (56%), Positives = 284/409 (69%), Gaps = 75/409 (18%)

Query: 269 LIQKLQNIYKLIVSQELELQDKCNKLSTSQSTKLKYLWSIYKLNHDLINNYILFILTSLS 328
           L+QKLQ+IYK+IV QE+ELQ++C++L+TSQ+T+LK LW+IYK+N DLINNY  FI T+L 
Sbjct: 291 LVQKLQDIYKVIVKQEIELQERCSQLTTSQTTELKNLWTIYKINTDLINNYTTFITTALL 350

Query: 329 PSQSINDQLIGKEILEIYKIERRLWIYGTITFLDILKNFANFMDPEILSQFITHVFESIS 388
           PSQ   D LIG+EI+EIY+IERRLW+YGTITFLD+LKNF+NFMDPE+ SQFITHVF S+S
Sbjct: 351 PSQPAQDILIGEEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCSQFITHVFISLS 410

Query: 389 NMISDLPIDFINPWYQRLGDLSRMAIALYPSNFIDWKLSSEYWYIESMKFTFSHGKLYYH 448
            ++ D+P     PW QRLGDLSRMAIALYPS FIDWKLS+E+WY+E+MKFT+SHGKLYYH
Sbjct: 411 AILIDIPPKHAIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKFTYSHGKLYYH 470

Query: 449 ISTVQQNPLEAFVNLGKSVFCFDTFIPSQRYMQLVIDNIYQRAFIERXXXXXXXXXXXXX 508
           +STVQQN LEAFVNLGKSVFC DTF PSQ+YMQLVIDNIYQR F++R             
Sbjct: 471 MSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRTFVDRNT----------- 519

Query: 509 XXXXHFMTSSFAKNFQQRFLIEYLKHSEVMLLPNFLENDHLKTVVLNYFTNSFGKIAIQX 568
                        N++   LI+YLKHSEVMLLP+FL +  L+ VVLNYF + FG      
Sbjct: 520 -----------GGNYRNPDLIDYLKHSEVMLLPSFLGSKDLQQVVLNYFQDRFG------ 562

Query: 569 XXXXXXXXXXXXXXXXXXXXXXQANIENINNGHNIPSSSNVITSESLQINAINLFNFRNI 628
                                             I  S N I            F+ +++
Sbjct: 563 ----------------------------------IDYSENNI------------FDTQDM 576

Query: 629 FKQKNSDILKYFFKNSATFAESHILQLIGFGDPKNPFALLFQLPKYLKE 677
           F Q  S  L++FF+++  FAESHILQL+GFG+PKNPFALLF+LPKYLKE
Sbjct: 577 FFQPPS-CLRFFFRHAPAFAESHILQLVGFGNPKNPFALLFELPKYLKE 624

 Score =  258 bits (660), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 160/360 (44%), Positives = 208/360 (57%), Gaps = 26/360 (7%)

Query: 1137 DSNTERNIDTWIPF-EKNSIQNTDLNCEPGLSLIENESLFEYEGYKRFIPDFSNFDKNGE 1195
            D  T    + +IP  E+ S  N D    P LS+++ E++FEY GY+    D ++FDKNGE
Sbjct: 924  DEPTSSKFNEFIPLCEEVSAINNDALATPSLSVVQGENIFEYMGYRTLGLDKNSFDKNGE 983

Query: 1196 LISTSLYTSTIIDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGSNQNKESSNSTTN--I 1253
            ++S+S+YTS +ID                               S     +  +TT+   
Sbjct: 984  IVSSSIYTSWMIDTGEAAAAASSATDNNAVSEGQGDLAANGTPISASLSAAGKTTTSHVT 1043

Query: 1254 DNKELFLMEKEIFNKIL---DPDYKNI-DEIWRGEMF-----HDTSIQFSD---TYFVLD 1301
            D+++  L E ++F K +   DP  +N+   +  G+ +      ++S+   D   T+F+ D
Sbjct: 1044 DDQDPGLNENDLFKKFMSLGDPRDRNVYHNMITGKSYLVKNLWESSVDELDRLKTFFIFD 1103

Query: 1302 ATSWLRHFAHVYKLATNGILKFAICLTTFQELRFLRKSKDENVMEAATRAIITLRQLYSE 1361
            ATSWLRHFAH+YK+ATNG+LKF +CLTTFQELRFLRKSKDENV+EAA RAIIT+RQLY E
Sbjct: 1104 ATSWLRHFAHIYKIATNGVLKFGVCLTTFQELRFLRKSKDENVVEAAARAIITMRQLYRE 1163

Query: 1362 KRLLPLRFTGNIATHIEEHLEFEEQITWRSHVDEFVIEAIKRAQLKRRDNRNQEDXXXXX 1421
             RLLPLRFTGN+A  IEEHLEFEEQITWRSHVDEFVIEA+ +AQ K       E      
Sbjct: 1164 NRLLPLRFTGNVANDIEEHLEFEEQITWRSHVDEFVIEAVMKAQDKF--TTAGETKQPEE 1221

Query: 1422 XXXXXXXXXXXXXXXXXVTDMIFVLVTDDISMIKKRQEEKSDNDIITFSTKFVFSLCNML 1481
                             VT     LVT+D +M +K Q    D  I TFST FVFSLC+ L
Sbjct: 1222 EGTGPPRVPLGGKRFHYVT-----LVTNDQNMKRKAQ----DQGIKTFSTDFVFSLCSKL 1272

 Score =  237 bits (604), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 117/275 (42%), Positives = 178/275 (64%), Gaps = 6/275 (2%)

Query: 766  DVDTELQNNGMEDEDEMLDNLSPQDFFNNLESLKLSFFLPNSLEIWNESLKYINIISLNC 825
            D  T+  N G  D+ E+   LS  ++ +N+E+LK +   P+ +  W +SL +IN+ SL C
Sbjct: 652  DQATDNVNEGTNDDHELTATLSGPEYLDNIETLKYAIETPD-ICTWIKSLDFINMTSLKC 710

Query: 826  SIIVLKKFLNGPLFVSLPHMLPWSYFIISLALRIESLENIESRIFWLQFIRKIFPWNSIV 885
            S+IVLKKFL+GPL ++LPH LPW+ FII+  +++  LEN ++  FW   +++IFPW++I 
Sbjct: 711  SMIVLKKFLHGPLLIALPHFLPWTVFIIACGIKVNELENEKNYKFWRILMKRIFPWDTIT 770

Query: 886  SYLNVIISVLLDNCYENSMITKLINNYSNKNLDELLVEFNENEYELPEVWKCYGSLWFDV 945
            S+LNV+++ +LDN    ++I +L   YS+ +LD++L  FN++E +LPEVWKC+G+LW+D 
Sbjct: 771  SFLNVLLAYVLDNYGNTTIIEELCMQYSDMDLDDMLAHFNKSE-DLPEVWKCWGTLWYDA 829

Query: 946  IAENYQIYSRDCSKNISMKDTKCLNYPIDGLPFDEMEENGTNFWKRSCRLIFLFKTMITR 1005
            I  N      D      + D   L++PIDG+ FD  +E G  FWKR+ R+IFLFK +  +
Sbjct: 830  IC-NKNSVDADTFAGFGIGDHMFLDFPIDGIEFDAEDETGAKFWKRALRVIFLFKGISKK 888

Query: 1006 FNGFGGLTISSNTSVYCNRSDIPNNHILRTFAFKL 1040
            F+   GL IS    VYC R++   +  LR F FKL
Sbjct: 889  FD--FGLKISHEAGVYC-RNEKAADSPLRRFTFKL 920

>YKR096W Chr11 (626793..630380) [3588 bp, 1195 aa] {ON} Protein of
           unknown function that may interact with ribosomes, based
           on co-purification experiments; green fluorescent
           protein (GFP)-fusion protein localizes to the nucleus
           and cytoplasm; predicted to contain a PINc domain
          Length = 1195

 Score =  449 bits (1154), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 222/407 (54%), Positives = 278/407 (68%), Gaps = 76/407 (18%)

Query: 269 LIQKLQNIYKLIVSQELELQDKCNKLSTSQSTKLKYLWSIYKLNHDLINNYILFILTSLS 328
           LIQKLQ +YK+IV QE+ELQ++C++L+ SQ+T+LK LW+IYK+N DL+NNY+ FI T+L 
Sbjct: 275 LIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYKINTDLVNNYVTFITTALL 334

Query: 329 PSQSINDQLIGKEILEIYKIERRLWIYGTITFLDILKNFANFMDPEILSQFITHVFESIS 388
           PSQ  +D +IG+EI+EIY+IERRLW+YGTITFLD+LKNF+NFMDPE+  QFITHVF S+S
Sbjct: 335 PSQPPHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITHVFVSLS 394

Query: 389 NMISDLPIDFINPWYQRLGDLSRMAIALYPSNFIDWKLSSEYWYIESMKFTFSHGKLYYH 448
            MISD+P  +   W QRLGDLSRMAIALYPS+FIDWKLS+E+WY E+MK+ ++HGKLYYH
Sbjct: 395 TMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKYIYNHGKLYYH 454

Query: 449 ISTVQQNPLEAFVNLGKSVFCFDTFIPSQRYMQLVIDNIYQRAFIERXXXXXXXXXXXXX 508
           +STVQQN LEAFVNLGKSVFC +TF PS +YMQLVIDNIYQRAF+ER             
Sbjct: 455 MSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNN----------- 503

Query: 509 XXXXHFMTSSFAKNFQQRFLIEYLKHSEVMLLPNFLENDHLKTVVLNYFTNSFGKIAIQX 568
                        N +   LIEYLKHSE MLLP+FLE+  L+ VVL+YF   FG      
Sbjct: 504 ------------GNLRNSLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFIEKFG------ 545

Query: 569 XXXXXXXXXXXXXXXXXXXXXXQANIENINNGHNIPSSSNVITSESLQINAINLFNFRNI 628
                                                         +  N  N+FN  ++
Sbjct: 546 ----------------------------------------------IDANGCNIFNAEDM 559

Query: 629 FKQKNSDILKYFFKNSATFAESHILQLIGFGDPKNPFALLFQLPKYL 675
           F Q N D  KYFF++  +FA+SHILQ++GFG+PKNPFA+LF+LPKYL
Sbjct: 560 FVQ-NPDFFKYFFRHGPSFAQSHILQIVGFGEPKNPFAILFELPKYL 605

 Score =  233 bits (595), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 146/334 (43%), Positives = 186/334 (55%), Gaps = 79/334 (23%)

Query: 1151 EKNSIQNTDLNCEPGLSLIENESLFEYEGYKRFIPDFSNFDKNGELISTSLYTSTIIDXX 1210
            E  S  NTDL+  P LS+ E +++F Y GYK+   D++ FDKNGE +S SLYT+  +   
Sbjct: 929  EARSENNTDLHAVPELSVNEGDNIFHYVGYKKLRADYTCFDKNGEFLSASLYTTWYV--- 985

Query: 1211 XXXXXXXXXXXXXXXXXXXXXXXXXXXXGSNQNKESSNSTTNIDNKELFLMEKE---IFN 1267
                                                +++ TNI++   +  EKE   +F 
Sbjct: 986  -----------------------------------PNSNNTNIEDNINYNSEKENEGLFL 1010

Query: 1268 KILDPDYKNIDEIWRGEMFHDTSIQFSDTYFVLDATSWLRHFAHVYKLATNGILKFAICL 1327
            + +  DY  ID              F  TYFV DATSWLRH A ++KLA N +L+FAICL
Sbjct: 1011 ECIKSDYPEID--------------FKTTYFVFDATSWLRHSARIFKLAQNRLLRFAICL 1056

Query: 1328 TTFQELRFLRKSKDENVMEAATRAIITLRQLYSEKRLLPLRFTGNIATHIEEHLEFEEQI 1387
            TTFQELRFLRKSKDENVMEAATR IIT+RQLY E ++LPLRFTGN+ATHIEE+LEFEEQI
Sbjct: 1057 TTFQELRFLRKSKDENVMEAATRGIITIRQLYYENKVLPLRFTGNVATHIEENLEFEEQI 1116

Query: 1388 TWRSHVDEFVIEAIKRAQLKRRDNRNQEDXXXXXXXXXXXXXXXXXXXXXXVTDMIFVLV 1447
            TWR+HVDEFVIE++ +AQ K                                     VL+
Sbjct: 1117 TWRTHVDEFVIESVMKAQEKLESASEPRLSPRRFNY--------------------VVLI 1156

Query: 1448 TDDISMIKKRQEEKSDNDIITFSTKFVFSLCNML 1481
            +DD +M KK +E++      T ST+FVFSLC  L
Sbjct: 1157 SDDDAMKKKAEEKEI----KTLSTRFVFSLCTKL 1186

 Score =  221 bits (562), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 122/280 (43%), Positives = 180/280 (64%), Gaps = 17/280 (6%)

Query: 774  NGMEDEDEMLDNLSP-------QDFFNNLESLKLSFFLPNSL--EIWNESLKYINIISLN 824
            N  ED+DE++ + +         +FFN++++L+    LP+ L  E W E+LK++N+ SL 
Sbjct: 634  NDNEDDDEIMSSTTSISDHDLLAEFFNDIDTLRRPI-LPSMLTNEAWLETLKFLNMTSLK 692

Query: 825  CSIIVLKKFLNGPLFVSLPHMLPWSYFIISLALRIESLENIESRIFWLQFIRKIFPWNSI 884
            C IIVL+KFL+GPL ++LPH+LPW YFIIS+ L+   L +  S+ FW+  +++ FPW+++
Sbjct: 693  CGIIVLRKFLHGPLGIALPHILPWIYFIISICLKSSQLSDPVSKEFWMIIVKRAFPWDTM 752

Query: 885  VSYLNVIISVLLDNCYENSMITKLINNYSNKNLDELLVEFNENEYELPEVWKCYGSLWFD 944
            V+++NV+I  LLDN   NS+I  L ++Y   +L ELL  FNE E ELPE+  C+G+LWFD
Sbjct: 753  VTFMNVLIVYLLDNQTSNSIIGDLCDDYDKLSLSELLELFNEGE-ELPEILGCWGTLWFD 811

Query: 945  VIAEN--YQIYSRDCSKNISMKDTKCLNYPIDGLPFDEMEENGTNFWKRSCRLIFLFKTM 1002
             I E   + I S D  + I +KD   L+ P DG+ FDE +ENG  FWKR+CR IFLF+ +
Sbjct: 812  TICEKNTHSISSEDNFQEIGIKDYMALDSPTDGIIFDEKDENGEKFWKRACRTIFLFREL 871

Query: 1003 ITRFNGFGGLTISSNTSVYCNRSDIPNNHILRTFAFKLLP 1042
               F    G+ I ++  +Y  RS   N +IL +  FKL P
Sbjct: 872  SRSFP--IGVIIRNDPLIY--RSSFQNTNILGSLVFKLEP 907

>Skud_11.336 Chr11 (608311..608769,608800..608948,608994..611952)
           [3567 bp, 1188 aa] {ON} YKR096W (REAL)
          Length = 1188

 Score =  448 bits (1153), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 221/407 (54%), Positives = 280/407 (68%), Gaps = 76/407 (18%)

Query: 269 LIQKLQNIYKLIVSQELELQDKCNKLSTSQSTKLKYLWSIYKLNHDLINNYILFILTSLS 328
           LIQKLQ +YK+IV QE+ELQ++C++L+ SQ+T+LK LW+IY++N +LINNY+ FI T+L 
Sbjct: 269 LIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYRINTELINNYVTFITTALL 328

Query: 329 PSQSINDQLIGKEILEIYKIERRLWIYGTITFLDILKNFANFMDPEILSQFITHVFESIS 388
           PSQ ++D LIG+EI+EIY+IERRLW+YGTITFLD+LKNF+NFMDPE+  QFITHVF S+S
Sbjct: 329 PSQPLHDLLIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITHVFVSLS 388

Query: 389 NMISDLPIDFINPWYQRLGDLSRMAIALYPSNFIDWKLSSEYWYIESMKFTFSHGKLYYH 448
            MISD+P  +   W QRLGDLSRMAIALYPS+FIDWKLS+E+WY E+MK+ ++HGKLYYH
Sbjct: 389 TMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKYIYNHGKLYYH 448

Query: 449 ISTVQQNPLEAFVNLGKSVFCFDTFIPSQRYMQLVIDNIYQRAFIERXXXXXXXXXXXXX 508
           +STVQQN LEAFVNLGKSVFC +TF PS +YMQLVIDNIYQRAF+ER             
Sbjct: 449 MSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNN----------- 497

Query: 509 XXXXHFMTSSFAKNFQQRFLIEYLKHSEVMLLPNFLENDHLKTVVLNYFTNSFGKIAIQX 568
                        N +   LIEYLKHSE MLLP+FLE+  L+ VV++YF   FG      
Sbjct: 498 ------------GNLRNSLLIEYLKHSEAMLLPSFLESPDLQNVVVSYFVEKFG------ 539

Query: 569 XXXXXXXXXXXXXXXXXXXXXXQANIENINNGHNIPSSSNVITSESLQINAINLFNFRNI 628
                                                         +  N  N+FN  ++
Sbjct: 540 ----------------------------------------------IDANGCNIFNPEDM 553

Query: 629 FKQKNSDILKYFFKNSATFAESHILQLIGFGDPKNPFALLFQLPKYL 675
           F Q N D  KYFF+++ +FA+SHILQ++GFG+PKNPFA+LF+LPKYL
Sbjct: 554 FIQ-NPDFFKYFFRHAPSFAQSHILQIVGFGEPKNPFAILFELPKYL 599

 Score =  242 bits (618), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 150/334 (44%), Positives = 188/334 (56%), Gaps = 74/334 (22%)

Query: 1151 EKNSIQNTDLNCEPGLSLIENESLFEYEGYKRFIPDFSNFDKNGELISTSLYTSTIIDXX 1210
            E  S  N DL   P LS+   +++F Y GYK+  PD++ FD+NGE +S SLYT   +   
Sbjct: 923  EARSKNNIDLYAVPELSVNSGDNIFHYTGYKKLRPDYTCFDRNGEFLSASLYTRWYLPN- 981

Query: 1211 XXXXXXXXXXXXXXXXXXXXXXXXXXXXGSNQNKESSNSTTNIDNKELFLMEKEIFNKIL 1270
                                        G+N ++   NS     +++LFL       + +
Sbjct: 982  ----------------------------GNNISEALVNSDIEKGDEDLFL-------ECM 1006

Query: 1271 DPDYKNIDEIWRGEMFHDTSIQFSDTYFVLDATSWLRHFAHVYKLATNGILKFAICLTTF 1330
             PD   ID              F  TYFV DATSWLRH A ++KLA N +LKFAICLTTF
Sbjct: 1007 KPDCPGID--------------FETTYFVFDATSWLRHSARIFKLAQNRLLKFAICLTTF 1052

Query: 1331 QELRFLRKSKDENVMEAATRAIITLRQLYSEKRLLPLRFTGNIATHIEEHLEFEEQITWR 1390
            QELRFLRKSKDENVMEAATR IIT+RQLY E ++LPLRFTGN+ATHIEE+LEFEEQITWR
Sbjct: 1053 QELRFLRKSKDENVMEAATRGIITIRQLYYEDKVLPLRFTGNVATHIEENLEFEEQITWR 1112

Query: 1391 SHVDEFVIEAIKRAQLKRRDNRNQEDXXXXXXXXXXXXXXXXXXXXXXVTDMIFVLVTDD 1450
            +HVDEFVIE+IK+AQ ++ +N  Q                              VL++DD
Sbjct: 1113 THVDEFVIESIKKAQ-EKLENAGQPHVTPRHSNY-------------------VVLISDD 1152

Query: 1451 ISMIKKRQEEKSDNDIITFSTKFVFSLCNMLVNK 1484
             +M KK +E++      T STKFVFSLC  L  K
Sbjct: 1153 DTMKKKAEEKEI----KTLSTKFVFSLCTKLGEK 1182

 Score =  223 bits (567), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 111/257 (43%), Positives = 173/257 (67%), Gaps = 10/257 (3%)

Query: 790  DFFNNLESLKLSFFLPNSL--EIWNESLKYINIISLNCSIIVLKKFLNGPLFVSLPHMLP 847
            +FFN++++L+    LP+ L  E W E+LK++N+ SL C +IVL+KFL+GPL ++LPH+LP
Sbjct: 651  EFFNDIDTLRRPI-LPSMLTSEAWLETLKFLNMTSLKCGMIVLRKFLHGPLGIALPHILP 709

Query: 848  WSYFIISLALRIESLENIESRIFWLQFIRKIFPWNSIVSYLNVIISVLLDNCYENSMITK 907
            W YFII+  L+   L +  S+ FW+  ++++FPW++IV+++NV+I+ LLDN   N +I +
Sbjct: 710  WIYFIIATCLKSNQLSDPTSKDFWMIIVKRVFPWDTIVTFMNVLIAYLLDNEALNPIIGE 769

