Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0E017005.708ON57657629960.0
YKR097W (PCK1)5.708ON54954523250.0
Smik_11.3615.708ON54954523220.0
KNAG0C066405.708ON54754123210.0
TDEL0B021205.708ON54855023160.0
CAGL0H06633g5.708ON54454223150.0
Skud_11.3375.708ON54954523130.0
Suva_11.3345.708ON54854523010.0
SAKL0E15048g5.708ON54254922770.0
ZYRO0B16456g5.708ON54854022710.0
NCAS0A031605.708ON55252322680.0
TPHA0E001705.708ON57853622540.0
Kpol_1043.755.708ON55852222500.0
NDAI0E050805.708ON55154122470.0
KLLA0A00484g5.708ON54354722440.0
KLTH0E00902g5.708ON54454822250.0
KAFR0H001605.708ON54952622250.0
Ecym_40135.708ON54254222170.0
Kwal_55.196635.708ON54454821800.0
AFR292W5.708ON54152521790.0
Suva_7.275singletonON961131538e-12
TBLA0G030703.258ON114735724.6
TBLA0B001002.1ON171765706.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0E01700
         (576 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0E01700 Chr5 complement(408779..410509) [1731 bp, 576 aa] {O...  1158   0.0  
YKR097W Chr11 (631152..632801) [1650 bp, 549 aa] {ON}  PCK1Phosp...   900   0.0  
Smik_11.361 Chr11 (621197..622846) [1650 bp, 549 aa] {ON} YKR097...   899   0.0  
KNAG0C06640 Chr3 (1288896..1290539) [1644 bp, 547 aa] {ON} Anc_5...   898   0.0  
TDEL0B02120 Chr2 complement(377690..379336) [1647 bp, 548 aa] {O...   896   0.0  
CAGL0H06633g Chr8 (659326..660960) [1635 bp, 544 aa] {ON} highly...   896   0.0  
Skud_11.337 Chr11 (612752..614401) [1650 bp, 549 aa] {ON} YKR097...   895   0.0  
Suva_11.334 Chr11 (615967..617613) [1647 bp, 548 aa] {ON} YKR097...   890   0.0  
SAKL0E15048g Chr5 (1251927..1253555) [1629 bp, 542 aa] {ON} high...   881   0.0  
ZYRO0B16456g Chr2 (1334967..1336613) [1647 bp, 548 aa] {ON} high...   879   0.0  
NCAS0A03160 Chr1 complement(619303..620961) [1659 bp, 552 aa] {O...   878   0.0  
TPHA0E00170 Chr5 complement(16873..18609) [1737 bp, 578 aa] {ON}...   872   0.0  
Kpol_1043.75 s1043 (162051..163727) [1677 bp, 558 aa] {ON} (1620...   871   0.0  
NDAI0E05080 Chr5 (1165969..1167624) [1656 bp, 551 aa] {ON} Anc_5...   870   0.0  
KLLA0A00484g Chr1 complement(40330..41961) [1632 bp, 543 aa] {ON...   868   0.0  
KLTH0E00902g Chr5 complement(88552..90186) [1635 bp, 544 aa] {ON...   861   0.0  
KAFR0H00160 Chr8 complement(16235..17884) [1650 bp, 549 aa] {ON}...   861   0.0  
Ecym_4013 Chr4 complement(31078..32706) [1629 bp, 542 aa] {ON} s...   858   0.0  
Kwal_55.19663 s55 complement(70935..72569) [1635 bp, 544 aa] {ON...   844   0.0  
AFR292W Chr6 (965578..967203) [1626 bp, 541 aa] {ON} Syntenic ho...   843   0.0  
Suva_7.275 Chr7 complement(476201..476281,476285..476410,476414....    64   8e-12
TBLA0G03070 Chr7 complement(812624..816067) [3444 bp, 1147 aa] {...    32   4.6  
TBLA0B00100 Chr2 (2396..7549) [5154 bp, 1717 aa] {ON} Anc_2.1 YN...    32   6.7  

>TBLA0E01700 Chr5 complement(408779..410509) [1731 bp, 576 aa] {ON}
           Anc_5.708 YKR097W
          Length = 576

 Score = 1158 bits (2996), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 556/576 (96%), Positives = 556/576 (96%)

Query: 1   MCPARVXXXXXXXXXXXXXXXXXXXXPSLKKQKLSMEDQLLSQLNWDGSKDSSLINIKHN 60
           MCPARV                    PSLKKQKLSMEDQLLSQLNWDGSKDSSLINIKHN
Sbjct: 1   MCPARVSTTTSNTSINGTNINNYNGNPSLKKQKLSMEDQLLSQLNWDGSKDSSLINIKHN 60