Query: 908  LINNYSNKNLDELLVEFNENEYELPEVWKCYGSLWFDVIAEN--YQIYSRDCSKNISMKD 965
            L + Y   NL  LL  FNE+E ELPE+W C+G+LWFD I +   + I S D  + I +KD
Sbjct: 770  LCSKYGTLNLAGLLESFNESE-ELPEIWNCWGTLWFDTICQKNAHSISSDDNFQEIGIKD 828

Query: 966  TKCLNYPIDGLPFDEMEENGTNFWKRSCRLIFLFKTMITRFNGFGGLTISSNTSVYCNRS 1025
               L+ P DG+ FD+ +E+G  FWKR+CR+IFLF+ +   F    G+ +S++  + C+ S
Sbjct: 829  YMALDAPTDGIIFDDKDESGEKFWKRACRIIFLFRELSRTFP--IGVIVSNDPLIKCSSS 886

Query: 1026 DIPNNHILRTFAFKLLP 1042
               ++ ILR   +KL P
Sbjct: 887  Q--SSIILRNLVYKLEP 901

>Smik_11.360 Chr11 (616879..620421) [3543 bp, 1180 aa] {ON} YIL151C
           (REAL)
          Length = 1180

 Score =  447 bits (1151), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 221/407 (54%), Positives = 279/407 (68%), Gaps = 76/407 (18%)

Query: 269 LIQKLQNIYKLIVSQELELQDKCNKLSTSQSTKLKYLWSIYKLNHDLINNYILFILTSLS 328
           LIQKLQ +Y++IV QE+ELQ++C++L+ SQ+T+LK LW+IYK+N +L+NNY+ FI T+L 
Sbjct: 256 LIQKLQELYRVIVKQEIELQERCSQLTNSQTTELKSLWTIYKINTELVNNYVTFITTALL 315

Query: 329 PSQSINDQLIGKEILEIYKIERRLWIYGTITFLDILKNFANFMDPEILSQFITHVFESIS 388
           PSQ  +D +IG+EI+EIY+IERRLW+YGTITFLD+LKNF+NFMDPE+  QFITHVF S+S
Sbjct: 316 PSQPPHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITHVFISLS 375

Query: 389 NMISDLPIDFINPWYQRLGDLSRMAIALYPSNFIDWKLSSEYWYIESMKFTFSHGKLYYH 448
            MISD+P  +   W QRLGDLSRMAIALYPS+FIDWKLS+E+WY E+MK+T++HGKLYYH
Sbjct: 376 TMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKYTYNHGKLYYH 435

Query: 449 ISTVQQNPLEAFVNLGKSVFCFDTFIPSQRYMQLVIDNIYQRAFIERXXXXXXXXXXXXX 508
           +STVQQN LEAFVNLGKSVFC +TF PS +YMQLVIDNIYQRAF+ER             
Sbjct: 436 MSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNN----------- 484

Query: 509 XXXXHFMTSSFAKNFQQRFLIEYLKHSEVMLLPNFLENDHLKTVVLNYFTNSFGKIAIQX 568
                        N +   LIEYLKHSE MLLP+FLE+  L+ VVL+YF   FG      
Sbjct: 485 ------------GNLRNSLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFIEKFG------ 526

Query: 569 XXXXXXXXXXXXXXXXXXXXXXQANIENINNGHNIPSSSNVITSESLQINAINLFNFRNI 628
                                                         +  N  N+FN  ++
Sbjct: 527 ----------------------------------------------IDANGCNIFNCEDM 540

Query: 629 FKQKNSDILKYFFKNSATFAESHILQLIGFGDPKNPFALLFQLPKYL 675
           F Q N D  KYFF++  +FA+SHILQ++GFG+PKNPFA+LF+LPKYL
Sbjct: 541 FIQ-NPDFFKYFFRHGPSFAQSHILQIVGFGEPKNPFAILFELPKYL 586

 Score =  253 bits (645), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 152/333 (45%), Positives = 190/333 (57%), Gaps = 73/333 (21%)

Query: 1151 EKNSIQNTDLNCEPGLSLIENESLFEYEGYKRFIPDFSNFDKNGELISTSLYTSTIIDXX 1210
            E  S  NTDL+  P LS+I  +++F Y GYK+  PD++ FDKNGE +S SLYTS  +   
Sbjct: 910  EARSEINTDLHAVPELSVINGDNIFHYVGYKKLRPDYTCFDKNGEFLSASLYTSWYVP-- 967

Query: 1211 XXXXXXXXXXXXXXXXXXXXXXXXXXXXGSNQNKESSNSTTNIDNKELFLME--KEIFNK 1268
                                          N N E++ S  N    E   +E  K +  +
Sbjct: 968  ----------------------------NCNNNLETNISYANERENEALFLECMKSVHPE 999

Query: 1269 ILDPDYKNIDEIWRGEMFHDTSIQFSDTYFVLDATSWLRHFAHVYKLATNGILKFAICLT 1328
            I  P+                 I F  TYFV DATSWLRH A ++KLA N +L+FAICLT
Sbjct: 1000 IAYPE-----------------IDFKTTYFVFDATSWLRHSARIFKLAQNRLLRFAICLT 1042

Query: 1329 TFQELRFLRKSKDENVMEAATRAIITLRQLYSEKRLLPLRFTGNIATHIEEHLEFEEQIT 1388
            TFQELRFLRKSKDENVMEAATR IIT+RQLY E ++LPLRFTGN+ATHIEE+LEFEEQIT
Sbjct: 1043 TFQELRFLRKSKDENVMEAATRGIITIRQLYCEDKVLPLRFTGNVATHIEENLEFEEQIT 1102

Query: 1389 WRSHVDEFVIEAIKRAQLKRRDNRNQEDXXXXXXXXXXXXXXXXXXXXXXVTDMIFVLVT 1448
            WR+HVDEFVIE+I +AQ ++ +N  Q +                            VL++
Sbjct: 1103 WRTHVDEFVIESIMKAQ-EKLENAKQPNISSHRFNY-------------------VVLIS 1142

Query: 1449 DDISMIKKRQEEKSDNDIITFSTKFVFSLCNML 1481
            DD +M KK +E+K    I T ST+FVFSLC  L
Sbjct: 1143 DDDTMKKKAEEKK----IRTLSTRFVFSLCTKL 1171

 Score =  238 bits (606), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 124/280 (44%), Positives = 185/280 (66%), Gaps = 17/280 (6%)

Query: 774  NGMEDEDEMLDNLSPQ-------DFFNNLESLKLSFFLPNSL--EIWNESLKYINIISLN 824
            NG ED+DE + + +         +FFN++++L+    LP+ L  E W E+LK++N+ SL 
Sbjct: 615  NGNEDDDETMSSTTSMSDPDLLVEFFNDIDTLRRPI-LPSMLTNEAWLETLKFLNMTSLK 673

Query: 825  CSIIVLKKFLNGPLFVSLPHMLPWSYFIISLALRIESLENIESRIFWLQFIRKIFPWNSI 884
            C +IVL+KFL+GPL V+LPH+LPW YFIIS+ L+   L +  S+ FW+  I+++FPW+++
Sbjct: 674  CGMIVLRKFLHGPLGVALPHVLPWIYFIISICLKSNQLNDPISKEFWIVIIKRMFPWDTM 733

Query: 885  VSYLNVIISVLLDNCYENSMITKLINNYSNKNLDELLVEFNENEYELPEVWKCYGSLWFD 944
            V+++NV+I+ LLDN   NS+I  L N YS  NL ELL  FNENE +LPE+W C+G+LWFD
Sbjct: 734  VTFMNVLIAYLLDNETSNSIIGDLCNEYSKLNLSELLNSFNENE-DLPEIWGCWGTLWFD 792

Query: 945  VIAEN--YQIYSRDCSKNISMKDTKCLNYPIDGLPFDEMEENGTNFWKRSCRLIFLFKTM 1002
             I +   + I S D  + I ++D   L+ P DG+ FD+ +ENG  FWKR+CR+IFLF+ +
Sbjct: 793  AICQKNTHSISSEDNFQEIGIRDYMALDSPTDGIIFDDKDENGEKFWKRACRIIFLFREV 852

Query: 1003 ITRFNGFGGLTISSNTSVYCNRSDIPNNHILRTFAFKLLP 1042
               F    G+ +  +  V C  S + +N+ILR   +KL P
Sbjct: 853  SRSFP--LGVIVRHDPLVNC--SSLQSNNILRDLVYKLEP 888

>Suva_11.333 Chr11 (611602..612061,612092..615195) [3564 bp, 1187
           aa] {ON} YKR096W (REAL)
          Length = 1187

 Score =  444 bits (1143), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 219/407 (53%), Positives = 279/407 (68%), Gaps = 76/407 (18%)

Query: 269 LIQKLQNIYKLIVSQELELQDKCNKLSTSQSTKLKYLWSIYKLNHDLINNYILFILTSLS 328
           LIQKLQ +YK+IV QE+ELQ++C++L+ SQ+T+LK LW+IY++N +L+NNY+ FI T+L 
Sbjct: 268 LIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYRINTELVNNYVTFITTALL 327

Query: 329 PSQSINDQLIGKEILEIYKIERRLWIYGTITFLDILKNFANFMDPEILSQFITHVFESIS 388
           PSQ  +D +IG+EI+EIY+IERRLW+YGTITFLD+LKNF+NFMDPE+  QFITHVF S+S
Sbjct: 328 PSQPQHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITHVFVSLS 387

Query: 389 NMISDLPIDFINPWYQRLGDLSRMAIALYPSNFIDWKLSSEYWYIESMKFTFSHGKLYYH 448
            MISD+P  +   W QRLGDLSRMAIALYPS+FIDWKLS+E+WY E+MK+ ++HGKLYYH
Sbjct: 388 TMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKYVYNHGKLYYH 447

Query: 449 ISTVQQNPLEAFVNLGKSVFCFDTFIPSQRYMQLVIDNIYQRAFIERXXXXXXXXXXXXX 508
           +STVQQN LEAFVNLGKSVFC +TF PS +YMQLVIDNIYQRAF+ER             
Sbjct: 448 MSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNN----------- 496

Query: 509 XXXXHFMTSSFAKNFQQRFLIEYLKHSEVMLLPNFLENDHLKTVVLNYFTNSFGKIAIQX 568
                        N +   LIEYLKHSE MLLP+FLE+  L+ VVL+YF   FG      
Sbjct: 497 ------------GNLRNSLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFVEKFG------ 538

Query: 569 XXXXXXXXXXXXXXXXXXXXXXQANIENINNGHNIPSSSNVITSESLQINAINLFNFRNI 628
                                                         +  N  N+FN  ++
Sbjct: 539 ----------------------------------------------IDANGCNIFNPEDM 552

Query: 629 FKQKNSDILKYFFKNSATFAESHILQLIGFGDPKNPFALLFQLPKYL 675
           F Q N D  KYFF+++ +FA+SHILQ++GFG+PKNPFA+LF+LPK+L
Sbjct: 553 FIQ-NPDFFKYFFRHAPSFAQSHILQIVGFGEPKNPFAILFELPKHL 598

 Score =  244 bits (624), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 154/335 (45%), Positives = 193/335 (57%), Gaps = 80/335 (23%)

Query: 1150 FEKNSIQNTDLNCEPGLSLIENESLFEYEGYKRFIPDFSNFDKNGELISTSLYTSTIIDX 1209
            FE  S  N DL+  P LS+I+  S+F Y GYK+  P+++ FDKNGE +S SLYTS  +  
Sbjct: 921  FETRSENNIDLHAVPELSVIKGGSIFNYTGYKKLCPNYTCFDKNGEFLSASLYTSWYVPN 980

Query: 1210 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXGSNQNKESSNSTTNIDNKELFLMEKEIFNKI 1269
                                         GSN  + + NS    +N+  FL       + 
Sbjct: 981  -----------------------------GSNNPETNINSNCEKENEGQFL-------EC 1004

Query: 1270 LDPDYKNIDEIWRGEMFHDTSIQFSDTYFVLDATSWLRHFAHVYKLATNGILKFAICLTT 1329
            L  D + ID               + TYFV DATSWLRH A ++KLA N +LKFAICLTT
Sbjct: 1005 LKSDDREID--------------LNTTYFVFDATSWLRHSARIFKLAQNRLLKFAICLTT 1050

Query: 1330 FQELRFLRKSKDENVMEAATRAIITLRQLYSEKRLLPLRFTGNIATHIEEHLEFEEQITW 1389
            FQELRFLRKSKDENVMEAATR IIT+RQLY E ++LPLRFTGN+ATHIEE+LEFEEQITW
Sbjct: 1051 FQELRFLRKSKDENVMEAATRGIITIRQLYYENKVLPLRFTGNVATHIEENLEFEEQITW 1110

Query: 1390 RSHVDEFVIEAIKRAQLKRRDNRNQEDXXXXXXXXXXXXXXXXXXXXXXVTDMIF---VL 1446
            R+HVDEFVIE+I +AQ ++ +N NQ                        V+   F   +L
Sbjct: 1111 RTHVDEFVIESIMKAQ-EKLENANQ----------------------LPVSSCRFNYVIL 1147

Query: 1447 VTDDISMIKKRQEEKSDNDIITFSTKFVFSLCNML 1481
            ++DD +M KK +E+K      T ST+FVFSLC  L
Sbjct: 1148 ISDDDTMKKKAEEKKI----KTLSTRFVFSLCTKL 1178

 Score =  222 bits (566), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 114/258 (44%), Positives = 174/258 (67%), Gaps = 12/258 (4%)

Query: 790  DFFNNLESLK---LSFFLPNSLEIWNESLKYINIISLNCSIIVLKKFLNGPLFVSLPHML 846
            +FFN++++L+   +S  L N  E W ESLK++N+ SL C +IVL+KFL+GPL ++LPH L
Sbjct: 650  EFFNDIDTLRRPIVSSMLTN--EAWLESLKFLNMTSLKCGMIVLRKFLHGPLGIALPHFL 707

Query: 847  PWSYFIISLALRIESLENIESRIFWLQFIRKIFPWNSIVSYLNVIISVLLDNCYENSMIT 906
            PW YFIIS+ L+   L +  S+ FW+  +++IFPW+++V+++N++I+ +LDN   + +I 
Sbjct: 708  PWIYFIISICLKSSQLSDPISKEFWIVIVKRIFPWDTMVTFMNILIACVLDNEMTSPIIG 767

Query: 907  KLINNYSNKNLDELLVEFNENEYELPEVWKCYGSLWFDVIAE--NYQIYSRDCSKNISMK 964
             L + YS+ NL ELL  F E E ELPE+W C+G+LWFD I +     I S D  + + +K
Sbjct: 768  SLCDEYSDLNLAELLDVFKEKE-ELPEIWGCWGTLWFDTICQKNTNSISSDDDFEEVGIK 826

Query: 965  DTKCLNYPIDGLPFDEMEENGTNFWKRSCRLIFLFKTMITRFNGFGGLTISSNTSVYCNR 1024
            D   L+ PIDG+ FD  +ENG  FWKR+CR IFLF+ +   F    G+ I++ +S+  NR
Sbjct: 827  DYMALDSPIDGIIFDVNDENGEKFWKRACRTIFLFRELSRSFQ--IGVIINNESSI--NR 882

Query: 1025 SDIPNNHILRTFAFKLLP 1042
            S + +N+IL   ++KL P
Sbjct: 883  SSLQSNNILGNLSYKLEP 900

>KAFR0H00180 Chr8 complement(20661..24386) [3726 bp, 1241 aa] {ON}
           Anc_5.706 YIL151C
          Length = 1241

 Score =  444 bits (1143), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 234/409 (57%), Positives = 279/409 (68%), Gaps = 75/409 (18%)

Query: 269 LIQKLQNIYKLIVSQELELQDKCNKLSTSQSTKLKYLWSIYKLNHDLINNYILFILTSLS 328
           LI+KLQNIYK+IV QE+ELQ +C++L+TSQ+T+LK LWSIYKLN DLINNYI FI T+L 
Sbjct: 284 LIEKLQNIYKIIVKQEMELQQRCSQLTTSQTTELKNLWSIYKLNTDLINNYITFITTALL 343

Query: 329 PSQSINDQLIGKEILEIYKIERRLWIYGTITFLDILKNFANFMDPEILSQFITHVFESIS 388
           PSQS+ D  IG+EI+EIY+IERRLW+YGTITFLD+LKNF+NFMDPE+ SQFITHVF S+S
Sbjct: 344 PSQSLQDIQIGEEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCSQFITHVFISLS 403

Query: 389 NMISDLPIDFINPWYQRLGDLSRMAIALYPSNFIDWKLSSEYWYIESMKFTFSHGKLYYH 448
            M+ DLP     PW QRLGDLSRMAIALYPS FIDWKLS+E+WY+E+MKFT+SHGKLYYH
Sbjct: 404 TMLIDLPPKHSIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKFTYSHGKLYYH 463

Query: 449 ISTVQQNPLEAFVNLGKSVFCFDTFIPSQRYMQLVIDNIYQRAFIERXXXXXXXXXXXXX 508
           +STVQQN LEAFVNLGKSVFC DTF PSQ+YMQLVIDNIYQR F++R             
Sbjct: 464 MSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRTFVDRNKN---------- 513

Query: 509 XXXXHFMTSSFAKNFQQRFLIEYLKHSEVMLLPNFLENDHLKTVVLNYFTNSFGKIAIQX 568
                        N +   LI+YLKHSEVMLLP+FLEN+ L+ VVLNYF + FG      
Sbjct: 514 ------------GNVRNSDLIDYLKHSEVMLLPSFLENEDLQQVVLNYFNDRFGVDY--- 558

Query: 569 XXXXXXXXXXXXXXXXXXXXXXQANIENINNGHNIPSSSNVITSESLQINAINLFNFRNI 628
                                         N +NI  + ++      Q+ A   F FR+ 
Sbjct: 559 ------------------------------NDNNIFETQDMF----FQVPASLRFYFRH- 583

Query: 629 FKQKNSDILKYFFKNSATFAESHILQLIGFGDPKNPFALLFQLPKYLKE 677
                          +  FAESHILQL+GFG+PKNPFALLF LP +LKE
Sbjct: 584 ---------------APAFAESHILQLVGFGNPKNPFALLFDLPNFLKE 617

 Score =  254 bits (650), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 154/334 (46%), Positives = 196/334 (58%), Gaps = 34/334 (10%)

Query: 1150 FEKNSIQNTDLNCEPGLSLIENESLFEYEGYKRFIPDFSNFDKNGELISTSLYTSTIIDX 1209
            FE     N D +  P LS+++ E++FEY GYK+   +  +FD+NGEL+S+S+YT+ +ID 
Sbjct: 931  FENIDETNLDFDARPMLSVVKGENIFEYVGYKKLFLNNHSFDRNGELVSSSIYTAWVIDN 990

Query: 1210 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXGSNQNKESSNSTTNIDNKELFLMEKEIFNKI 1269
                                            QN +  N  +N D ++ F  E  +  + 
Sbjct: 991  DNSLNNSQGNQYTSNMQMTQQQRQLLP--PEQQNFQMRNFASNEDTEDDFNFELYMNPEK 1048

Query: 1270 LDPDYKNIDE--IWRGEMFHDTSIQFSDTYFVLDATSWLRHFAHVYKLATNGILKFAICL 1327
            L+   KN+D+  IW      +  I  + TYFV DATSWLRHFAH+YKL+TN +L FA+CL
Sbjct: 1049 LN---KNMDQASIWTTA---NDEINRNITYFVFDATSWLRHFAHIYKLSTNNVLNFAVCL 1102

Query: 1328 TTFQELRFLRKSKDENVMEAATRAIITLRQLYSEKRLLPLRFTGNIATHIEEHLEFEEQI 1387
            TTFQELRFLRKSKDENV+ AA RAIIT+RQLYSE +LLPLRFTGN+AT IEEHLEFEEQI
Sbjct: 1103 TTFQELRFLRKSKDENVVGAAARAIITMRQLYSEGKLLPLRFTGNVATDIEEHLEFEEQI 1162

Query: 1388 TWRSHVDEFVIEAIKRAQLKRRDNRNQEDXXXXXXXXXXXXXXXXXXXXXXVTDMIFVLV 1447
            TWRSHVDEFVIEA+ +AQ K                               V     VLV
Sbjct: 1163 TWRSHVDEFVIEAVVKAQNK---------------FISANESVTLRKGFNHV-----VLV 1202

Query: 1448 TDDISMIKKRQEEKSDNDIITFSTKFVFSLCNML 1481
            TDDI+M +K QE+     I TF+T F+FS+C  L
Sbjct: 1203 TDDINMKRKAQEQ----GIKTFTTHFIFSVCRKL 1232

 Score =  246 bits (629), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 117/252 (46%), Positives = 175/252 (69%), Gaps = 6/252 (2%)

Query: 790  DFFNNLESLKLSFFLPNSLEIWNESLKYINIISLNCSIIVLKKFLNGPLFVSLPHMLPWS 849
            ++F+N++SL+L    PN L +W +SL+++N+ SL CS+IVL+KFL GPL ++LPH+LPW+
Sbjct: 662  EYFDNIDSLRLPIDHPNIL-VWLKSLEHLNMTSLKCSVIVLRKFLRGPLLIALPHVLPWT 720

Query: 850  YFIISLALRIESLENIESRIFWLQFIRKIFPWNSIVSYLNVIISVLLDNCYENSMITKLI 909
            YFII+  L+ +S +N  S  FW   +R+I PWN++ S+LNV+++ +LDN Y+   I KL 
Sbjct: 721  YFIIATFLKAQSSKNTSSVKFWTIVMRRILPWNTLTSFLNVLLAYILDNFYQTESIAKLC 780

Query: 910  NNYSN-KNLDELLVEFNENEYELPEVWKCYGSLWFDVIAENYQIYSRDCSKNISMKDTKC 968
              YSN +N  ELL  FN NE  LPE+WKC+G+LWFDVI+ N +  + D    + ++D   
Sbjct: 781  ETYSNFENFYELLDYFNRNE-NLPEIWKCWGTLWFDVIS-NKRALNADTFNGLGIEDHMF 838

Query: 969  LNYPIDGLPFDEMEENGTNFWKRSCRLIFLFKTMITRFNGFGGLTISSNTSVYCNRSDIP 1028
            L++P+DG+ FDE++E G NFW R+ R++FLFK +        GL +S    V+C R DI 
Sbjct: 839  LDFPLDGIGFDELDETGENFWNRALRIVFLFKGIAENLQ--TGLRVSRTAPVHCRRDDID 896

Query: 1029 NNHILRTFAFKL 1040
             NHIL++F+FK+
Sbjct: 897  PNHILKSFSFKM 908

>NCAS0A03170 Chr1 complement(621400..625359) [3960 bp, 1319 aa] {ON}
           Anc_5.706 YIL151C
          Length = 1319

 Score =  444 bits (1141), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 239/411 (58%), Positives = 293/411 (71%), Gaps = 61/411 (14%)

Query: 269 LIQKLQNIYKLIVSQELELQDKCNKLSTSQSTKLKYLWSIYKLNHDLINNYILFILTSLS 328
           L++KLQ+IYK+IV QE+ELQ++C++L+TSQ+T LK LW+IYK+N DLINNY+ FI T+L 
Sbjct: 300 LVRKLQDIYKVIVKQEIELQERCSQLTTSQTTDLKNLWTIYKVNIDLINNYVTFITTALL 359

Query: 329 PSQSINDQLIGKEILEIYKIERRLWIYGTITFLDILKNFANFMDPEILSQFITHVFESIS 388
            SQS  D  IG+EI+EIY+IERRLW+YGTITFLD+LKNF+NFMDPE+  QFITHVF S+S
Sbjct: 360 SSQSQQDLHIGEEIIEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITHVFISLS 419

Query: 389 NMISDLPIDFINPWYQRLGDLSRMAIALYPSNFIDWKLSSEYWYIESMKFTFSHGKLYYH 448
            M++D+P  +  PW QRLGDLSRMAIALYPS FIDWKLS+E WY+E+MKFT++HGKLYYH
Sbjct: 420 TMLADIPTKYSIPWLQRLGDLSRMAIALYPSGFIDWKLSAEEWYMEAMKFTYNHGKLYYH 479

Query: 449 ISTVQQNPLEAFVNLGKSVFCFDTFIPSQRYMQLVIDNIYQRAFIERXXXXXXXXXXXXX 508
           +STVQQN LEAFVNLGKSVFC +TF PSQ+YMQLVIDNIYQRAF+ER             
Sbjct: 480 MSTVQQNTLEAFVNLGKSVFCQETFTPSQQYMQLVIDNIYQRAFVERNNGNN-------- 531

Query: 509 XXXXHFMTSSFAKNFQQRFLIEYLKHSEVMLLPNFLENDHLKTVVLNYFTNSFGKIAIQX 568
                       +N Q   LIEYLKHSEVMLLP FLEN  L+ VVL YF   FG + +  
Sbjct: 532 ------------RNLQ---LIEYLKHSEVMLLPTFLENSELQQVVLLYFQEKFGILEV-- 574

Query: 569 XXXXXXXXXXXXXXXXXXXXXXQANIENINNGHNIPSSSNVITSESLQIN--AINLFNFR 626
                                             IPS+S  I+  ++  N   I++F  R
Sbjct: 575 ---------------------------------TIPSTSETISINTMNNNTRTIDMFRSR 601

Query: 627 NIFKQKNSDILKYFFKNSATFAESHILQLIGFGDPKNPFALLFQLPKYLKE 677
           ++F Q N + LKYFF+++  FAESHILQL+GFGDPKNPFALLF+LPKYLKE
Sbjct: 602 DMFIQ-NPEQLKYFFRHAPAFAESHILQLVGFGDPKNPFALLFELPKYLKE 651

 Score =  252 bits (643), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 124/284 (43%), Positives = 184/284 (64%), Gaps = 17/284 (5%)

Query: 780  DEMLDNLSPQDFFNNLESLKLSFFLPNSLEIWNESLKYINIISLNCSIIVLKKFLNGPLF 839
            D +++ ++ ++FF N+E L+  +F+PNSLEIW  SL +IN+ISL CS+IVLKKFL+GPL 
Sbjct: 700  DNVMNQVTSEEFFQNIEQLRFDYFIPNSLEIWMASLNHINLISLKCSMIVLKKFLHGPLL 759

Query: 840  VSLPHMLPWSYFIISLALRIESLENIESRIFWLQFIRKIFPWNSIVSYLNVIISVLLDNC 899
            ++LPH+LPW YFIIS+ L+ E L + +S+IFW+  ++ IFPWN I+++LNV++   LDN 
Sbjct: 760  IALPHLLPWCYFIISILLKREGLTHEDSKIFWIGILKTIFPWNDIINFLNVLLRYTLDNI 819

Query: 900  Y--------------ENSMITKLINNYSNKNLDELLVEFNENEYELPEVWKCYGSLWFDV 945
                            N  I  L N YS     +LL  FNENE +LPEVWKC+G+LWFD 
Sbjct: 820  GLPTPSAVNDTKQKDMNVFILDLCNKYSTMGFADLLQHFNENE-DLPEVWKCWGTLWFDT 878

Query: 946  IAENYQIYSRDCSKNISMKDTKCLNYPIDGLPFDEMEENGTNFWKRSCRLIFLFKTMITR 1005
            I+ N      D  +N+ +KD   L++PIDG+ +   +E G NFWKR+ R+IFLFK +   
Sbjct: 879  IS-NKNGMDADSFENLGIKDHMFLDFPIDGIGYVLEDETGENFWKRTLRIIFLFKGIAEN 937

Query: 1006 FNGFGGLTISSNTSVYCNRSDIPNNHILRTFAFKLLPDDDNYMN 1049
            F+   GL +S N       +++P ++IL+ F+FK    + +Y++
Sbjct: 938  FDSL-GLKVSYNAGTEYRNNNVPMDNILKMFSFKWAGSNADYVD 980

 Score =  245 bits (626), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 148/338 (43%), Positives = 193/338 (57%), Gaps = 40/338 (11%)

Query: 1152 KNSIQNTDLNCE--PGLSLIENESLFEYEGYKRFIPDFSNFDKNGELISTSLYTSTIIDX 1209
            K  I  T+LN E  P  S+I NE +F+Y GYK+  P+  +FDKNGE  S S+YT+  +D 
Sbjct: 1005 KEPIHETNLNFEIPPLKSMIANEDIFDYTGYKKLEPNSRSFDKNGEFSSGSIYTAWPMDY 1064

Query: 1210 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXGSNQNKESSNSTTNIDNKELFLMEKEIFNKI 1269
                                          +++  +    T +ID           F ++
Sbjct: 1065 DQLILAQNNNNNTN---------------ATDEMTDLFTGTLSIDELS--------FRQL 1101

Query: 1270 LDPDYKNIDEIWRGEMFHDTSIQ---FSDTYFVLDATSWLRHFAHVYKLATNGILKFAIC 1326
              P++++     +  +   TS +      TYFV DATSWLRHFAH+YKLA+N +LKFA+C
Sbjct: 1102 KRPEFRD-----KSTLLSSTSTEPFNRYKTYFVFDATSWLRHFAHIYKLASNHVLKFAVC 1156

Query: 1327 LTTFQELRFLRKSKDENVMEAATRAIITLRQLYSEKRLLPLRFTGNIATHIEEHLEFEEQ 1386
            LTTFQELRFLRKSKD NV+EA+TRAIIT+RQLYS+  LLPLRFTGN+AT IEEHLEFEEQ
Sbjct: 1157 LTTFQELRFLRKSKDANVVEASTRAIITMRQLYSDGNLLPLRFTGNVATDIEEHLEFEEQ 1216

Query: 1387 ITWRSHVDEFVIEAIKRAQLKRRDNRNQEDXXXXXXXXXXXXXXXXXXXXXXVTDMIF-- 1444
            ITWRSHVDEFVIEA+ +AQ K   ++  E+                          +F  
Sbjct: 1217 ITWRSHVDEFVIEAVMKAQEKFVKSKTVENMEGTSNWGEIDATTTTVSAEEEEKSNLFKY 1276

Query: 1445 -VLVTDDISMIKKRQEEKSDNDIITFSTKFVFSLCNML 1481
             VL+TDD SM  K Q +     I TF T+ VFS+C+M+
Sbjct: 1277 VVLITDDDSMRMKAQLK----GISTFGTQVVFSVCSMM 1310

>KLTH0E00968g Chr5 complement(92019..95465) [3447 bp, 1148 aa] {ON}
           similar to uniprot|P36168 Saccharomyces cerevisiae
           YKR096W Hypothetical ORF
          Length = 1148

 Score =  435 bits (1119), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 218/407 (53%), Positives = 272/407 (66%), Gaps = 76/407 (18%)

Query: 269 LIQKLQNIYKLIVSQELELQDKCNKLSTSQSTKLKYLWSIYKLNHDLINNYILFILTSLS 328
           L+QKLQ+IY+ IV QE+ELQ++C++L+ SQ+T LK LW IYK+N +LINNY+ FI T+L 
Sbjct: 214 LVQKLQDIYRNIVKQEVELQERCSQLTHSQTTDLKNLWIIYKVNTELINNYVAFITTALL 273

Query: 329 PSQSINDQLIGKEILEIYKIERRLWIYGTITFLDILKNFANFMDPEILSQFITHVFESIS 388
           PSQ   D LIG+EI+ IY+IERRLW++GTITFLD+LKNF+NFMDPE+  QFITHVF SIS
Sbjct: 274 PSQPEQDLLIGQEIVNIYRIERRLWVHGTITFLDVLKNFSNFMDPEVCCQFITHVFISIS 333

Query: 389 NMISDLPIDFINPWYQRLGDLSRMAIALYPSNFIDWKLSSEYWYIESMKFTFSHGKLYYH 448
           NM+ D+P  F  PW +RLGDLSRMAIALYPS FIDWKLS+E+WY +++   F HGKLYYH
Sbjct: 334 NMLGDMPQKFATPWLERLGDLSRMAIALYPSGFIDWKLSAEHWYTQALSHIFGHGKLYYH 393

Query: 449 ISTVQQNPLEAFVNLGKSVFCFDTFIPSQRYMQLVIDNIYQRAFIERXXXXXXXXXXXXX 508
           +STVQQN LEAFVNLGKSVFC DTFIPSQ+YMQLVIDNIYQRAF ER             
Sbjct: 394 MSTVQQNTLEAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAERN------------ 441

Query: 509 XXXXHFMTSSFAKNFQQRFLIEYLKHSEVMLLPNFLENDHLKTVVLNYFTNSFGKIAIQX 568
                        N +   ++EYLKHSEVMLL +FLE+  L+ VVL++F N FG      
Sbjct: 442 -----------GGNQRNSLMVEYLKHSEVMLLSSFLESPELQKVVLSFFQNKFG------ 484

Query: 569 XXXXXXXXXXXXXXXXXXXXXXQANIENINNGHNIPSSSNVITSESLQINAINLFNFRNI 628
                                                         +  N  + F+ + I
Sbjct: 485 ----------------------------------------------ISSNNTDYFSHQAI 498

Query: 629 FKQKNSDILKYFFKNSATFAESHILQLIGFGDPKNPFALLFQLPKYL 675
           F Q + +  KYFF+++  FAESHILQ++GFG+PKNPFALLF+LPK+L
Sbjct: 499 FLQ-DGERTKYFFRHAPAFAESHILQMVGFGNPKNPFALLFELPKFL 544

 Score =  238 bits (607), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 161/361 (44%), Positives = 204/361 (56%), Gaps = 62/361 (17%)

Query: 1137 DSNTERNIDTWIP-FEKNSIQNTDLNCEPGLSLIENESLFEYEGYKRFIPDFSNFDKNGE 1195
            DS +   I T +P FE  S +N D N  PG S++E +SLFE  GY++   D + F+K G 
Sbjct: 825  DSESYALISTQMPAFENISERNLDPNAPPGQSMLEGKSLFELPGYRQLHADHTCFNKTGT 884

Query: 1196 LISTSLYTSTIIDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGSNQNKES---SNSTTN 1252
            LI+ SLYTS  ++                              G + N E    S+    
Sbjct: 885  LITCSLYTSGSLEKGPIHG------------------------GDDFNTERYSRSDELNK 920

Query: 1253 IDN---KELFLMEKEIFNKILDPDYKNIDEIWRGEMFHDTSIQFSD---------TYFVL 1300
             DN   KEL  ME+   +  ++P++         E  +D    F D         +YFV 
Sbjct: 921  ADNPQIKELDKMERMWLDTCMNPEFI--------EQTYDMKFPFGDLSCNCDSGVSYFVP 972

Query: 1301 DATSWLRHFAHVYKLATNGILKFAICLTTFQELRFLRKSKDENVMEAATRAIITLRQLYS 1360
            DATSWLRHFAHVYKLATNG+L+FAICLTTFQELRFLRKSKDE+V+EAATRA+IT+RQLYS
Sbjct: 973  DATSWLRHFAHVYKLATNGVLRFAICLTTFQELRFLRKSKDESVVEAATRAVITVRQLYS 1032

Query: 1361 EKRLLPLRFTGNIATHIEEHLEFEEQITWRSHVDEFVIEAIKRAQLKRRDNRNQEDXXXX 1420
            EKRLLPLRFTGN+ATH+EEHLEFEEQITWRSHVDEFVIEA+ +AQ K      Q      
Sbjct: 1033 EKRLLPLRFTGNVATHLEEHLEFEEQITWRSHVDEFVIEAVYKAQNKFEALNAQAKEGGH 1092

Query: 1421 XXXXXXXXXXXXXXXXXXVTDMIFVLVTDDISMIKKRQEEKSDNDIITFSTKFVFSLCNM 1480
                                     LV+DD +M  K   ++    I TFS++F+F++CN 
Sbjct: 1093 DFIPTTEEEPFH----------FIALVSDDTNMRLKAHAQR----IRTFSSRFMFAVCNQ 1138

Query: 1481 L 1481
            +
Sbjct: 1139 I 1139

 Score =  227 bits (579), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 106/254 (41%), Positives = 167/254 (65%), Gaps = 6/254 (2%)

Query: 787  SPQDFFNNLESLKLSFFLPNSLEIWNESLKYINIISLNCSIIVLKKFLNGPLFVSLPHML 846
            SP ++  +++S +  +  P  L IW +SL +IN  S+ CS +VL+KFL+GPL  +  H+L
Sbjct: 572  SPIEYLESVDSPRFVYEFPTDLAIWQQSLSHINTTSIKCSAVVLQKFLHGPLVSAAAHLL 631

Query: 847  PWSYFIISLALRIESLENIESRIFWLQFIRKIFPWNSIVSYLNVIISVLLDNCYENSMIT 906
            PW+YF++SLA+RI+ L + E + FW+   R++FPWNSIV++LN+II+  LDN ++ S I 
Sbjct: 632  PWAYFLLSLAIRIDELPSPELKDFWIALCRQVFPWNSIVNFLNMIIAFALDNAWKTSSID 691

Query: 907  KLINNYSNKNLDELLVEFNENEYELPEVWKCYGSLWFDVIAENYQIYSRDCSKNISMKDT 966
             L   + + ++  L+  F++NE +LPEVWKC+G+LWFDVI++   +     + N S++D 
Sbjct: 692  NLCEQFDSVDVRTLVDHFSQNE-DLPEVWKCWGALWFDVISDKSDVVDEGATYN-SVQDH 749

Query: 967  KCLNYPIDGLPFDEMEENGTNFWKRSCRLIFLFKTMITRFNGFGGLTISSNTSVYCNRSD 1026
               + P+DG+ FDE +E G+ FWKR+CRL+F+FK +   FN   GLT++S      +R  
Sbjct: 750  MFGDMPVDGICFDEDDETGSRFWKRACRLVFIFKGIAQEFN--MGLTLASVP--LQSRRS 805

Query: 1027 IPNNHILRTFAFKL 1040
            +   H L+ F FK 
Sbjct: 806  LAAGHPLQNFCFKF 819

>Kwal_55.19678 s55 complement(75394..78930) [3537 bp, 1178 aa] {ON}
           YKR096W - Hypothetical ORF [contig 159] FULL
          Length = 1178

 Score =  436 bits (1120), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 220/407 (54%), Positives = 274/407 (67%), Gaps = 76/407 (18%)

Query: 269 LIQKLQNIYKLIVSQELELQDKCNKLSTSQSTKLKYLWSIYKLNHDLINNYILFILTSLS 328
           L+QKLQ+IY+ IV QE+ELQ++C +L+TSQ+T LK LW IYK+N +LINNY+ FI T+L 
Sbjct: 244 LVQKLQDIYRNIVKQEVELQERCAQLTTSQTTDLKNLWIIYKINIELINNYVAFITTALL 303

Query: 329 PSQSINDQLIGKEILEIYKIERRLWIYGTITFLDILKNFANFMDPEILSQFITHVFESIS 388
           PSQ   D LIG+EI+ IY+IERRLW++GTITFLD+LKNF+NFMDPE+  QFITHVF SIS
Sbjct: 304 PSQPEQDLLIGQEIVNIYRIERRLWVHGTITFLDVLKNFSNFMDPEVCCQFITHVFISIS 363

Query: 389 NMISDLPIDFINPWYQRLGDLSRMAIALYPSNFIDWKLSSEYWYIESMKFTFSHGKLYYH 448
            M+ D+P  F  PW++RLGDLSRMAIALYPS FIDWKLS+E+WY +++   F HGKLYYH
Sbjct: 364 TMLGDMPQKFSTPWFERLGDLSRMAIALYPSGFIDWKLSAEHWYSQALSHIFGHGKLYYH 423

Query: 449 ISTVQQNPLEAFVNLGKSVFCFDTFIPSQRYMQLVIDNIYQRAFIERXXXXXXXXXXXXX 508
           +STVQQN LEAFVNLGKSVFC DTFIPS +YMQLVIDNIYQRAF ER             
Sbjct: 424 MSTVQQNTLEAFVNLGKSVFCRDTFIPSPQYMQLVIDNIYQRAFAERN------------ 471

Query: 509 XXXXHFMTSSFAKNFQQRFLIEYLKHSEVMLLPNFLENDHLKTVVLNYFTNSFGKIAIQX 568
                        N +   ++EYLKHSEVMLL +FLE+  L+ VVL++F + FG      
Sbjct: 472 -----------GGNHRNSLMVEYLKHSEVMLLSSFLESPELQKVVLSFFQHKFGV----- 515

Query: 569 XXXXXXXXXXXXXXXXXXXXXXQANIENINNGHNIPSSSNVITSESLQINAINLFNFRNI 628
                                               S+SN            + FN R++
Sbjct: 516 ------------------------------------STSNT-----------DFFNPRDM 528

Query: 629 FKQKNSDILKYFFKNSATFAESHILQLIGFGDPKNPFALLFQLPKYL 675
           F Q + + +KYFF+++  FAESHILQ +GFGDPKNPFALLF+LPK+L
Sbjct: 529 FLQ-DGERVKYFFRHAPAFAESHILQTVGFGDPKNPFALLFELPKFL 574

 Score =  236 bits (602), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 150/338 (44%), Positives = 200/338 (59%), Gaps = 38/338 (11%)

Query: 1148 IP-FEKNSIQNTDLNCEPGLSLIENESLFEYEGYKRFIPDFSNFDKNGELISTSLYTSTI 1206
            IP FE+ +  N D N  PG S++E ES+F++ GY++   D++ F+K+G LIS SLYTS  
Sbjct: 866  IPLFEEIATGNLDPNIRPGQSMLEGESIFDFPGYRQMYADYTCFNKSGSLISCSLYTSGK 925