Query: 61  PSAAILYEDALKEPKTVISSSGALIAYSGAKTGRSPKDKRIVYEDGSKDNVWWGPVNKPC 120
           PSAAILYEDALKEPKTVISSSGALIAYSGAKTGRSPKDKRIVYEDGSKDNVWWGPVNKPC
Sbjct: 61  PSAAILYEDALKEPKTVISSSGALIAYSGAKTGRSPKDKRIVYEDGSKDNVWWGPVNKPC 120

Query: 121 SEKTWQINRERTLDYLGTRSNLYVIDAYVGWDPRYRLKVRVVCARAYHALFMTNMLIRPT 180
           SEKTWQINRERTLDYLGTRSNLYVIDAYVGWDPRYRLKVRVVCARAYHALFMTNMLIRPT
Sbjct: 121 SEKTWQINRERTLDYLGTRSNLYVIDAYVGWDPRYRLKVRVVCARAYHALFMTNMLIRPT 180

Query: 181 EEELKNFNEPDFTVWNAGGFSANSYTADMTSKTSVEINFKAMEMIILGTEYAGEMKKGIF 240
           EEELKNFNEPDFTVWNAGGFSANSYTADMTSKTSVEINFKAMEMIILGTEYAGEMKKGIF
Sbjct: 181 EEELKNFNEPDFTVWNAGGFSANSYTADMTSKTSVEINFKAMEMIILGTEYAGEMKKGIF 240

Query: 241 TVMFYLMPIHHNILTLHSSANEGIEKKDVTVFFGLSGTGKTTLSADPNRLLIGDDEHCWS 300
           TVMFYLMPIHHNILTLHSSANEGIEKKDVTVFFGLSGTGKTTLSADPNRLLIGDDEHCWS
Sbjct: 241 TVMFYLMPIHHNILTLHSSANEGIEKKDVTVFFGLSGTGKTTLSADPNRLLIGDDEHCWS 300

Query: 301 DHGVFNIEGGCYAKCIGLTREKEPEIFDAIRFGSVLENVTYNELNHKVDYNDCAITENTR 360
           DHGVFNIEGGCYAKCIGLTREKEPEIFDAIRFGSVLENVTYNELNHKVDYNDCAITENTR
Sbjct: 301 DHGVFNIEGGCYAKCIGLTREKEPEIFDAIRFGSVLENVTYNELNHKVDYNDCAITENTR 360

Query: 361 CAYPIDYIKSAKIPCLANSHPKNLILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAG 420
           CAYPIDYIKSAKIPCLANSHPKNLILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAG
Sbjct: 361 CAYPIDYIKSAKIPCLANSHPKNLILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAG 420

Query: 421 TEQGVTEPEATFSSCFGQPFLALHPITYATMLAKKMDQYKSNAWLINTGWTGSSYSAGGS 480
           TEQGVTEPEATFSSCFGQPFLALHPITYATMLAKKMDQYKSNAWLINTGWTGSSYSAGGS
Sbjct: 421 TEQGVTEPEATFSSCFGQPFLALHPITYATMLAKKMDQYKSNAWLINTGWTGSSYSAGGS 480

Query: 481 RCPLKYTRAILDAIHDGTLANENYETLPVFNLQIPTHVNGVPNEILNPENSWNSPANKNN 540
           RCPLKYTRAILDAIHDGTLANENYETLPVFNLQIPTHVNGVPNEILNPENSWNSPANKNN
Sbjct: 481 RCPLKYTRAILDAIHDGTLANENYETLPVFNLQIPTHVNGVPNEILNPENSWNSPANKNN 540

Query: 541 ISYNKAVNKLAALFVENFKIYQDKATDDVLAAGPQV 576
           ISYNKAVNKLAALFVENFKIYQDKATDDVLAAGPQV
Sbjct: 541 ISYNKAVNKLAALFVENFKIYQDKATDDVLAAGPQV 576

>YKR097W Chr11 (631152..632801) [1650 bp, 549 aa] {ON}
           PCK1Phosphoenolpyruvate carboxykinase, key enzyme in
           gluconeogenesis, catalyzes early reaction in
           carbohydrate biosynthesis, glucose represses
           transcription and accelerates mRNA degradation,
           regulated by Mcm1p and Cat8p, located in the cytosol
          Length = 549

 Score =  900 bits (2325), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 422/545 (77%), Positives = 474/545 (86%), Gaps = 18/545 (3%)

Query: 31  KQKLSMEDQLLSQLNWDGSKDSSLINIKHNPSAAILYEDALKEPKTVISSSGALIAYSGA 90
           +Q+L++ D++ +              I+ N  AA+LYED LKE KTVISSSGALIAYSG 
Sbjct: 21  RQELALSDEVTT--------------IRRNAPAAVLYEDGLKENKTVISSSGALIAYSGV 66