Query: 1207 IDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGSNQNKESSNSTTNIDNKELFLMEKEIF 1266
            ++                                    E SN   N    EL  +E++  
Sbjct: 926  LERGPIQGGDDFNTERYG------------------RSEDSNKPENAQITELERLERDWL 967

Query: 1267 NKILDPDYKNIDEIWRGEM-FHDTSIQFSD--TYFVLDATSWLRHFAHVYKLATNGILKF 1323
            +  ++P++  I++ +  +  F D S       +YFVLDATSWLRHFAHV+KLATN +L+F
Sbjct: 968  DNCMNPEF--IEQAYEMKFPFGDLSCNCDSGVSYFVLDATSWLRHFAHVFKLATNNVLRF 1025

Query: 1324 AICLTTFQELRFLRKSKDENVMEAATRAIITLRQLYSEKRLLPLRFTGNIATHIEEHLEF 1383
             ICLTTFQELRFLRKSKDE+V+EAATRA+IT+RQLYS+K+LLPLRFTGN+ATH+EEHLEF
Sbjct: 1026 GICLTTFQELRFLRKSKDESVVEAATRAVITVRQLYSDKKLLPLRFTGNVATHLEEHLEF 1085

Query: 1384 EEQITWRSHVDEFVIEAIKRAQLKRRDNRNQEDXXXXXXXXXXXXXXXXXXXXXXVTDMI 1443
            EEQITWRSHVDEFVIEA+ +AQ K      Q                             
Sbjct: 1086 EEQITWRSHVDEFVIEAVYKAQKKFEAINAQAKEAGHDFIATTDEEPFH----------F 1135

Query: 1444 FVLVTDDISMIKKRQEEKSDNDIITFSTKFVFSLCNML 1481
              LV+DD +M  K   ++    I TFST+F+F++CN +
Sbjct: 1136 VALVSDDTNMRVKAHTQR----IQTFSTRFMFAVCNQI 1169

 Score =  228 bits (581), Expect = 5e-60,   Method: Compositional matrix adjust.
 Identities = 113/258 (43%), Positives = 167/258 (64%), Gaps = 6/258 (2%)

Query: 781  EMLDNLSPQDFFNNLESLKLSFFLPNSLEIWNESLKYINIISLNCSIIVLKKFLNGPLFV 840
            E   +LSP ++  N++S + ++  P  L IW ESL +INI S  CS IV +KFL GPL V
Sbjct: 596  ETTSHLSPSEYLENVDSPRYAYEFPEDLAIWRESLSHINITSARCSSIVFQKFLRGPLVV 655

Query: 841  SLPHMLPWSYFIISLALRIESLENIESRIFWLQFIRKIFPWNSIVSYLNVIISVLLDNCY 900
            ++ HMLPWSYF++SLAL+I+SL ++E + FW+  +R+IFPWNSIV +LN++++ +LDN +
Sbjct: 656  AVTHMLPWSYFLLSLALKIDSLPSVELKSFWITLVRQIFPWNSIVDFLNMLMAFVLDNNW 715

Query: 901  ENSMITKLINNYSNKNLDELLVEFNENEYELPEVWKCYGSLWFDVIAENYQIYSRDCSKN 960
            + S I  L     + +   L+  F+E+E +LPE+W+C+G+LWFDVIA+       D   N
Sbjct: 716  KTSPIDTLCEQLDSVDARSLVEHFSEHE-DLPEIWRCWGALWFDVIADKSNGEDGDV-IN 773

Query: 961  ISMKDTKCLNYPIDGLPFDEMEENGTNFWKRSCRLIFLFKTMITRFNGFGGLTISSNTSV 1020
               KD    + P DG+ FDE +E G  FWKR+CRLIF+FK +   F+   GLT+S+    
Sbjct: 774  SGSKDHPFWDLPGDGICFDEDDEVGEKFWKRACRLIFIFKGIAQEFS--LGLTLSAFAPQ 831

Query: 1021 YCNRSDIPNNHILRTFAF 1038
              +R  +   H L+ F+F
Sbjct: 832  --SRRPMTAGHPLQNFSF 847

>Kpol_1043.73 s1043 (155026..158808) [3783 bp, 1260 aa] {ON}
           (155026..158808) [3783 nt, 1261 aa]
          Length = 1260

 Score =  435 bits (1119), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 221/409 (54%), Positives = 287/409 (70%), Gaps = 72/409 (17%)

Query: 269 LIQKLQNIYKLIVSQELELQDKCNKLSTSQSTKLKYLWSIYKLNHDLINNYILFILTSLS 328
           L+QKLQ+IYK+I+ QE+ELQ++C++L+ SQ+T++K LW IYKLN DLINNY+ FI T+L 
Sbjct: 318 LVQKLQDIYKIILKQEVELQERCSQLTNSQTTEIKNLWVIYKLNADLINNYVTFITTALF 377

Query: 329 PSQSINDQLIGKEILEIYKIERRLWIYGTITFLDILKNFANFMDPEILSQFITHVFESIS 388
           PSQS +D LIG+EI++IYKIERRLW+YGTITFLD+LKNF+NFMDPE+  QFITHVF SIS
Sbjct: 378 PSQSKSDLLIGEEIVDIYKIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITHVFISIS 437

Query: 389 NMISDLPIDFINPWYQRLGDLSRMAIALYPSNFIDWKLSSEYWYIESMKFTFSHGKLYYH 448
           +M+ D+P  +  PW Q+LGDLSRMA+AL+PS FIDWKLS+E WY+ +M++++ +GKLYYH
Sbjct: 438 SMLDDIPQKYAIPWLQKLGDLSRMAVALFPSGFIDWKLSAERWYMAAMEYSYGYGKLYYH 497

Query: 449 ISTVQQNPLEAFVNLGKSVFCFDTFIPSQRYMQLVIDNIYQRAFIERXXXXXXXXXXXXX 508
           +STVQQN LEAFVNLGKSVFC +TF+PSQ+Y+QLVIDNIYQRAF +R             
Sbjct: 498 MSTVQQNTLEAFVNLGKSVFCQNTFVPSQQYLQLVIDNIYQRAFADRN------------ 545

Query: 509 XXXXHFMTSSFAKNFQQRFLIEYLKHSEVMLLPNFLENDHLKTVVLNYFTNSFGKIAIQX 568
                  +SS ++N Q   L++YLKHSEVMLLPNF+E+  L+ VVL YF   FG      
Sbjct: 546 -------SSSNSRNCQ--LLVDYLKHSEVMLLPNFMESPDLQQVVLLYFMEKFG------ 590

Query: 569 XXXXXXXXXXXXXXXXXXXXXXQANIENINNGHNIPSSSNVITSESLQINAINLFNFRNI 628
                                    I+  NN                    + +F  R +
Sbjct: 591 -------------------------IDYNNNN-------------------VKMFQPRQM 606

Query: 629 FKQKNSDILKYFFKNSATFAESHILQLIGFGDPKNPFALLFQLPKYLKE 677
           F Q N+D LK++F+++  FAE+ ILQL+G+G+PKNPFALLF LPKYLKE
Sbjct: 607 FIQ-NNDQLKFYFRHANAFAEAQILQLVGYGNPKNPFALLFSLPKYLKE 654

 Score =  296 bits (759), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 171/337 (50%), Positives = 211/337 (62%), Gaps = 59/337 (17%)

Query: 1150 FEKNSIQNTDLNCEPGLSLIENESLFEYEGYKRFIPDFSNFDKNGELISTSLYTSTIIDX 1209
            FE+    N+D N  P LS+I  E++FEY GYKR   D+ +FDKNG+LISTS Y +  I+ 
Sbjct: 965  FEEIDSNNSDFNAIPLLSMIYGENIFEYVGYKRIHADYYSFDKNGDLISTSFYNTWSINQ 1024

Query: 1210 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXGSNQNKESSNSTTNIDNKELFLMEKEIFNKI 1269
                                         G N    S+NS+++       + EKE+FNK 
Sbjct: 1025 DT---------------------------GVNGGPLSNNSSSSNAASSDPMNEKELFNKC 1057

Query: 1270 LDPDYKNIDEIWRGEMFHDTSIQFS-----DTYFVLDATSWLRHFAHVYKLATNGILKFA 1324
             DP+Y ++DE W  E++ D   +F      DTYF+LDATSWLRHFAHVYK+ATN ILKF+
Sbjct: 1058 FDPEYDSVDEFWNKEIYDDIGRKFGMELYEDTYFILDATSWLRHFAHVYKIATNSILKFS 1117

Query: 1325 ICLTTFQELRFLRKSKDENVMEAATRAIITLRQLYSEKRLLPLRFTGNIATHIEEHLEFE 1384
            ICLTTFQELRFLRKSKDENV+EAATRAIITLRQL+SE +LLPLRFTGN+ATHIEEHLEFE
Sbjct: 1118 ICLTTFQELRFLRKSKDENVVEAATRAIITLRQLFSEGKLLPLRFTGNVATHIEEHLEFE 1177

Query: 1385 EQITWRSHVDEFVIEAIKRAQLKRRDNRNQEDXXXXXXXXXXXXXXXXXXXXXXVTDMIF 1444
            EQITWRSHVDEFVIEA+ +A+ KR++   QE                       +     
Sbjct: 1178 EQITWRSHVDEFVIEAVIKAETKRKE---QE--------------------MHNMKGFQI 1214

Query: 1445 VLVTDDISMIKKRQEEKSDNDIITFSTKFVFSLCNML 1481
            VLVTDD +M  K  E+ S     TFST+FVF++ N L
Sbjct: 1215 VLVTDDSNMKNKALEKGSK----TFSTRFVFAISNYL 1247

 Score =  285 bits (728), Expect = 9e-78,   Method: Compositional matrix adjust.
 Identities = 137/276 (49%), Positives = 191/276 (69%), Gaps = 4/276 (1%)

Query: 775  GMEDEDEMLDN--LSPQDFFNNLESLKLSFFLPNSLEIWNESLKYINIISLNCSIIVLKK 832
            GME    M  N  L  +DFFNN++ L ++ F+PNS+ +WN+SLKY N  +  CS+IVL+K
Sbjct: 683  GMEYMVNMETNVFLGSEDFFNNIDKLAINNFMPNSISLWNDSLKYHNFTATKCSMIVLQK 742

Query: 833  FLNGPLFVSLPHMLPWSYFIISLALRIESLENIESRIFWLQFIRKIFPWNSIVSYLNVII 892
            FLNGPL V+LPH+LPW YF+IS+AL+IE  ++     FW  FI++IFPWNS+V +LNV++
Sbjct: 743  FLNGPLMVALPHILPWVYFLISIALQIEKYQDTAMMEFWYAFIKRIFPWNSMVRFLNVLL 802

Query: 893  SVLLDNCYENSMITKLINNYSNKNLDELLVEFNENEYELPEVWKCYGSLWFDVIAENYQI 952
            + ++DNC++NS + +L + Y + NL+ELL  FN NE +LPEVWKC GSLWFD+I E    
Sbjct: 803  AYMIDNCWDNSPLNELCDQYGSLNLEELLRNFNANE-DLPEVWKCRGSLWFDIIDEKRNS 861

Query: 953  YSRDCSKNISMKDTKCLNYPIDGLPFDEMEENGTNFWKRSCRLIFLFKTMITRFNGFGGL 1012
             + D      +KD + L++P+DG+ FDE +E G  FWKRS R+IFLF+ ++ RFNGFG L
Sbjct: 862  QNCDSYTECGIKDYQFLDFPVDGIEFDENDEIGIKFWKRSVRVIFLFRGIVERFNGFGNL 921

Query: 1013 TISSNTSVYCNRSDIPNNHILRTFAFKLLPDDDNYM 1048
             IS N  V  NR  +  N  L  ++FKL+   D+ M
Sbjct: 922  AISYNAPV-INRRGLGVNSHLVGYSFKLMAKSDDIM 956

>AFR290W Chr6 (960776..964429) [3654 bp, 1217 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL151C and YKR096W
          Length = 1217

 Score =  432 bits (1111), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 219/409 (53%), Positives = 278/409 (67%), Gaps = 77/409 (18%)

Query: 269 LIQKLQNIYKLIVSQELELQDKCNKLSTSQSTKLKYLWSIYKLNHDLINNYILFILTSLS 328
           L++KLQ IY+ IV QE ELQ +C++L+TSQ+T LK LW IYK+N +LI+NY +FI T+L 
Sbjct: 285 LMEKLQEIYRNIVRQETELQQRCSQLTTSQTTDLKNLWIIYKVNAELIDNYFMFITTALL 344

Query: 329 PSQSINDQLIGKEILEIYKIERRLWIYGTITFLDILKNFANFMDPEILSQFITHVFESIS 388
           P+Q   D LIGKEI+E+Y+IERRLW+YGTITFLD+LKNF+NFMDPE+  QFI +VF SIS
Sbjct: 345 PTQPEADLLIGKEIIEVYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFIIYVFISIS 404

Query: 389 NMISDLPIDFINPWYQRLGDLSRMAIALYPSNFIDWKLSSEYWYIESMKFTFSHGKLYYH 448
           NM+ D+P  F   W +RLGDLSRMAIALYPS FIDWKLS+E+WY E++K+TF HGKLYYH
Sbjct: 405 NMLGDIPPKFSIIWLERLGDLSRMAIALYPSGFIDWKLSAEHWYHEALKYTFGHGKLYYH 464

Query: 449 ISTVQQNPLEAFVNLGKSVFCFDTFIPSQRYMQLVIDNIYQRAFIERXXXXXXXXXXXXX 508
           +STVQQN L AFVNLGKSVFC DTFIPSQ+YMQLVIDNIYQRAF ER             
Sbjct: 465 MSTVQQNTLAAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAERN------------ 512

Query: 509 XXXXHFMTSSFAKNFQQRFLIEYLKHSEVMLLPNFLENDHLKTVVLNYFTNSFGKIAIQX 568
                      + + +   L+EYLKH+EVMLLP+FLE+  L+ VVL +F   FG      
Sbjct: 513 -----------SGHHRNAHLVEYLKHTEVMLLPSFLESSELQDVVLAFFEQKFG------ 555

Query: 569 XXXXXXXXXXXXXXXXXXXXXXQANIENINNGHNIPSSSNVITSESLQINAINLFNFRNI 628
                                                    +TS       ++ F+ R +
Sbjct: 556 -----------------------------------------VTSN------VDFFDPRLV 568

Query: 629 FKQKNSDILKYFFKNSATFAESHILQLIGFGDPKNPFALLFQLPKYLKE 677
           F Q +S+ LK+FF++++ +AESH+LQL+GFGDP+NPFALLF+LPK+LKE
Sbjct: 569 FVQ-DSERLKHFFRHASLYAESHLLQLVGFGDPRNPFALLFELPKHLKE 616

 Score =  214 bits (545), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 146/356 (41%), Positives = 192/356 (53%), Gaps = 66/356 (18%)

Query: 1150 FEKNSIQNTDLNCEPGLSLIENESLFEYEGYKRFIPDFSNFDKNGELISTSLYTSTIIDX 1209
            FE+ S  N D    P   +  +  +   +GY+  +PD+  F++NG++I+ SLYT   ++ 
Sbjct: 905  FEQISPVNLDQRATPYCGMTPDIDIRTLQGYRILLPDYYCFNRNGDMITGSLYTIGTLES 964

Query: 1210 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXGSNQNKESSNSTTNIDNKELFLMEKEIFNKI 1269
                                               +  N    ++N EL   E+  +N +
Sbjct: 965  SGI-----------------------------HGGDDFNGKRLLENGELVSTERRDYNSL 995

Query: 1270 LDPDYKNI------------DEIW-----RGEM--FHDTSIQFSDTYFVLDATSWLRHFA 1310
            +D + + I            D  W     RG++  F DT +    TYFVLDAT+WLRHF 
Sbjct: 996  IDREEQPIMDEFLRHTHCKNDVRWEQMLPRGDLHCFADTHV----TYFVLDATTWLRHFG 1051

Query: 1311 HVYKLATNGILKFAICLTTFQELRFLRKSKDENVMEAATRAIITLRQLYSEKRLLPLRFT 1370
            HVYKLA N ILKFAICLTTFQELRFLRKSKDE+V+EAATRA+IT+RQLY E++LLPLRFT
Sbjct: 1052 HVYKLAANNILKFAICLTTFQELRFLRKSKDESVLEAATRAVITVRQLYYERKLLPLRFT 1111

Query: 1371 GNIATHIEEHLEFEEQITWRSHVDEFVIEAIKRAQLKRRDNRNQEDXXXXXXXXXXXXXX 1430
            GN+A H+EEHLE EEQ+TWRSHVDEFVIEAI +AQ K   N   +D              
Sbjct: 1112 GNVAGHLEEHLEIEEQMTWRSHVDEFVIEAIHKAQDKF--NALNDDAKAASRDCIPTGAD 1169

Query: 1431 XXXXXXXXVTDMIFVLVTDDISMIKKRQEEKSDNDIITFSTKFVFSLCNMLVNKFN 1486
                           LVTDD++M  K        +I  FST+F+FS+CN L +  N
Sbjct: 1170 QRFN--------FIALVTDDLNMRNK----AGAQNIKAFSTRFMFSVCNELGHAKN 1213

 Score =  186 bits (471), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 83/216 (38%), Positives = 138/216 (63%), Gaps = 2/216 (0%)

Query: 787  SPQDFFNNLESLKLSFFLPNSLEIWNESLKYINIISLNCSIIVLKKFLNGPLFVSLPHML 846
            +P +FF  ++S K  +  P+ + IW ESL Y N+ ++ CS+IVL+KFL+GPL  +LPH+L
Sbjct: 646  APSEFFETIDSTKYIYKFPDDINIWKESLSYANVTAMKCSMIVLRKFLHGPLLTALPHLL 705

Query: 847  PWSYFIISLALRIESLENIESRIFWLQFIRKIFPWNSIVSYLNVIISVLLDNCYENSMIT 906
            PW YF+ +   R+ ++   E R FW+  +R++FP+N+I+++LNV++  + +    N    
Sbjct: 706  PWGYFLAATNSRVITIPQDEIRRFWVALVRQLFPFNTIITFLNVLLLYMNNQTQANFPFD 765

Query: 907  KLINNYSNKNLDELLVEFNENEYELPEVWKCYGSLWFDVIAENYQIYSRDCSKNISMKDT 966
            +    + + +L +L+  F ENE ELPEVW+C+G+LWFD +   +     D + +  +KD 
Sbjct: 766  EYFEQFIDMSLADLVGYFCENE-ELPEVWECWGTLWFDALNTKHITNLTDIN-STGVKDH 823

Query: 967  KCLNYPIDGLPFDEMEENGTNFWKRSCRLIFLFKTM 1002
              ++ PIDG+ FD  +E+G  FWKR  R+I LF+ +
Sbjct: 824  MFMDSPIDGISFDHNDESGEKFWKRCARVILLFRAL 859

>CAGL0G02541g Chr7 (231428..235315) [3888 bp, 1295 aa] {ON} similar
           to uniprot|P36168 Saccharomyces cerevisiae YKR096w
          Length = 1295

 Score =  429 bits (1103), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 220/404 (54%), Positives = 275/404 (68%), Gaps = 76/404 (18%)

Query: 269 LIQKLQNIYKLIVSQELELQDKCNKLSTSQSTKLKYLWSIYKLNHDLINNYILFILTSLS 328
           L+QKLQ+IYK IV QE+ELQ+KC +L++SQ+T L  +WSIY++N +L+ NY+ FI T+L 
Sbjct: 370 LVQKLQDIYKNIVRQEVELQEKCAQLTSSQTTDLNSIWSIYRINVELVTNYVTFISTALL 429

Query: 329 PSQSINDQLIGKEILEIYKIERRLWIYGTITFLDILKNFANFMDPEILSQFITHVFESIS 388
            SQS  D +IG+EI+E Y+I RRLW+YGTITFLD+LKNF++FMDPE+ SQFITHVF SIS
Sbjct: 430 SSQSQYDLMIGQEIVETYRIGRRLWVYGTITFLDVLKNFSSFMDPEVCSQFITHVFISIS 489

Query: 389 NMISDLPIDFINPWYQRLGDLSRMAIALYPSNFIDWKLSSEYWYIESMKFTFSHGKLYYH 448
            M++D+P  +  PW QRLGDLSRMAIALYPS FIDWKLSSEYWY +++K+T+ +GKLYYH
Sbjct: 490 TMLADIPTKYSIPWMQRLGDLSRMAIALYPSGFIDWKLSSEYWYNQALKYTYGYGKLYYH 549

Query: 449 ISTVQQNPLEAFVNLGKSVFCFDTFIPSQRYMQLVIDNIYQRAFIERXXXXXXXXXXXXX 508
           +ST+QQN LEAFVNLGKSVFC DTFIPS +YMQLVIDNIYQRAFIER             
Sbjct: 550 MSTIQQNTLEAFVNLGKSVFCQDTFIPSPQYMQLVIDNIYQRAFIER------------- 596

Query: 509 XXXXHFMTSSFAKNFQQRFLIEYLKHSEVMLLPNFLENDHLKTVVLNYFTNSFGKIAIQX 568
                   S+  +N Q   LIEYLKHSEVMLLPNF+ N++L+ VV+ YF + FG      
Sbjct: 597 -------GSNNTRNSQ---LIEYLKHSEVMLLPNFIGNENLQKVVMTYFEHKFGT----- 641

Query: 569 XXXXXXXXXXXXXXXXXXXXXXQANIENINNGHNIPSSSNVITSESLQINAINLFNFRNI 628
                                                           ++ +N+F  R+I
Sbjct: 642 -----------------------------------------------DLHDLNIFQPRDI 654

Query: 629 FKQKNSDILKYFFKNSATFAESHILQLIGFGDPKNPFALLFQLP 672
           F Q N + LKYFF+++  FAESHILQ +GFGD KNPFALLF LP
Sbjct: 655 FLQ-NPENLKYFFRHAPAFAESHILQTVGFGDSKNPFALLFDLP 697

 Score =  246 bits (629), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 117/255 (45%), Positives = 172/255 (67%), Gaps = 4/255 (1%)

Query: 786  LSPQDFFNNLESLKLSFFLPNSLEIWNESLKYINIISLNCSIIVLKKFLNGPLFVSLPHM 845
            +S   +F+NLES++  +  P   +IW +SL Y+N+ ++ C +IVL+KFL+GP  V+LPH+
Sbjct: 736  ISSDQYFSNLESMQHPYLPPPRYDIWLKSLSYLNLTAVQCGVIVLRKFLHGPFVVALPHL 795

Query: 846  LPWSYFIISLALRIESLENIESRIFWLQFIRKIFPWNSIVSYLNVIISVLLDNCYENSMI 905
            + W+YFIIS+ L+ E+L + ESR FW  F+R++ P NSIVS+LNV+I+  LDN Y +++I
Sbjct: 796  MVWTYFIISVCLKSETLVDEESRYFWSSFMRRLLPLNSIVSFLNVLIAYALDNSYYSTLI 855

Query: 906  TKLINNYSNKNLDELLVEFNENEYELPEVWKCYGSLWFDVIAENYQIYSRDCSKNISMKD 965
            + +     + +L ELL +FN NE ELPEVWKC+G+LWFD I +     +    K I + D
Sbjct: 856  SSISEELDSMDLQELLTKFNNNE-ELPEVWKCWGTLWFDAITDKSNTDTNSYEK-IGVSD 913

Query: 966  TKCLNYPIDGLPFDEMEENGTNFWKRSCRLIFLFKTMITRFNGFGGLTISSNTSVYCNRS 1025
                + PIDG+ FD  +ENG  FWKR+ R+IFLFK +   F+   G+T+S    VYC R 
Sbjct: 914  HLFFDSPIDGIVFDSKDENGEKFWKRALRIIFLFKKIAETFD--IGITLSHTAPVYCRRD 971

Query: 1026 DIPNNHILRTFAFKL 1040
            D+  NHIL +F+FK+
Sbjct: 972  DVELNHILGSFSFKI 986

 Score =  226 bits (577), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 145/325 (44%), Positives = 180/325 (55%), Gaps = 56/325 (17%)

Query: 1157 NTDLNCEPGLSLIENESLFEYEGYKRFIPDFSNFDKNGELISTSLYTSTIIDXXXXXXXX 1216
            N  ++  P +SL ENE++FEY GYKR  P+  NFDKNGEL S + YTS            
Sbjct: 1018 NITMDATPPMSLQENENIFEYTGYKRIAPELQNFDKNGELRSAANYTS------------ 1065

Query: 1217 XXXXXXXXXXXXXXXXXXXXXXGSNQNKESSNSTTNIDNKELFLMEKEIFNKILDPDYKN 1276
                                  GS+  +   +     +   +F  E+E    +LD     
Sbjct: 1066 --WYSAQEIVPKSAASPENSVAGSSPGRSFQSQDVEENIFSVFTNEEENSTSLLD----- 1118

Query: 1277 IDEIWRGEMFHDTSIQFSDTYFVLDATSWLRHFAHVYKLATNGILKFAICLTTFQELRFL 1336
                          +    T FVLDATSWLRH AH+YKLA+N  L F+ICLTTFQELRFL
Sbjct: 1119 -------------GLNLETTSFVLDATSWLRHSAHIYKLASNSFLVFSICLTTFQELRFL 1165

Query: 1337 RKSKDENVMEAATRAIITLRQLYSEKRLLPLRFTGNIATHIEEHLEFEEQITWRSHVDEF 1396
            RKSKDENVMEAA RAII +RQLYS+ +++PLRFTGNIATHIEEHLEFEEQITWRSHVDEF
Sbjct: 1166 RKSKDENVMEAAARAIIIIRQLYSDGKVIPLRFTGNIATHIEEHLEFEEQITWRSHVDEF 1225

Query: 1397 VIEAIKRAQLKRRDNRNQEDXXXXXXXXXXXXXXXXXXXXXXVTDMIFVLVTDDISMIKK 1456
            VIE+I +AQ K      Q                             FVLV+DD +M +K
Sbjct: 1226 VIESISKAQKKFLQPFVQNPVDNDSR--------------------FFVLVSDDENMKRK 1265

Query: 1457 RQEEKSDNDIITFSTKFVFSLCNML 1481
              E+    +I TF+T+FVF+LC+ +
Sbjct: 1266 AHEK----EIRTFTTRFVFALCSEM 1286

>KLLA0A00528g Chr1 complement(44587..48276) [3690 bp, 1229 aa] {ON}
           similar to uniprot|P36168 Saccharomyces cerevisiae
           YKR096W
          Length = 1229

 Score =  417 bits (1071), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 213/408 (52%), Positives = 273/408 (66%), Gaps = 77/408 (18%)

Query: 269 LIQKLQNIYKLIVSQELELQDKCNKLSTSQSTKLKYLWSIYKLNHDLINNYILFILTSLS 328
           L++KLQ IYK IV QE ELQ++C+ L+T Q+T LK LW  YK+N +LI+NYILFI T+L 
Sbjct: 284 LVEKLQEIYKSIVKQETELQERCSNLTTQQTTDLKNLWLAYKINAELIDNYILFITTALL 343

Query: 329 PSQSINDQLIGKEILEIYKIERRLWIYGTITFLDILKNFANFMDPEILSQFITHVFESIS 388
           PSQS +   IG+EI+++Y+IERRLW+YGTITFLD+LKNF+NFMDPE+  QFI +VF ++S
Sbjct: 344 PSQSESSLAIGQEIVDVYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFIAYVFIALS 403

Query: 389 NMISDLPIDFINPWYQRLGDLSRMAIALYPSNFIDWKLSSEYWYIESMKFTFSHGKLYYH 448
           NM+ DLP  +  PW +RLGDLSRMAIALYPS F+DWKLS+E+WY ES+KFTF HGKLYYH
Sbjct: 404 NMLEDLPPKYSIPWLERLGDLSRMAIALYPSGFVDWKLSAEHWYRESLKFTFGHGKLYYH 463

Query: 449 ISTVQQNPLEAFVNLGKSVFCFDTFIPSQRYMQLVIDNIYQRAFIERXXXXXXXXXXXXX 508
           +STVQQN LEAFVNLGKSVFC D F+PS +YMQLVIDNIYQRAF ER             
Sbjct: 464 MSTVQQNTLEAFVNLGKSVFCEDIFVPSPQYMQLVIDNIYQRAFAERD------------ 511

Query: 509 XXXXHFMTSSFAKNFQQRFLIEYLKHSEVMLLPNFLENDHLKTVVLNYFTNSFGKIAIQX 568
                      +   +   +++YLKH+EVMLLP+FLE+  L+ VV++YF + FG      
Sbjct: 512 -----------SSGNRTNHIVDYLKHTEVMLLPSFLESSELQNVVIHYFQHKFG------ 554

Query: 569 XXXXXXXXXXXXXXXXXXXXXXQANIENINNGHNIPSSSNVITSESLQINAINLFNFRNI 628
                                             + SS N              F+   I
Sbjct: 555 ----------------------------------VSSSGN-------------FFDPNLI 567

Query: 629 FKQKNSDILKYFFKNSATFAESHILQLIGFGDPKNPFALLFQLPKYLK 676
           F Q +++ LK+FF++S+ F++SHILQL GFGDPKNPFA+LF+L K+LK
Sbjct: 568 FIQ-DAERLKHFFRHSSLFSQSHILQLCGFGDPKNPFAMLFELSKHLK 614

 Score =  203 bits (516), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 143/355 (40%), Positives = 197/355 (55%), Gaps = 66/355 (18%)

Query: 1149 PFEKNSIQNTDLNCEPGL-----SLIENESLFEYEGYKRFIPDFSNFDKNGELISTSLYT 1203
            PFEK  I  ++LNC   L     S+I   S+   +G+K   PD+  F+KNG+LI+ SLYT
Sbjct: 910  PFEKFEII-SNLNCSDNLQDGSKSMIPGVSIENLQGFKLMYPDYFCFNKNGDLITASLYT 968

Query: 1204 STIIDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGSNQNKESSNSTTNIDNKELFL--- 1260
               ++                                 Q  +  N+   +DN  L +   
Sbjct: 969  KGPLETANI-----------------------------QGGDDFNANKILDNGRLVVQDR 999

Query: 1261 ---------MEKEIFNKILDPDYKNIDEIWRGEMFH-----DTSIQFSDTYFVLDATSWL 1306
                     +E+      ++PD++  + + R  + +     DT++    T+FVLDAT+WL
Sbjct: 1000 LEYSSAIDKLEQPWLEAFMNPDFRQRELLNRSFLGNLNCQADTNV----TFFVLDATTWL 1055

Query: 1307 RHFAHVYKLATNGILKFAICLTTFQELRFLRKSKDENVMEAATRAIITLRQLYSEKRLLP 1366
            RHFAH+YKLAT+ +LKFAICLTTFQELRFLRKSKDE+V+EAATRA+I +RQLY E++LL 
Sbjct: 1056 RHFAHIYKLATSSVLKFAICLTTFQELRFLRKSKDESVLEAATRAVIAVRQLYYERKLLA 1115

Query: 1367 LRFTGNIATHIEEHLEFEEQITWRSHVDEFVIEAIKRAQLKRRDNRNQEDXXXXXXXXXX 1426
            LRFTGN+A H+EEHLE EEQ+TW+SHVDEFVI+AI +AQ  + +  N +           
Sbjct: 1116 LRFTGNVAGHLEEHLEIEEQMTWKSHVDEFVIDAIAKAQ-DKFNVLNNDAIEKGKDCIPL 1174

Query: 1427 XXXXXXXXXXXXVTDMIFVLVTDDISMIKKRQEEKSDNDIITFSTKFVFSLCNML 1481
                        V+     LVTDD +M  K Q+      I TFST+FVF++C  L
Sbjct: 1175 SEDGQSTQRFNFVS-----LVTDDFNMRNKAQQL----GIRTFSTRFVFAICREL 1220

 Score =  181 bits (460), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 86/227 (37%), Positives = 143/227 (62%), Gaps = 6/227 (2%)

Query: 787  SPQDFFNNLESLKLSFFLPNSLEIWNESLKYINIISLNCSIIVLKKFLNGPLFVSLPHML 846
            S +DFF+ ++S K+ +  P  L +W  SL YIN+ S+ C +IVL++FL GP+  +LPH+L
Sbjct: 646  STEDFFSTIDSPKVPYEFPLDLGVWKRSLHYINVTSMKCGMIVLRRFLYGPIVTALPHVL 705

Query: 847  PWSYFIISLALRIESLENIESRIFWLQFIRKIFPWNSIVSYLNVIISVLLDNCYENSMIT 906
            PW  FIIS+ +R++ + ++  + FW+ FIR+IFPW+S+++++N +I   +    +N  I 
Sbjct: 706  PWLLFIISIQIRLDQVNDLTLKKFWIVFIRRIFPWDSLITFMNTLIHYCMVTGTKNFDID 765

Query: 907  KLINNYSNKNLDELLVEFNENEYELPEVWKCYGSLWFDVIAENYQIYSRDCSKNISMKDT 966
              ++ Y   N +ELL    ENE  LPE W C+GSLWF+ I++   +      ++  + DT
Sbjct: 766  AHMSTYLPMNREELLTSICENE-NLPECWSCWGSLWFNTISKKSDL-DVTTLESTGLSDT 823

Query: 967  KCLNYPIDGLPFDEMEENGTNFWKRSCRLIFLFKTMITRF---NGFG 1010
              L+ P +G+ FD+ +E G  +W+R CR + LF  +IT +   +G+G
Sbjct: 824  LFLDSPTEGICFDDDDEFGRKYWQRICRTLLLF-NIITEWEACDGYG 869

>Ecym_4015 Chr4 complement(34835..38608) [3774 bp, 1257 aa] {ON}
           similar to Ashbya gossypii AFR290W
          Length = 1257

 Score =  415 bits (1066), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 212/405 (52%), Positives = 267/405 (65%), Gaps = 77/405 (19%)

Query: 269 LIQKLQNIYKLIVSQELELQDKCNKLSTSQSTKLKYLWSIYKLNHDLINNYILFILTSLS 328
           L++KLQ IYK IV QE ELQ++C++L+TSQ+T LK LW IYKLN +LI+NY  FI T+L 
Sbjct: 323 LVEKLQEIYKNIVKQETELQERCSQLTTSQTTDLKNLWVIYKLNAELIDNYFTFITTALL 382

Query: 329 PSQSINDQLIGKEILEIYKIERRLWIYGTITFLDILKNFANFMDPEILSQFITHVFESIS 388
           P+Q   D LIG+EI+E+Y+IERRLW+YGTITFLD+LKNF+NFMDPE+  QFI +VF SIS
Sbjct: 383 PTQPKADLLIGQEIIEVYRIERRLWLYGTITFLDVLKNFSNFMDPEVCCQFIVYVFISIS 442

Query: 389 NMISDLPIDFINPWYQRLGDLSRMAIALYPSNFIDWKLSSEYWYIESMKFTFSHGKLYYH 448
           N++ ++P  F   W +RLGDLSRMAIALYPS FIDWKLS+E+WY E++K+ F HGKLYYH
Sbjct: 443 NILGNIPPTFSVIWLERLGDLSRMAIALYPSGFIDWKLSAEHWYQEALKYNFGHGKLYYH 502

Query: 449 ISTVQQNPLEAFVNLGKSVFCFDTFIPSQRYMQLVIDNIYQRAFIERXXXXXXXXXXXXX 508
           +STVQQN L AFVNLGKSVFC DTFIPSQ+YMQLVIDNIYQRAF ER             
Sbjct: 503 MSTVQQNTLAAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAERN------------ 550

Query: 509 XXXXHFMTSSFAKNFQQRFLIEYLKHSEVMLLPNFLENDHLKTVVLNYFTNSFGKIAIQX 568
                      + + +   ++EYLKH+EVMLLP+FLEN   + VVL +F   FG      
Sbjct: 551 -----------SGHHRYSHIVEYLKHTEVMLLPSFLENVESQGVVLAFFDQKFGATG--- 596

Query: 569 XXXXXXXXXXXXXXXXXXXXXXQANIENINNGHNIPSSSNVITSESLQINAINLFNFRNI 628
                                                             + N F+   I
Sbjct: 597 --------------------------------------------------SANFFDPSLI 606

Query: 629 FKQKNSDILKYFFKNSATFAESHILQLIGFGDPKNPFALLFQLPK 673
           F Q + + LK+FF++++ +AESHILQL+GFGDP+NPFALLF+LPK
Sbjct: 607 FVQ-DCERLKHFFRHASLYAESHILQLVGFGDPRNPFALLFELPK 650

 Score =  227 bits (578), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 153/353 (43%), Positives = 200/353 (56%), Gaps = 71/353 (20%)

Query: 1150 FEKNSIQNTDLNCEPGLSLIENESLFEYEGYKRFIPDFSNFDKNGELISTSLYTSTIIDX 1209
            FE  S  NTDL   P   ++    +   +GYK+ +PD+  F+KNG+LI+ SLYTS + + 
Sbjct: 942  FESISFVNTDLQSPPHKGMVLGTDIRTLQGYKQLVPDYLCFNKNGDLITGSLYTSGMSEG 1001

Query: 1210 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXGSNQNKESSNSTTNIDNKELFLM-EKEIFNK 1268
                                         G   + E   ST  +   EL +  E+  +N 
Sbjct: 1002 GS---------------------------GVPNDSEDFGSTKRLLENELLVTSERRDYNN 1034

Query: 1269 ILDPD------------YKNIDEIW-----RGEM--FHDTSIQFSDTYFVLDATSWLRHF 1309
            +LD +            Y + +  W     RG++  F DT +    TYFVLDAT+WLRHF
Sbjct: 1035 LLDKEETPIIDEFLKWRYSSTNSRWEQCLPRGDLQYFTDTHV----TYFVLDATTWLRHF 1090

Query: 1310 AHVYKLATNGILKFAICLTTFQELRFLRKSKDENVMEAATRAIITLRQLYSEKRLLPLRF 1369
             HVYKLAT+ +LKFAICLTTFQELRFLRKSKDE+V+EAATRA+IT+RQLY E++LLPLRF
Sbjct: 1091 GHVYKLATSNLLKFAICLTTFQELRFLRKSKDESVLEAATRAVITVRQLYYERKLLPLRF 1150

Query: 1370 TGNIATHIEEHLEFEEQITWRSHVDEFVIEAIKRAQLKRRDNRNQEDXXXXXXXXXXXXX 1429
            TGN+A H+EEHLE EEQ+TWRSHVDEFVIEAI +AQ K   N+  +D             
Sbjct: 1151 TGNVAGHLEEHLEIEEQMTWRSHVDEFVIEAIDKAQSKF--NQLNKD-----------AK 1197

Query: 1430 XXXXXXXXXVTDMIF---VLVTDDISMIKKRQEEKSDNDIITFSTKFVFSLCN 1479
                     + D  F    LVTDDI+M  K + +     I  FSTKF+F++C+
Sbjct: 1198 ASGRESITTIDDGKFNFIALVTDDINMRNKARAQS----IRAFSTKFMFAICH 1246

 Score =  200 bits (509), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 96/219 (43%), Positives = 140/219 (63%), Gaps = 2/219 (0%)

Query: 788  PQDFFNNLESLKLSFFLPNSLEIWNESLKYINIISLNCSIIVLKKFLNGPLFVSLPHMLP 847
            P  FF  L S K ++     L IW ESL Y+N  S+ CS++VL+KFLN  L  +LPH+LP
Sbjct: 684  PVQFFETLNSTKTAYRFSQDLNIWKESLNYVNKTSMRCSMVVLRKFLNSSLLTALPHLLP 743

Query: 848  WSYFIISLALRIESLENIESRIFWLQFIRKIFPWNSIVSYLNVIISVLLDNCYENSMITK 907
            W+YF++++ LR++++ N +S+ FW+ FIR+IFPW SI ++LNV++  + D       I +
Sbjct: 744  WAYFLVAVGLRLDAIRNEDSKRFWIVFIRQIFPWESITNFLNVLLLYINDQKPTKFPIDE 803

Query: 908  LINNYSNKNLDELLVEFNENEYELPEVWKCYGSLWFDVIAENYQIYSRDCSKNISMKDTK 967
             + NY N  L ELL  F ENE +LPEVW C+G+LWFDVI   +     D   +  +KD  
Sbjct: 804  YMANYINMPLPELLEYFCENE-DLPEVWNCWGTLWFDVINSKHVSNLVDI-HSTGVKDHM 861

Query: 968  CLNYPIDGLPFDEMEENGTNFWKRSCRLIFLFKTMITRF 1006
             L+ P+DG+ FD  +E+G  FWKR  R+I LF+ +  +F
Sbjct: 862  FLDAPVDGISFDHSDESGEKFWKRCVRVILLFRGIAYQF 900

>TPHA0E00190 Chr5 complement(20436..24521) [4086 bp, 1361 aa] {ON}
           Anc_5.706 YIL151C
          Length = 1361

 Score =  414 bits (1065), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 213/407 (52%), Positives = 276/407 (67%), Gaps = 72/407 (17%)

Query: 269 LIQKLQNIYKLIVSQELELQDKCNKLSTSQSTKLKYLWSIYKLNHDLINNYILFILTSLS 328
           L+QKLQ+IYK IV QE+ELQ++C +L+ SQ+T+LK LW+IY++N +L++NYI FI T++ 
Sbjct: 384 LVQKLQDIYKTIVKQEIELQERCGRLTNSQTTELKNLWTIYRVNSELVDNYITFITTAIH 443

Query: 329 PSQSINDQLIGKEILEIYKIERRLWIYGTITFLDILKNFANFMDPEILSQFITHVFESIS 388
           P+Q  +DQ IGKEI+EIYKIERRLW+YGTITFLD+LKNF+NFMDPE+  QFI HVF SIS
Sbjct: 444 PTQPESDQQIGKEIIEIYKIERRLWVYGTITFLDLLKNFSNFMDPEVCCQFIFHVFISIS 503

Query: 389 NMISDLPIDFINPWYQRLGDLSRMAIALYPSNFIDWKLSSEYWYIESMKFTFSHGKLYYH 448
           NM++D+P  +   WYQ+LGDLSRMAIALYPSNFIDWKLS+E WY+ +M+FT+ HGKLYYH
Sbjct: 504 NMLADIPQKYRVSWYQKLGDLSRMAIALYPSNFIDWKLSAERWYMAAMEFTYGHGKLYYH 563

Query: 449 ISTVQQNPLEAFVNLGKSVFCFDTFIPSQRYMQLVIDNIYQRAFIERXXXXXXXXXXXXX 508
           +STVQQN LEAFVNLGKS+FC +TF+PSQ+Y+QLVI NIYQRA+ +              
Sbjct: 564 MSTVQQNTLEAFVNLGKSLFCKNTFVPSQQYLQLVIGNIYQRAYADSN------------ 611

Query: 509 XXXXHFMTSSFAKNFQQRFLIEYLKHSEVMLLPNFLENDHLKTVVLNYFTNSFGKIAIQX 568
                   S+  +N Q   L++Y+KH EV LLPNF E+  L+ VVL YF + FG      
Sbjct: 612 -------NSNNGRNDQ--LLVDYIKHCEVTLLPNFKESQELQQVVLMYFIDKFGV----- 657

Query: 569 XXXXXXXXXXXXXXXXXXXXXXQANIENINNGHNIPSSSNVITSESLQINAINLFNFRNI 628
                                      + NN  N                  N+F  R +
Sbjct: 658 ---------------------------DYNNSSN------------------NMFISRKM 672

Query: 629 FKQKNSDILKYFFKNSATFAESHILQLIGFGDPKNPFALLFQLPKYL 675
           F Q N+D  K F++ SA FAES ILQ++G+G+ K+PF+LLF+LPKYL
Sbjct: 673 FVQ-NNDQFKCFYRYSAAFAESQILQIVGYGNLKSPFSLLFELPKYL 718

 Score =  284 bits (726), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 160/335 (47%), Positives = 200/335 (59%), Gaps = 37/335 (11%)

Query: 1150 FEKNSIQNTDLNCEPGLSLIENESLFEYEGYKRFIPDFSNFDKNGELISTSLYTSTIIDX 1209
            FE     N D +  P LS+++ +S+F+Y GYKR  P+F +FDKNG+ ISTS + S  I  
Sbjct: 1048 FETPDEVNYDTHKTPMLSMVDGDSIFDYVGYKRVCPNFYSFDKNGDFISTSFFNSWSI-- 1105

Query: 1210 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXGSNQNKESSNSTTNIDNKELFLMEKEIFNKI 1269
                                          S    +S+ ++TN D     L    +FN+ 
Sbjct: 1106 ---------KNLTNELSRNTCSSITDDAISSGSGNDSAAASTNNDPMNELL----VFNEC 1152

Query: 1270 LDPDYKNIDEIWRGEMFHDTSIQFS---DTYFVLDATSWLRHFAHVYKLATNGILKFAIC 1326
             DP YK ++E W  E++ D+    S    TYF+LDATSWLRHFAH+YK+AT+ ILKFAIC
Sbjct: 1153 FDPKYKTLEEFWSQEIYPDSQTNISLQGKTYFILDATSWLRHFAHIYKIATSKILKFAIC 1212

Query: 1327 LTTFQELRFLRKSKDENVMEAATRAIITLRQLYSEKRLLPLRFTGNIATHIEEHLEFEEQ 1386
            LTTFQELR+LRKSKD NV+EAATRAIITLRQLY E  LLPLRFTGN+ATHIEEHLEFEEQ
Sbjct: 1213 LTTFQELRYLRKSKDHNVVEAATRAIITLRQLYHENNLLPLRFTGNVATHIEEHLEFEEQ 1272

Query: 1387 ITWRSHVDEFVIEAIKRAQLKRRDNRNQEDXXXXXXXXXXXXXXXXXXXXXXVTDMIFVL 1446
            ITWRSHVDEFVIEA+ +A+ KR D  N  +                            +L
Sbjct: 1273 ITWRSHVDEFVIEAVLKAEEKRTDRLNDINMDTDEKEKSIFG---------------IIL 1317

Query: 1447 VTDDISMIKKRQEEKSDNDIITFSTKFVFSLCNML 1481
            VTDDI+M  K  + K    I TFST+F+FS+ N +
Sbjct: 1318 VTDDITMKNKAMDRK----IKTFSTRFIFSMANYI 1348

 Score =  255 bits (651), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 126/280 (45%), Positives = 181/280 (64%), Gaps = 18/280 (6%)

Query: 786  LSPQDFFNNLESLKLSFFLPNSLEIWNESLKYINIISLNCSIIVLKKFLNGPLFVSLPHM 845
            L+ ++FF N++++    F+PNS++IWN SL+Y N +S+ CS+IV KKFL+ P  ++LPH 
Sbjct: 762  LTAEEFFENIDTINYPSFMPNSVDIWNHSLQYANHVSIKCSMIVWKKFLHAPFMIALPHT 821

Query: 846  LPWSYFIISLALRIESLENIESRIFWLQFIRKIFPWNSIVSYLNVIISVLLDNCYENSMI 905
            LPW YFIIS+ L+++  +N+    FW++F+R+IFPWNSIV +LNV+++ ++DNC+E S++
Sbjct: 822  LPWCYFIISIVLQLDKHKNVAMNEFWVEFVRRIFPWNSIVKFLNVLLAYMVDNCWEQSIL 881

Query: 906  TKLINNYSNKNLDELLVEFNENEYELPEVWKCYGSLWFDVIAE-------------NYQI 952
             +L   Y++ +LDELL  FNENE ELPEVWKC GSLWFD I E             N   
Sbjct: 882  NELCPFYNSMSLDELLTYFNENE-ELPEVWKCRGSLWFDTIMEKSNLNKDKNPEVINGSD 940

Query: 953  YSRDCSKNISMKDTKCLNYPIDGLPFDEMEENGTNFWKRSCRLIFLFKTMITRFNGFGGL 1012
            ++ +  K   +KD K  ++PIDG  FDE +E G  FWKR+ R+IFLFK +   + G GGL
Sbjct: 941  FNINDYKGNGVKDYKFFDFPIDGTDFDESDEIGERFWKRAARVIFLFKKLAESYTGLGGL 1000

Query: 1013 TISSNTSVYCNRSD-IPNNHI---LRTFAFKLLPDDDNYM 1048
             +S    V+  R D    N +   L  F+FKL    D  M
Sbjct: 1001 ILSYEAPVFNRRKDEYKVNTVCQELLEFSFKLNASSDGVM 1040

>Skud_9.17 Chr9 complement(34389..37745) [3357 bp, 1118 aa] {ON}
           YIL151C (REAL)
          Length = 1118

 Score =  408 bits (1048), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 210/408 (51%), Positives = 272/408 (66%), Gaps = 69/408 (16%)

Query: 269 LIQKLQNIYKLIVSQELELQDKCNKLSTSQSTKLKYLWSIYKLNHDLINNYILFILTSLS 328
            I+KLQ IY++IV QE ELQ +C  L+TSQ+T+LK LW+IY+LN +LI NYI FI+T+L 
Sbjct: 207 FIKKLQEIYRIIVVQETELQQRCLFLTTSQTTELKSLWAIYRLNTELIKNYINFIITALL 266

Query: 329 PSQSINDQLIGKEILEIYKIERRLWIYGTITFLDILKNFANFMDPEILSQFITHVFESIS 388
            +Q IND ++G+EIL+IY+IE+RLW+YG ITFLD+LKNF+NFMDPE+  QFI + F S+S
Sbjct: 267 TTQPINDLIMGQEILDIYRIEKRLWVYGIITFLDVLKNFSNFMDPEVCCQFIIYAFISVS 326

Query: 389 NMISDLPIDFINPWYQRLGDLSRMAIALYPSNFIDWKLSSEYWYIESMKFTFSHGKLYYH 448
           +M+ D+P+ +   W QRLGDLSRMAI+LYPS FIDW+LS+EYWY ESMK+ +  GKLYYH
Sbjct: 327 SMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMKYIYGCGKLYYH 386

Query: 449 ISTVQQNPLEAFVNLGKSVFCFDTFIPSQRYMQLVIDNIYQRAFIERXXXXXXXXXXXXX 508
           I+TVQQN LEAFVNLGKSVFC D F PSQ+ +QL+I+NIYQ AFI+R             
Sbjct: 387 IATVQQNSLEAFVNLGKSVFCQDLFTPSQQTLQLLIENIYQSAFIDRSSAGTNN------ 440

Query: 509 XXXXHFMTSSFAKNFQQRFLIEYLKHSEVMLLPNFLENDHLKTVVLNYFTNSFGKIAIQX 568
                    +  +N Q   LI+YLKH+EVMLLP+FLEN  L+ VVL YF + FGK     
Sbjct: 441 -------NETAHRNSQ---LIDYLKHTEVMLLPSFLENMDLQHVVLMYFKDKFGK----- 485

Query: 569 XXXXXXXXXXXXXXXXXXXXXXQANIENINNGHNIPSSSNVITSESLQINAINLFNFRNI 628
                                                            N  ++F+ +++
Sbjct: 486 -----------------------------------------------DFNGNDIFDTKDM 498

Query: 629 FKQKNSDILKYFFKNSATFAESHILQLIGFGDPKNPFALLFQLPKYLK 676
           F Q N + L+Y+F+++  FAES +LQLIGFG+PKNPFALLFQLPKYLK
Sbjct: 499 FCQ-NPESLRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQLPKYLK 545

 Score =  209 bits (531), Expect = 6e-54,   Method: Compositional matrix adjust.
 Identities = 137/339 (40%), Positives = 181/339 (53%), Gaps = 87/339 (25%)

Query: 1151 EKNSIQNTDLNCEPGLSLIENESLFEYEGYKRFIPDFSNFDKNGELISTSLYT------- 1203
            EK    N DL   P LS++  E++FEY GY R  PD+  FDKNG   S  +Y+       
Sbjct: 842  EKIERVNRDLRATPNLSVVSGENIFEYTGYTRLTPDYHCFDKNGGFNSAFIYSQWSNVGN 901

Query: 1204 STIIDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGSNQNKESSNSTTNIDNKELFL-ME 1262
              ++D                                     SS S  +  N  L    E
Sbjct: 902  GMVLDV------------------------------------SSESMYDAANNNLSPHWE 925

Query: 1263 KEIFNKILDPDYKNIDEIWRGEMFHDTSIQFSDTYFVLDATSWLRHFAHVYKLATNGILK 1322
            K  F++I    +        G+   + S+ F     V+DATSWLRHFAH++KLA N ILK
Sbjct: 926  KIFFDRITTAGHN-------GDKNGNCSVYF-----VIDATSWLRHFAHIFKLAKNNILK 973

Query: 1323 FAICLTTFQELRFLRKSKDENVMEAATRAIITLRQLYSEKRLLPLRFTGNIATHIEEHLE 1382
            FAICLTTFQELR+LR SKD+NV+EAATR++IT+RQLY EK+++PLRFTGNIAT++EE+LE
Sbjct: 974  FAICLTTFQELRYLRGSKDDNVVEAATRSVITIRQLYDEKKIIPLRFTGNIATNVEENLE 1033

Query: 1383 FEEQITWRSHVDEFVIEAIKRA----QLKRRDNRNQEDXXXXXXXXXXXXXXXXXXXXXX 1438
            FEEQITW +HVDEFVI+AI +     Q +R  ++N+                        
Sbjct: 1034 FEEQITWETHVDEFVIDAIAKLNQNFQTERLIDKNKNK---------------------- 1071

Query: 1439 VTDMIFVLVTDDISMIKKRQEEKSDNDIITFSTKFVFSL 1477
              +   VLVTDD +M  K +    D  I T +TK++FSL
Sbjct: 1072 -NNAYAVLVTDDDNMDGKAK----DKMIKTCNTKYLFSL 1105

 Score =  198 bits (504), Expect = 8e-51,   Method: Compositional matrix adjust.
 Identities = 104/276 (37%), Positives = 168/276 (60%), Gaps = 11/276 (3%)

Query: 779  EDEMLDNLSPQDFFNNLESLKLSFF-LPNSLEIWNESLKYINIISLNCSIIVLKKFLNGP 837
             D   D +S + +F N++SL  +F  +P +L IW +SL +IN+ S+ CSI VL KFL+ P
Sbjct: 565  RDPFDDQISSESYFQNIDSLTSNFDDIPTNLNIWLDSLNHINMTSIQCSIHVLTKFLHAP 624

Query: 838  LFVSLPHMLPWSYFIISLALRIESLENIESRIFWLQFIRKIFPWNSIVSYLNVIISVLLD 897
            L V+LPH L W +FI+++  ++E++ +     FW+ F+R+  PWNS+V+  NV++  +LD
Sbjct: 625  LVVALPHFLTWLHFIVAILKKLETVNSKAVSGFWIHFLRRTMPWNSMVNLANVLVCYMLD 684

Query: 898  NCYENSMITKLINNYSNKNLDELLVEFNENEYELPEVWKCYGSLWFDVIAENYQIYSRDC 957
            N +    + + +  + +  LD+L+  FNENE  LPE+WKC+GSLWFD I +       D 
Sbjct: 685  NIH--PFLERELERFYSLELDDLIEYFNENE-NLPEIWKCWGSLWFDAIKKC------DV 735

Query: 958  SKNISMKDTKCLNYPIDGLPFDEMEENGTNFWKRSCRLIFLFKTMITRFNGFGGLTISSN 1017
             +   ++D    + P+DG+ FDE +E G  FW RS R I + K +  +F    GL ++  
Sbjct: 736  MEIPGVQDHLFFDSPLDGIVFDEKDEIGERFWIRSIRTILILKGVAKKFPDL-GLKVNFQ 794

Query: 1018 TSVYCNRSDIPNNHILRTFAFKLLPDDDNYMNNSNK 1053
              V+C R+DI  ++ L+ F FKL   ++N  N++N+
Sbjct: 795  APVFCRRNDISPDYFLKNFTFKLDEYEENDHNDNNE 830

>YIL151C Chr9 complement(57338..60694) [3357 bp, 1118 aa] {ON}
           Putative protein of unknown function, predicted to
           contain a PINc domain
          Length = 1118

 Score =  407 bits (1045), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 210/406 (51%), Positives = 269/406 (66%), Gaps = 69/406 (16%)

Query: 269 LIQKLQNIYKLIVSQELELQDKCNKLSTSQSTKLKYLWSIYKLNHDLINNYILFILTSLS 328
            I+KLQ IYK+IV QE ELQ +C  L+TSQ+T+LK LW+IY+LN +LI NYI FI+T+L 
Sbjct: 207 FIKKLQEIYKIIVVQETELQQRCLYLTTSQTTELKSLWAIYRLNTELIKNYINFIITALL 266

Query: 329 PSQSINDQLIGKEILEIYKIERRLWIYGTITFLDILKNFANFMDPEILSQFITHVFESIS 388
            +Q IND ++G+EIL+IY+IE+RLW+YG ITFLD+LKNF+NFMDPE+  QFI + F S+S
Sbjct: 267 TTQPINDLIMGQEILDIYRIEKRLWVYGIITFLDVLKNFSNFMDPEVCCQFIIYAFISVS 326

Query: 389 NMISDLPIDFINPWYQRLGDLSRMAIALYPSNFIDWKLSSEYWYIESMKFTFSHGKLYYH 448
           NM+ D+P+ +   W QRLGDLSRMAI+LYPS FIDW+LS+EYWY ESMK+ +  GKLYYH
Sbjct: 327 NMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMKYIYGCGKLYYH 386

Query: 449 ISTVQQNPLEAFVNLGKSVFCFDTFIPSQRYMQLVIDNIYQRAFIERXXXXXXXXXXXXX 508
           I+TVQQN LEAFVNLGKSVFC D F PSQ+ +QL+I+NIYQ AFI+R             
Sbjct: 387 IATVQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIENIYQSAFIDRSSGSANNNEIAH- 445

Query: 509 XXXXHFMTSSFAKNFQQRFLIEYLKHSEVMLLPNFLENDHLKTVVLNYFTNSFGKIAIQX 568
                       +N Q   LI+YLKH+EVMLLP+FLEN  L+ VVL YF + FGK     
Sbjct: 446 ------------RNSQ---LIDYLKHTEVMLLPSFLENMDLQHVVLMYFKDKFGK----- 485

Query: 569 XXXXXXXXXXXXXXXXXXXXXXQANIENINNGHNIPSSSNVITSESLQINAINLFNFRNI 628
                                                            N  ++F+ +++
Sbjct: 486 -----------------------------------------------DFNGNDVFDTKDM 498

Query: 629 FKQKNSDILKYFFKNSATFAESHILQLIGFGDPKNPFALLFQLPKY 674
           F Q N + L+Y+F+++  FAES +LQLIGFG+PKNPFALLFQLPKY
Sbjct: 499 FCQ-NPESLRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQLPKY 543

 Score =  218 bits (555), Expect = 7e-57,   Method: Compositional matrix adjust.
 Identities = 135/330 (40%), Positives = 179/330 (54%), Gaps = 73/330 (22%)

Query: 1157 NTDLNCEPGLSLIENESLFEYEGYKRFIPDFSNFDKNGELISTSLYTSTIIDXXXXXXXX 1216
            N D    P LS++  ES+FEY GY R  PD+  FDKNG   S  +Y+             
Sbjct: 848  NMDPQATPNLSVVSGESIFEYTGYTRLAPDYHCFDKNGGFNSAFIYSQ------------ 895

Query: 1217 XXXXXXXXXXXXXXXXXXXXXXGSNQNKE-SSNSTTNIDNKELFLMEKEIFNKILDPDYK 1275
                                  G+    + S  S  ++ N  L L  ++IF   +    K
Sbjct: 896  ------------------WSNVGNGVTLDVSGESIYDVANNNLSLHWEKIFFDKIAAASK 937

Query: 1276 NIDEIWRGEMFHDTSIQFSDTYFVLDATSWLRHFAHVYKLATNGILKFAICLTTFQELRF 1335
              DE +   +           YFV+DATSWLRHFAH++KLA N  LKFAICLTTFQELR+
Sbjct: 938  GSDENYNCTL-----------YFVIDATSWLRHFAHIFKLAKNNTLKFAICLTTFQELRY 986

Query: 1336 LRKSKDENVMEAATRAIITLRQLYSEKRLLPLRFTGNIATHIEEHLEFEEQITWRSHVDE 1395
            LR SKD+ V+EAATR++IT+RQLY EK+++P+RFTGNIATH+EE+LEFEEQITW++HVDE
Sbjct: 987  LRGSKDDTVVEAATRSVITIRQLYDEKKIIPMRFTGNIATHVEENLEFEEQITWKTHVDE 1046

Query: 1396 FVIEAI----KRAQLKRRDNRNQEDXXXXXXXXXXXXXXXXXXXXXXVTDMIFVLVTDDI 1451
            FVI+AI    +R Q +R  + N+                              VLVTDD 
Sbjct: 1047 FVIDAIAKLNQRFQAERLTDENKNKGKEFA-----------------------VLVTDDD 1083

Query: 1452 SMIKKRQEEKSDNDIITFSTKFVFSLCNML 1481
            +M +K +    D  I T +TK++FSL + L
Sbjct: 1084 NMNQKAK----DRMIKTCNTKYLFSLGSKL 1109

 Score =  206 bits (523), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 106/267 (39%), Positives = 166/267 (62%), Gaps = 12/267 (4%)

Query: 786  LSPQDFFNNLESLKLSF-FLPNSLEIWNESLKYINIISLNCSIIVLKKFLNGPLFVSLPH 844
            +S + +F N+++L  SF  +P +L IW +SL +IN+ S+ CSI VL KFL+ PL V+LPH
Sbjct: 572  ISSESYFQNIDALNSSFNDIPTNLNIWLDSLNHINMTSIQCSIHVLTKFLHAPLVVALPH 631

Query: 845  MLPWSYFIISLALRIESLENIESRIFWLQFIRKIFPWNSIVSYLNVIISVLLDNCYENSM 904
             L W +FI+++  ++E + + +   FW+ F+R+  PWNSIV+  NV++  +LDN +    
Sbjct: 632  FLTWLHFIVAILKKLEMVNSKQVVAFWIHFLRRTMPWNSIVTLGNVLVCYMLDNLH--PF 689

Query: 905  ITKLINNYSNKNLDELLVEFNENEYELPEVWKCYGSLWFDVIAENYQIYSRDCSKNISMK 964
            + K +  + +  LD+L+  +NENE  LPE+WKC+G+LWFD I +       D  +   ++
Sbjct: 690  LKKELEKFYSLELDDLIEYYNENE-NLPEIWKCWGTLWFDAIKKC------DVMEIPGVQ 742

Query: 965  DTKCLNYPIDGLPFDEMEENGTNFWKRSCRLIFLFKTMITRFNGFGGLTISSNTSVYCNR 1024
            D    + P+DG+ FDE +E G  FW RS R + L K +  +F    GL +S   SV+C R
Sbjct: 743  DHLFFDSPLDGIVFDEKDEVGEKFWMRSVRAVLLLKGIAKKFPDL-GLKVSFQASVFCRR 801

Query: 1025 SDIPNNHILRTFAFKL-LPDDDNYMNN 1050
            +DIP ++ L+   FKL   D+DNY +N
Sbjct: 802  NDIPPDYFLKNLTFKLDAYDEDNYNDN 828

>Smik_9.18 Chr9 complement(34956..38312) [3357 bp, 1118 aa] {ON}
           YIL151C (REAL)
          Length = 1118

 Score =  407 bits (1045), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 211/406 (51%), Positives = 269/406 (66%), Gaps = 69/406 (16%)

Query: 269 LIQKLQNIYKLIVSQELELQDKCNKLSTSQSTKLKYLWSIYKLNHDLINNYILFILTSLS 328
            I+KLQ IYK+IV QE ELQ +C  L+TSQ+T+LK LW+IY+LN +LI NYI FI+T+L 
Sbjct: 207 FIKKLQEIYKIIVVQETELQQRCLYLTTSQTTELKSLWAIYRLNTELIKNYINFIITALL 266

Query: 329 PSQSINDQLIGKEILEIYKIERRLWIYGTITFLDILKNFANFMDPEILSQFITHVFESIS 388
            +Q IND ++G+EIL+IY +E+RLW+YG ITFLD+LKNF+NFMDPE+  QFI + F S+S
Sbjct: 267 TTQPINDLIMGQEILDIYGMEKRLWVYGIITFLDVLKNFSNFMDPEVCCQFIIYAFISVS 326

Query: 389 NMISDLPIDFINPWYQRLGDLSRMAIALYPSNFIDWKLSSEYWYIESMKFTFSHGKLYYH 448
           NM+ D+P+ +   W QRLGDLSRMAI+LYPS FIDW+LS+EYWY ESMK+ +  GKLYYH
Sbjct: 327 NMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMKYIYGCGKLYYH 386

Query: 449 ISTVQQNPLEAFVNLGKSVFCFDTFIPSQRYMQLVIDNIYQRAFIERXXXXXXXXXXXXX 508
           I+TVQQN LEAFVNLGKSVFC D F PSQ+ +QL+I+NIYQ AFI+R             
Sbjct: 387 IATVQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIENIYQSAFIDRGSSGTNN------ 440

Query: 509 XXXXHFMTSSFAKNFQQRFLIEYLKHSEVMLLPNFLENDHLKTVVLNYFTNSFGKIAIQX 568
                    +  KN Q   LI+YLKH+EVMLLP+FLEN  L+ VVL YF N FGK     
Sbjct: 441 -------NETAHKNSQ---LIDYLKHTEVMLLPSFLENMDLQHVVLMYFKNKFGK----- 485

Query: 569 XXXXXXXXXXXXXXXXXXXXXXQANIENINNGHNIPSSSNVITSESLQINAINLFNFRNI 628
                                                            N  ++F+ +++
Sbjct: 486 -----------------------------------------------DFNGNDVFDTKDM 498

Query: 629 FKQKNSDILKYFFKNSATFAESHILQLIGFGDPKNPFALLFQLPKY 674
           F Q N + L+Y+F+++  FAES +LQLIGFG+PKNPFALLFQLPKY
Sbjct: 499 FCQ-NPESLRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQLPKY 543

 Score =  222 bits (565), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 139/332 (41%), Positives = 185/332 (55%), Gaps = 77/332 (23%)

Query: 1157 NTDLNCEPGLSLIENESLFEYEGYKRFIPDFSNFDKNGELISTSLYTSTIIDXXXXXXXX 1216
            N DL   P LS++  ES+FEY GY R  PD+  FDKNG   S  +Y+             
Sbjct: 848  NLDLRATPNLSVVFGESIFEYTGYTRLAPDYHCFDKNGGFNSAFIYSQ------------ 895

Query: 1217 XXXXXXXXXXXXXXXXXXXXXXGSNQNKESSNSTT-NIDNKELFLMEKEIFNKILDPDYK 1275
                                  G+    + SN    ++ + +L L  ++IF   +   YK
Sbjct: 896  ------------------WSNVGNGVPIDVSNEPIYDVTDNDLSLHWEKIFFDRIAAAYK 937

Query: 1276 NIDEIWRGEMFHDTSIQFSDTYFVLDATSWLRHFAHVYKLATNGILKFAICLTTFQELRF 1335
            N DE       +D        YFV+DATSWLRHFAH++KLA N IL FAICLTTFQELR+
Sbjct: 938  NCDE-------NDNCT----IYFVVDATSWLRHFAHIFKLAKNSILDFAICLTTFQELRY 986

Query: 1336 LRKSKDENVMEAATRAIITLRQLYSEKRLLPLRFTGNIATHIEEHLEFEEQITWRSHVDE 1395
            LR SKD+NV+EAATR++IT+RQLY E++++P+RFTGNIATH+EE+LEFEEQITW++HVDE
Sbjct: 987  LRGSKDDNVVEAATRSVITIRQLYDERKIIPMRFTGNIATHVEENLEFEEQITWKTHVDE 1046

Query: 1396 FVIEAIKRA----QLKR--RDNRNQEDXXXXXXXXXXXXXXXXXXXXXXVTDMIFVLVTD 1449
            FVI+AI +     Q +R   +N+N+                              VLVTD
Sbjct: 1047 FVIDAIAKLNQNFQTERMIAENKNK-------------------------NKQFAVLVTD 1081

Query: 1450 DISMIKKRQEEKSDNDIITFSTKFVFSLCNML 1481
            D +M KK +    D  I T +TK++FSL + L
Sbjct: 1082 DDNMNKKAK----DKMIKTCNTKYLFSLGSKL 1109

 Score =  211 bits (536), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 106/263 (40%), Positives = 162/263 (61%), Gaps = 11/263 (4%)

Query: 779  EDEMLDNLSPQDFFNNLESLKLSFF-LPNSLEIWNESLKYINIISLNCSIIVLKKFLNGP 837
             D   D  SP+ +F N+++L  +F  +P +L IW ESL +IN+ S+ CSI VL KFL+ P
Sbjct: 565  RDPFHDKKSPESYFQNIDALSSNFDDIPTNLNIWLESLNHINMTSIQCSIHVLTKFLHAP 624

Query: 838  LFVSLPHMLPWSYFIISLALRIESLENIESRIFWLQFIRKIFPWNSIVSYLNVIISVLLD 897
              ++LPH L W YF++++  R+E++ + +   FW+ F+R+  PWNS+VS  NV++  +LD
Sbjct: 625  FVIALPHFLTWLYFLVAILKRLETINSKQVIAFWIHFLRRTMPWNSMVSLANVLVCYMLD 684

Query: 898  NCYENSMITKLINNYSNKNLDELLVEFNENEYELPEVWKCYGSLWFDVIAENYQIYSRDC 957
            N +    + K + ++ +  LD+L+  FNENE  LPE+WKC+GSLWFD I +       D 
Sbjct: 685  NLH--PFLKKELESFYSFELDDLIEHFNENE-NLPEIWKCWGSLWFDAIKKC------DV 735

Query: 958  SKNISMKDTKCLNYPIDGLPFDEMEENGTNFWKRSCRLIFLFKTMITRFNGFGGLTISSN 1017
             +   ++D    + P+DG+ FDE +E G  FW RS R I L K +  +F    GL ++  
Sbjct: 736  MEIPGVQDHLFFDSPLDGIVFDEKDEIGERFWVRSVRAISLLKGIAKKFPDL-GLKVNFQ 794

Query: 1018 TSVYCNRSDIPNNHILRTFAFKL 1040
              V+C R+DIP ++ LR F FKL
Sbjct: 795  APVFCRRNDIPQDYFLRKFTFKL 817

>Suva_9.37 Chr9 complement(51993..55343) [3351 bp, 1117 aa] {ON}
           YIL151C (REAL)
          Length = 1117

 Score =  407 bits (1045), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 211/407 (51%), Positives = 271/407 (66%), Gaps = 69/407 (16%)

Query: 269 LIQKLQNIYKLIVSQELELQDKCNKLSTSQSTKLKYLWSIYKLNHDLINNYILFILTSLS 328
            I+KLQ IYK+IV QE ELQ +C  L+TSQ+T+LK LW+IYKLN +LI NYI FI+T+L 
Sbjct: 206 FIKKLQEIYKIIVVQETELQQRCLYLTTSQTTELKSLWAIYKLNTELIKNYINFIITALL 265

Query: 329 PSQSINDQLIGKEILEIYKIERRLWIYGTITFLDILKNFANFMDPEILSQFITHVFESIS 388
            +Q IND ++G+EIL+IY+IE+RLW+YG ITFLD+LK+F+NFMDPE+  QFIT+ F  IS
Sbjct: 266 TTQPINDLIMGQEILDIYRIEKRLWVYGIITFLDVLKSFSNFMDPEVCCQFITYAFICIS 325

Query: 389 NMISDLPIDFINPWYQRLGDLSRMAIALYPSNFIDWKLSSEYWYIESMKFTFSHGKLYYH 448
           NM+ D+P+ +   W QRLGDLSRMAI+LYPS FIDW+LS+EYWY ESMK+ +  GKLYYH
Sbjct: 326 NMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMKYIYGCGKLYYH 385

Query: 449 ISTVQQNPLEAFVNLGKSVFCFDTFIPSQRYMQLVIDNIYQRAFIERXXXXXXXXXXXXX 508
           I+T+QQN LEAFVNLGKSVFC D F PSQ+ +QL+I+NIYQ AFI+R             
Sbjct: 386 IATIQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIENIYQSAFIDRSSGNTNN------ 439

Query: 509 XXXXHFMTSSFAKNFQQRFLIEYLKHSEVMLLPNFLENDHLKTVVLNYFTNSFGKIAIQX 568
                    +  +N Q   LI+YLKH+EVMLLP+FLEN  L+ VVL YF + FGK     
Sbjct: 440 -------NETAHRNSQ---LIDYLKHTEVMLLPSFLENLDLQHVVLLYFKDKFGK----- 484

Query: 569 XXXXXXXXXXXXXXXXXXXXXXQANIENINNGHNIPSSSNVITSESLQINAINLFNFRNI 628
                                                            N  ++F+ +++
Sbjct: 485 -----------------------------------------------DFNGNDVFSTKDM 497

Query: 629 FKQKNSDILKYFFKNSATFAESHILQLIGFGDPKNPFALLFQLPKYL 675
           F Q N + L+Y+F+++  FAES ILQLIGFG+PKNPFALLFQLPK+L
Sbjct: 498 FCQ-NPESLRYYFRHAPAFAESQILQLIGFGNPKNPFALLFQLPKHL 543

 Score =  218 bits (555), Expect = 7e-57,   Method: Compositional matrix adjust.
 Identities = 138/329 (41%), Positives = 180/329 (54%), Gaps = 71/329 (21%)

Query: 1157 NTDLNCEPGLSLIENESLFEYEGYKRFIPDFSNFDKNGELISTSLYTSTIIDXXXXXXXX 1216
            N DL   P LS++  ES+FEY GY R   D+  FDKNG   S  +YT             
Sbjct: 847  NIDLQATPKLSVVSGESIFEYTGYTRLTQDYHCFDKNGGFNSAFIYTQ------------ 894

Query: 1217 XXXXXXXXXXXXXXXXXXXXXXGSNQNKESSNSTTNIDNKELFLMEKEIFNKILDPDYKN 1276
                                  G   +  S +   +  N       K +F+K+     KN
Sbjct: 895  ----------------WSNVGNGVTLDVSSESLYDSTTNDLSLHWAKILFDKVFTIG-KN 937

Query: 1277 IDEIWRGEMFHDTSIQFSDTYFVLDATSWLRHFAHVYKLATNGILKFAICLTTFQELRFL 1336
             D+        D S      YFV+DATSWLRHFAH++KLA N ILKFAICLTTFQELR+L
Sbjct: 938  TDD--------DGS---CSVYFVIDATSWLRHFAHIFKLAKNNILKFAICLTTFQELRYL 986

Query: 1337 RKSKDENVMEAATRAIITLRQLYSEKRLLPLRFTGNIATHIEEHLEFEEQITWRSHVDEF 1396
            R SKD+NV+EAATR++IT+RQLY EK+++P+RFTGNIATHIEE+LEFEEQITW++HVDEF
Sbjct: 987  RGSKDDNVVEAATRSVITIRQLYDEKKIIPMRFTGNIATHIEENLEFEEQITWKTHVDEF 1046

Query: 1397 VIEAIKRA----QLKRRDNRNQEDXXXXXXXXXXXXXXXXXXXXXXVTDMIFVLVTDDIS 1452
            VI+AI +     Q +R  ++N+                         +    VLVTDD +
Sbjct: 1047 VIDAIAKLNQNFQTERTIDKNKGR-----------------------SKEFAVLVTDDDN 1083

Query: 1453 MIKKRQEEKSDNDIITFSTKFVFSLCNML 1481
            M +K +    D  I T +TK++FSL + L
Sbjct: 1084 MNQKAK----DKMIKTCNTKYLFSLGSKL 1108

 Score =  199 bits (507), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 104/276 (37%), Positives = 167/276 (60%), Gaps = 11/276 (3%)

Query: 779  EDEMLDNLSPQDFFNNLESLKLSF-FLPNSLEIWNESLKYINIISLNCSIIVLKKFLNGP 837
             D   D  S + +F N+++L   F   P ++ IW +SL YIN+ S+ CSI VL KFL+ P
Sbjct: 564  RDPFDDQGSSESYFQNIDTLNSDFNDPPTNIGIWLDSLNYINMTSIQCSIQVLTKFLHAP 623

Query: 838  LFVSLPHMLPWSYFIISLALRIESLENIESRIFWLQFIRKIFPWNSIVSYLNVIISVLLD 897
            L V+LPH L W +FII++  ++E++ + +   FW+ F+R+  PWNS+V++ NV++  +LD
Sbjct: 624  LAVALPHFLIWLHFIIAVLKKLETINSEQVTAFWIHFLRRTMPWNSMVTFSNVLVCYMLD 683

Query: 898  NCYENSMITKLINNYSNKNLDELLVEFNENEYELPEVWKCYGSLWFDVIAENYQIYSRDC 957
            N +    + K +  + +  LD+L+  FNENE  LPEVWKC+GSLWFD + +       D 
Sbjct: 684  NLH--PFLEKQLEKFYSLELDDLIEYFNENE-NLPEVWKCWGSLWFDAVKKC------DV 734

Query: 958  SKNISMKDTKCLNYPIDGLPFDEMEENGTNFWKRSCRLIFLFKTMITRFNGFGGLTISSN 1017
             +   ++D    + P+DG+ FD+ +E G  FW RS R I   K +  +F    GL ++  
Sbjct: 735  MEIPGVQDHLFFDSPLDGIVFDKKDEIGEKFWIRSVRTILTLKGIAKKFPDL-GLKVNFQ 793

Query: 1018 TSVYCNRSDIPNNHILRTFAFKLLPDDDNYMNNSNK 1053
             SV+C R+DI  ++ L+   FKL P +++  N++N+
Sbjct: 794  ASVFCRRNDISPDYFLKNLTFKLDPYEEDAFNDNNE 829

>SAKL0E15004g Chr5 (1246544..1250134) [3591 bp, 1196 aa] {ON}
           similar to uniprot|P36168 Saccharomyces cerevisiae
           YKR096W Hypothetical ORF
          Length = 1196

 Score =  390 bits (1003), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 185/294 (62%), Positives = 230/294 (78%), Gaps = 23/294 (7%)

Query: 269 LIQKLQNIYKLIVSQELELQDKCNKLSTSQSTKLKYLWSIYKLNHDLINNYILFILTSLS 328
           L+QKLQ+IY+ IV QE+ELQ++C++L+ SQ+T +K LW IYK+N +LINNYI FI T+L 
Sbjct: 246 LVQKLQDIYRSIVKQEIELQERCSQLTNSQTTDMKNLWVIYKVNAELINNYISFITTALL 305

Query: 329 PSQSINDQLIGKEILEIYKIERRLWIYGTITFLDILKNFANFMDPEILSQFITHVFESIS 388
           PSQ   D LIG+EI+EIY++ERRLW+YGTITFLD+LKNF+NFMDPE+  QFI+HVF SIS
Sbjct: 306 PSQPEQDLLIGQEIVEIYRVERRLWVYGTITFLDVLKNFSNFMDPEVCCQFISHVFMSIS 365

Query: 389 NMISDLPIDFINPWYQRLGDLSRMAIALYPSNFIDWKLSSEYWYIESMKFTFSHGKLYYH 448
           NM+ D+P  +  PW +RLGDLSRMAIALYPS FIDWKLS+E+WY +++ +T+ HGKLYYH
Sbjct: 366 NMLGDVPPRYSIPWLERLGDLSRMAIALYPSGFIDWKLSAEHWYSQALIYTYGHGKLYYH 425

Query: 449 ISTVQQNPLEAFVNLGKSVFCFDTFIPSQRYMQLVIDNIYQRAFIERXXXXXXXXXXXXX 508
           +STVQQN LEAFVNLGKSVFC DTFIPSQ+YMQLVIDNIYQRAF ER             
Sbjct: 426 MSTVQQNTLEAFVNLGKSVFCQDTFIPSQQYMQLVIDNIYQRAFAER------------- 472

Query: 509 XXXXHFMTSSFAKNFQQRFLIEYLKHSEVMLLPNFLENDHLKTVVLNYFTNSFG 562
                  +   ++NF    ++EYLKHSEVMLLP+FLE+  L+ VVL +F   FG
Sbjct: 473 -------SGGSSRNFP---IVEYLKHSEVMLLPSFLESPELQKVVLTFFQQRFG 516

 Score =  238 bits (606), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 152/342 (44%), Positives = 195/342 (57%), Gaps = 41/342 (11%)

Query: 1150 FEKNSIQNTDLNCEPGLSLIENESLFEYEGYKRFIPDFSNFDKNGELISTSLYTSTIIDX 1209
            FE  S  N++    P LS+I+ ES+FE++GY+R  PD+  F+KNG+LI+ SLYTS +++ 
Sbjct: 877  FEPISPINSNFEAVPSLSMIDGESIFEFQGYRRMYPDYYCFNKNGDLITGSLYTSGLLER 936

Query: 1210 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXGSNQNKESSNSTTNIDNKELFLMEKEIFNKI 1269
                                          + +  E+           +   E++  N  
Sbjct: 937  VAIQGGDDFNVKRHVENGVLLAAHNSPVDCNERTPETM----------VEYAERKWLNMC 986

Query: 1270 LDPDYKNIDEIWRGEMFHDTSIQFSD---------TYFVLDATSWLRHFAHVYKLATNGI 1320
            +DP +         E   D+     D         TYFVLDATSWLRHFAHVYKLATN +
Sbjct: 987  MDPAFM--------ESLRDSRFPHGDLACNADSNVTYFVLDATSWLRHFAHVYKLATNNV 1038

Query: 1321 LKFAICLTTFQELRFLRKSKDENVMEAATRAIITLRQLYSEKRLLPLRFTGNIATHIEEH 1380
            LKFAICLTTFQELRFLRKSKDE+V+EAATRA+IT RQLY E++LLPLRFTGNIATH+EEH
Sbjct: 1039 LKFAICLTTFQELRFLRKSKDESVVEAATRAVITARQLYYERKLLPLRFTGNIATHLEEH 1098

Query: 1381 LEFEEQITWRSHVDEFVIEAIKRAQLKRRD-NRNQEDXXXXXXXXXXXXXXXXXXXXXXV 1439
            LEFEEQITWRSHVDEFVIEA+ ++Q K +  N    D                       
Sbjct: 1099 LEFEEQITWRSHVDEFVIEAVYKSQRKFKGLNLQARDQGQEYIPTDPKDDDKFN------ 1152

Query: 1440 TDMIFVLVTDDISMIKKRQEEKSDNDIITFSTKFVFSLCNML 1481
                 VLVTDD++M  K +     +DI  FS++F+F+ CN L
Sbjct: 1153 ---FVVLVTDDLNMRTKAEA----HDIHIFSSRFMFAFCNQL 1187

 Score =  231 bits (589), Expect = 6e-61,   Method: Compositional matrix adjust.
 Identities = 109/263 (41%), Positives = 174/263 (66%), Gaps = 6/263 (2%)

Query: 778  DEDEMLDNLSPQDFFNNLESLKLSFFLPNSLEIWNESLKYINIISLNCSIIVLKKFLNGP 837
            D+     ++S   +F N++S ++ +  P  ++IW +SL Y+N+ S+ CS+ VLKKFL+ P
Sbjct: 599  DDGNGSSSISVDHYFENIDSHRVPYSFPQDIQIWQQSLSYLNLTSMECSMSVLKKFLHAP 658

Query: 838  LFVSLPHMLPWSYFIISLALRIESLENIESRIFWLQFIRKIFPWNSIVSYLNVIISVLLD 897
            L  +LPH+LPW++F++S+A+RI SL +   + FWL F+R+IFPWNS+VS+LN +++ LLD
Sbjct: 659  LLTALPHLLPWAHFLVSVAIRISSLSSDALKKFWLVFMRRIFPWNSLVSFLNTLMAFLLD 718

Query: 898  NCYENSMITKLINNYSNKNLDELLVEFNENEYELPEVWKCYGSLWFDVIAENYQIYSRDC 957
            N    S + KL   Y+  +L  L+  F  +E ELPEVWKC+G+LWFD I+   ++ +   
Sbjct: 719  NSRNMSSVEKLCEEYNKMDLHTLVEHFTNSE-ELPEVWKCWGTLWFDTISNKSELKASSV 777

Query: 958  SKNISMKDTKCLNYPIDGLPFDEMEENGTNFWKRSCRLIFLFKTMITRFNGFGGLTISSN 1017
             ++  ++D   L+ PIDG+ FD+ +E+G  FWKR+CR+IF+FK M   F+   G+ + S+
Sbjct: 778  -QSTGIRDHLFLDAPIDGICFDQDDESGLKFWKRACRVIFMFKGMAKEFH--YGIRV-SD 833

Query: 1018 TSVYCNRSDIPNNHILRTFAFKL 1040
            T +   R D+   H L+ F+FK 
Sbjct: 834  TPI-STRRDVTTLHALKRFSFKF 855

 Score = 78.2 bits (191), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 33/58 (56%), Positives = 47/58 (81%), Gaps = 1/58 (1%)

Query: 618 NAINLFNFRNIFKQKNSDILKYFFKNSATFAESHILQLIGFGDPKNPFALLFQLPKYL 675
           N ++ F+ + IF Q + + L+YFF ++  FAESHILQL+GFGDP+NPFA+LF+LPK+L
Sbjct: 520 NNVDFFDHKQIFIQ-DGEKLRYFFSHAPAFAESHILQLVGFGDPRNPFAILFELPKFL 576

>CAGL0H06611g Chr8 (653472..657320) [3849 bp, 1282 aa] {ON} similar
           to uniprot|P36168 Saccharomyces cerevisiae YKR096w
          Length = 1282

 Score =  387 bits (993), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 194/409 (47%), Positives = 268/409 (65%), Gaps = 76/409 (18%)

Query: 269 LIQKLQNIYKLIVSQELELQDKCNKLSTSQSTKLKYLWSIYKLNHDLINNYILFILTSLS 328
           LI KLQ+IYK I+ QE+ELQ+ C+ +++SQ+T LK +W +YK+N +L+NNY++FI T+L 
Sbjct: 276 LISKLQDIYKSILVQEVELQNCCSAITSSQTTDLKKIWEVYKINVELVNNYVIFITTALL 335

Query: 329 PSQSINDQLIGKEILEIYKIERRLWIYGTITFLDILKNFANFMDPEILSQFITHVFESIS 388
           PSQS  D LIG+EI+++YKIERRLW+YGTITFLD+LK+F+NFMDPEI  QFI HVF SI+
Sbjct: 336 PSQSQTDLLIGQEIIDVYKIERRLWVYGTITFLDVLKHFSNFMDPEICCQFIIHVFISIA 395

Query: 389 NMISDLPIDFINPWYQRLGDLSRMAIALYPSNFIDWKLSSEYWYIESMKFTFSHGKLYYH 448
           NM   +P  F  PW+ RLGDLSRMA ALYP    DWKLS+EYWY E+MK+T+  GKLYYH
Sbjct: 396 NMSDYIPKKFSIPWFSRLGDLSRMATALYPPGATDWKLSAEYWYGEAMKYTYGVGKLYYH 455

Query: 449 ISTVQQNPLEAFVNLGKSVFCFDTFIPSQRYMQLVIDNIYQRAFIERXXXXXXXXXXXXX 508
           ++TVQQN L AF+NLGKSVFC D F+P+Q+Y+QLVIDNIYQRA+I R             
Sbjct: 456 MATVQQNSLAAFINLGKSVFCRDAFVPTQQYLQLVIDNIYQRAYISRGEES--------- 506

Query: 509 XXXXHFMTSSFAKNFQQRFLIEYLKHSEVMLLPNFLENDHLKTVVLNYFTNSFGKIAIQX 568
                      + N Q   +++YLKH+E+M+LPNF+EN  L+ +   YF+  FG+  +  
Sbjct: 507 -----------SSNVQ---ILDYLKHNEIMVLPNFMENFELQRMAYVYFSEKFGQDFV-- 550

Query: 569 XXXXXXXXXXXXXXXXXXXXXXQANIENINNGHNIPSSSNVITSESLQINAINLFNFRNI 628
                                          G+N                    F+ R++
Sbjct: 551 -------------------------------GNN-------------------FFDTRSM 560

Query: 629 FKQKNSDILKYFFKNSATFAESHILQLIGFGDPKNPFALLFQLPKYLKE 677
           F Q N + +K++F++S  FA++HILQ++G+G+  N FALL++LPK++K+
Sbjct: 561 FVQ-NLESVKFYFRHSPLFAQAHILQVVGYGNIGNAFALLYELPKFIKD 608

 Score =  229 bits (585), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 105/218 (48%), Positives = 152/218 (69%), Gaps = 2/218 (0%)

Query: 790  DFFNNLESLKLSFFLPNSLEIWNESLKYINIISLNCSIIVLKKFLNGPLFVSLPHMLPWS 849
            ++FN+LE++   F LP +++IW +SL+Y N   + C ++VL+KFL GP   +LPH+LPW 
Sbjct: 644  EYFNSLENIDKEFTLPPNVDIWIQSLQYTNTTGIFCGMMVLQKFLQGPFVTALPHLLPWV 703

Query: 850  YFIISLALRIESLENIESRIFWLQFIRKIFPWNSIVSYLNVIISVLLDNCYENSMITKLI 909
            YF+IS+A +IE+L +  S+ FW  FIR+IFPWN+I+++LNV+I+ L DN    S++ +L 
Sbjct: 704  YFLISVAFKIETLRDTNSQYFWKLFIRRIFPWNTIINFLNVLIAFLKDNSDSCSLVNQLC 763

Query: 910  NNYSNKNLDELLVEFNENEYELPEVWKCYGSLWFDVIAENYQIYSRDCSKNISMKDTKCL 969
              YS  +LDE+L  F+ENE ELPEVW C+GSLWFD I +N    S    K   +KD   L
Sbjct: 764  ETYSQLSLDEILTNFSENE-ELPEVWNCWGSLWFDTI-KNKSETSYSGLKTAGIKDVNFL 821

Query: 970  NYPIDGLPFDEMEENGTNFWKRSCRLIFLFKTMITRFN 1007
            + P DG+ FDE ++NG  FWKR+CR++FLFK    +F+
Sbjct: 822  DAPYDGIVFDEEDDNGNKFWKRACRILFLFKGYAEKFD 859

 Score =  206 bits (525), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 107/224 (47%), Positives = 143/224 (63%), Gaps = 20/224 (8%)

Query: 1275 KNIDEIWR-----GEMFHDTSIQFSDTYFVLDATSWLRHFAHVYKLATNGILKFAICLTT 1329
            +++D I++     GEM     + +  TYF+ DAT+WLRHFAH+YK+A +G+L F ICLTT
Sbjct: 1063 RDLDTIFKTIKINGEM----RVAYYSTYFIFDATTWLRHFAHIYKIAYSGLLNFVICLTT 1118

Query: 1330 FQELRFLRKSKDENVMEAATRAIITLRQLYSEKRLLPLRFTGNIATHIEEHLEFEEQITW 1389
            FQELRFLR+S+DENVMEAATRA+I +R LY  K+++PLRF G IA+HIEEHLEFEEQITW
Sbjct: 1119 FQELRFLRRSRDENVMEAATRAVIVIRLLYKLKKVIPLRFNGKIASHIEEHLEFEEQITW 1178

Query: 1390 RSHVDEFVIEAIKRAQ-------LKRRDNRNQEDXXXXXXXXXXXXXXXXXXXXXXVTDM 1442
            RSHV+EFVIEA+ ++Q       L     +   D                       + +
Sbjct: 1179 RSHVNEFVIEAVAKSQENGMFDELHNESAKADFDAENMDTADSADTKQRGNSNASTNSKV 1238

Query: 1443 IFVLVTDDISMIKKRQEEKSDNDIITFSTKFVFSLCNMLVNKFN 1486
            + VLVTDD +M  K +E      I T ST+F+FS+C+ L  K+ 
Sbjct: 1239 LSVLVTDDRNMDSKAKER----GIRTCSTRFIFSICSQLGMKYG 1278

 Score = 47.8 bits (112), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/54 (40%), Positives = 35/54 (64%)

Query: 1150 FEKNSIQNTDLNCEPGLSLIENESLFEYEGYKRFIPDFSNFDKNGELISTSLYT 1203
            FE  S  N  L+  P LS+I+ ES+F+Y GYK+ +P +  +DKNG +   ++Y+
Sbjct: 923  FESISENNIILDAVPQLSVIDGESIFDYVGYKKLLPCYYYYDKNGNVNKGAIYS 976

>NDAI0E05070 Chr5 (1159816..1164486) [4671 bp, 1556 aa] {ON}
           Anc_5.706 YIL151C
          Length = 1556

 Score =  363 bits (933), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 192/294 (65%), Positives = 233/294 (79%), Gaps = 23/294 (7%)

Query: 269 LIQKLQNIYKLIVSQELELQDKCNKLSTSQSTKLKYLWSIYKLNHDLINNYILFILTSLS 328
           LIQKLQ+IYKLIV QE++LQD+C++L+TSQ+T LK LW+IYK+N DLINNYI FI  +L 
Sbjct: 398 LIQKLQDIYKLIVKQEIQLQDRCSQLTTSQTTDLKNLWTIYKINLDLINNYINFITNALL 457

Query: 329 PSQSINDQLIGKEILEIYKIERRLWIYGTITFLDILKNFANFMDPEILSQFITHVFESIS 388
           P+QS ND  IG+EI+EIY+IERRLW+YGTITFLD+LK+F+NFMDPE+  QFI+HVF +IS
Sbjct: 458 PTQSKNDLHIGEEIIEIYRIERRLWVYGTITFLDVLKSFSNFMDPEVCCQFISHVFIAIS 517

Query: 389 NMISDLPIDFINPWYQRLGDLSRMAIALYPSNFIDWKLSSEYWYIESMKFTFSHGKLYYH 448
            +++D+P+ +   W QRLGDLSRMAIALYPS FIDWKLS+E+WY E+MKFT+SHGKLYYH
Sbjct: 518 LILNDIPMKYSIQWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYNEAMKFTYSHGKLYYH 577

Query: 449 ISTVQQNPLEAFVNLGKSVFCFDTFIPSQRYMQLVIDNIYQRAFIERXXXXXXXXXXXXX 508
           +STVQQN LEAFVNLGKSVFC +TF PSQ+YMQLVIDNIYQRAF+ER             
Sbjct: 578 MSTVQQNTLEAFVNLGKSVFCQETFTPSQQYMQLVIDNIYQRAFVER------------- 624

Query: 509 XXXXHFMTSSFAKNFQQRFLIEYLKHSEVMLLPNFLENDHLKTVVLNYFTNSFG 562
                   +   +N Q   LIEYLKH+EVMLLP FLE+  L+ VVL YF   FG
Sbjct: 625 -------NNGNHRNLQ---LIEYLKHTEVMLLPTFLESLDLQNVVLVYFQTKFG 668

 Score =  228 bits (582), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 131/298 (43%), Positives = 184/298 (61%), Gaps = 41/298 (13%)

Query: 780  DEMLDNLSPQDFFNNLESLKLSFFLPNSLEIWNESLKYINIISLNCSIIVLKKFLNGPLF 839
            D    N+  ++FF N++ L+  + +P ++EIW ESLK IN+ISL CSIIVLKKFLNGP+ 
Sbjct: 857  DNNYSNILCEEFFENIDLLQFPYKIPQTIEIWLESLKNINLISLKCSIIVLKKFLNGPIL 916

Query: 840  VSLPHMLPWSYFIISLALRIE-SLENIESRIFWLQFIRKIFPWNSIVSYLNVIISVLLDN 898
            ++LPH+L W +FIIS+ L+IE S+ + +S+IFW  F++ I PWNSIV++LNV++  LLDN
Sbjct: 917  IALPHLLTWIHFIISILLKIENSITDNQSKIFWYSFLKCIIPWNSIVNFLNVLMVYLLDN 976

Query: 899  CYENS--MITKLINNY---SNKNLDELLVEFNENEYELPEVWKCYGSLWFDVIA------ 947
              + +  +I  L N Y   S+ +L+E+L  FN+NE  LPE+WKC+G+LWFDVI       
Sbjct: 977  INDENFKLIISLSNKYNSMSSSSLNEMLKFFNQNE-NLPEIWKCWGTLWFDVICNKNINS 1035

Query: 948  -------------------------ENYQIYSRDCSKNISMKDTKCLNYPIDGLPFDEME 982
                                     +NY   +    + + ++D   L+ P+DG+ F   +
Sbjct: 1036 DTTFLNQNNNNTTTTTKNNGEDILNDNYD--TDKTLRAMGIEDHTILDCPLDGIGFVAND 1093

Query: 983  ENGTNFWKRSCRLIFLFKTMITRFNGFGGLTISSNTSVYCNRSDIPNNHILRTFAFKL 1040
            E+G NF+KRS RLIFL K+MI  F    GL IS  TS YC  + IP N IL  FAFKL
Sbjct: 1094 EDGINFYKRSIRLIFLCKSMIETFPNL-GLKISHETSNYCRNTKIPQNFILNNFAFKL 1150

 Score =  204 bits (518), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 94/117 (80%), Positives = 104/117 (88%)

Query: 1289 TSIQFSDTYFVLDATSWLRHFAHVYKLATNGILKFAICLTTFQELRFLRKSKDENVMEAA 1348
             SI    T+FV DATSWLRHFAH+YKL+ NG LKFA+CLTTFQELRFLRKSKD NV+EA+
Sbjct: 1324 VSINKHRTFFVFDATSWLRHFAHIYKLSKNGFLKFAVCLTTFQELRFLRKSKDGNVVEAS 1383

Query: 1349 TRAIITLRQLYSEKRLLPLRFTGNIATHIEEHLEFEEQITWRSHVDEFVIEAIKRAQ 1405
            TRAIIT+RQLY E +LLPLRFTGN+AT IEEHLEFEEQITWRSHVDEFVIEAI R+Q
Sbjct: 1384 TRAIITMRQLYKEGKLLPLRFTGNVATDIEEHLEFEEQITWRSHVDEFVIEAIIRSQ 1440

 Score = 45.1 bits (105), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 36/53 (67%), Gaps = 1/53 (1%)

Query: 1157 NTDLNCEPGLSLIE-NESLFEYEGYKRFIPDFSNFDKNGELISTSLYTSTIID 1208
            N +L  +P LS++  NE++F Y GYKR   +  +F +NGE+IS S+Y+S  ID
Sbjct: 1203 NLNLQLQPPLSILGGNENIFNYLGYKRLNFNIQSFHENGEIISGSIYSSWPID 1255

>TPHA0D04640 Chr4 (1012556..1015444) [2889 bp, 962 aa] {ON} Anc_5.706
            YIL151C
          Length = 962

 Score = 81.3 bits (199), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 60/230 (26%), Positives = 113/230 (49%), Gaps = 7/230 (3%)

Query: 807  SLEIWNESLKYINIISLNCSIIVLKKFLNGPLFVSLPHMLPWSYFIISLALRIESLENIE 866
            SL  W   ++ ++   L+ + ++ KKFL   + +S P +LPW  F IS+A  + ++ +  
Sbjct: 477  SLSNWKILIEQMDDTLLHSNKLLFKKFLMLNVAISQPFILPWLLFYISVASEVANVTDRH 536

Query: 867  SRIFWLQFIRKIFPWNSIVSYLNVIISVLLDNCYENSMITKLINNYSNKNLDELLVEFNE 926
              + W   ++ + PW+ IV+YLN  I ++  +   +  +  LI N  + +L +LL  +  
Sbjct: 537  VLLLWKDLLQNLLPWDDIVTYLNESIDMVNKHSINSKTLRALIKNIKSCSLYDLLY-YMM 595

Query: 927  NEYELPEVWKCYGSLWFDVIAENYQIYSRDCSKNISMKDTKCLNYPIDGLPFDEMEENGT 986
             E    E+  C G +WFD +A   +I     + N S+   K  N   D L +D+ ++  T
Sbjct: 596  YESNFQEISMCEGFIWFDSLAS--KIKQASITTNESLMKFKSYNASEDSLIYDDDDQVYT 653

Query: 987  NFWKRSCRLIFLFKTMITRFNGFGGLTIS----SNTSVYCNRSDIPNNHI 1032
              W R+  +I L K +I  +     ++I     +N+S   N   + N+++
Sbjct: 654  KMWTRALLIILLIKNVINDYPELIDVSIRGQSLTNSSCIKNSDSLTNDYL 703

 Score = 61.2 bits (147), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 50/212 (23%), Positives = 104/212 (49%), Gaps = 25/212 (11%)

Query: 304 YLWSIYKLNHDLINNYILFILTSLSPSQSINDQLIGKEILEIYKIERRLWIYGTITFLDI 363
           YL  ++KL+  +++ Y  FI  +L+ + +  D + GKE +   ++  RL  +     L+I
Sbjct: 143 YLMRLFKLHTKIVSRYTEFIAIALNINNTQEDLIRGKEYVTKGRLNERLINHCLKPLLEI 202

Query: 364 LKNFANFM----------DPEILSQFITHVFESISNMISDLPIDFINPWYQRLGDLSRMA 413
           ++N+ N M          + + + +FI      I++M+ ++P+ F   W   +GDL+R+ 
Sbjct: 203 IENYKNHMKINGINVSVINNDNIIEFIQSFIIDITHMLEEIPLKFHYDWELHIGDLNRLL 262

Query: 414 IALYPSNFIDWKLSSEYWY-----IESMKFTFSHGK----------LYYHISTVQQNPLE 458
           + L   +   ++L+S + Y     + ++ ++ ++GK           Y+++S VQ + L 
Sbjct: 263 MLLSVKDQEVYRLNSLHRYNIIAPVVAVNYSPNNGKESDIKNHMCNYYFNLSKVQHSSLA 322

Query: 459 AFVNLGKSVFCFDTFIPSQRYMQLVIDNIYQR 490
             V L K +   +T +  +   QL ID I  +
Sbjct: 323 RIVTLSKCLCIENTNVYQKSMAQLAIDKIISK 354

 Score = 36.2 bits (82), Expect = 0.94,   Method: Compositional matrix adjust.
 Identities = 17/70 (24%), Positives = 38/70 (54%), Gaps = 1/70 (1%)

Query: 1292 QFSDTYFVLDATSWLRHFAHVYKLATNGILKFAICLTTFQELRFLRK-SKDENVMEAATR 1350
            +  + YF++D  +WL+H   + +      +K  + ++   +L  L+  S+ E+V  +A+R
Sbjct: 798  KLENNYFMVDTLAWLKHSNKLKRFIAEEKVKVILSVSILNDLNELKNYSEHESVRSSASR 857

Query: 1351 AIITLRQLYS 1360
             +I +  LY+
Sbjct: 858  VMIVINYLYA 867

>KAFR0H02700 Chr8 (512455..515580) [3126 bp, 1041 aa] {ON} Anc_8.624
            YPL125W
          Length = 1041

 Score = 33.9 bits (76), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 40/79 (50%), Gaps = 3/79 (3%)

Query: 936  KCYGSLWFDVIAENYQIY-SRDCSKNISMKDTKCLNYPIDGLPFDEMEENGTNFWK-RSC 993
            KCYG L+++++AE+   +    CS  I +  TK L +      + E  E   +FW+  + 
Sbjct: 282  KCYGKLYYNLVAESPATFILLPCSIRILISYTKLL-FEKASEVYSESTEVTGDFWENTTI 340

Query: 994  RLIFLFKTMITRFNGFGGL 1012
            R + L K +IT  N  G +
Sbjct: 341  RALLLLKRVITFTNKKGNV 359

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.134    0.389 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 146,378,605
Number of extensions: 6575816
Number of successful extensions: 40398
Number of sequences better than 10.0: 120
Number of HSP's gapped: 40935
Number of HSP's successfully gapped: 228
Length of query: 1526
Length of database: 53,481,399
Length adjustment: 123
Effective length of query: 1403
Effective length of database: 39,377,481
Effective search space: 55246605843
Effective search space used: 55246605843
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 73 (32.7 bits)