Query: 91  KTGRSPKDKRIVYEDGSKDNVWWGPVNKPCSEKTWQINRERTLDYLGTRSNLYVIDAYVG 150
           KTGRSPKDKRIV E  SKD +WWGPVNKPCSE+TW INRER  DYL TR ++Y++DA+ G
Sbjct: 67  KTGRSPKDKRIVEEPTSKDEIWWGPVNKPCSERTWSINRERAADYLRTRDHIYIVDAFAG 126

Query: 151 WDPRYRLKVRVVCARAYHALFMTNMLIRPTEEELKNFNEPDFTVWNAGGFSANSYTADMT 210
           WDP+YR+KVRVVCARAYHALFMTNMLIRPTEEEL +F EPDFTVWNAG F AN +T DM+
Sbjct: 127 WDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELAHFGEPDFTVWNAGQFPANLHTQDMS 186

Query: 211 SKTSVEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPIHHNILTLHSSANEGIEKKDVT 270
           SK+++EINFKAMEMIILGTEYAGEMKKGIFTVMFYLMP+HHN+LTLHSSAN+GI+  DVT
Sbjct: 187 SKSTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGIQNGDVT 246

Query: 271 VFFGLSGTGKTTLSADPNRLLIGDDEHCWSDHGVFNIEGGCYAKCIGLTREKEPEIFDAI 330
           +FFGLSGTGKTTLSADP+RLLIGDDEHCWSDHGVFNIEGGCYAKCI L+ EKEPEIFDAI
Sbjct: 247 LFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCINLSAEKEPEIFDAI 306

Query: 331 RFGSVLENVTYNELNHKVDYNDCAITENTRCAYPIDYIKSAKIPCLANSHPKNLILLTCD 390
           +FGSVLENV Y+E +H VDY+D +ITENTRCAYPIDYI SAKIPCLA+SHPKN+ILLTCD
Sbjct: 307 KFGSVLENVIYDEKSHVVDYDDSSITENTRCAYPIDYIPSAKIPCLADSHPKNIILLTCD 366

Query: 391 ASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALHPITYAT 450
           ASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPE TFSSCFGQPFLALHPI YAT
Sbjct: 367 ASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALHPIRYAT 426

Query: 451 MLAKKMDQYKSNAWLINTGWTGSSYSAGGSRCPLKYTRAILDAIHDGTLANENYETLPVF 510
           MLA KM Q+K+NA+LINTGWTGSSY +GG RCPLKYTRAILD+IHDG+LANE YETLP+F
Sbjct: 427 MLATKMSQHKANAYLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLANETYETLPIF 486

Query: 511 NLQIPTHVNGVPNEILNPENSWNSPANKNNISYNKAVNKLAALFVENFKIYQDKATDDVL 570
           NLQ+PT VNGVP E+LNP  +W+   +K    Y  AV  LA LFV+NFKIYQD+AT DVL
Sbjct: 487 NLQVPTKVNGVPAELLNPAKNWSQGESK----YRGAVTNLANLFVQNFKIYQDRATPDVL 542

Query: 571 AAGPQ 575
           AAGPQ
Sbjct: 543 AAGPQ 547

>Smik_11.361 Chr11 (621197..622846) [1650 bp, 549 aa] {ON} YKR097W
           (REAL)
          Length = 549

 Score =  899 bits (2322), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 420/545 (77%), Positives = 472/545 (86%), Gaps = 18/545 (3%)

Query: 31  KQKLSMEDQLLSQLNWDGSKDSSLINIKHNPSAAILYEDALKEPKTVISSSGALIAYSGA 90
           +Q+L++ D++ +              I+ N  AA+LYED LKE KTVISSSGALIAYSG 
Sbjct: 21  RQELALSDEVTT--------------IRRNAPAAVLYEDGLKEKKTVISSSGALIAYSGV 66

Query: 91  KTGRSPKDKRIVYEDGSKDNVWWGPVNKPCSEKTWQINRERTLDYLGTRSNLYVIDAYVG 150
           KTGRSPKDKRIV E  SKD +WWGPVNKPCSE+TW INRER  DYL TR ++Y++DA+ G
Sbjct: 67  KTGRSPKDKRIVEEPTSKDEIWWGPVNKPCSERTWSINRERAADYLRTRDHIYIVDAFAG 126

Query: 151 WDPRYRLKVRVVCARAYHALFMTNMLIRPTEEELKNFNEPDFTVWNAGGFSANSYTADMT 210
           WDP+YR+KVRVVCARAYHALFMTNMLIRPTEEEL +F EPDFTVWNAG F AN +T DM+
Sbjct: 127 WDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELAHFGEPDFTVWNAGQFPANLHTQDMS 186

Query: 211 SKTSVEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPIHHNILTLHSSANEGIEKKDVT 270
           SK+++EINFKAMEMIILGTEYAGEMKKGIFTVMFYLMP+HHN+LTLHSSAN+GI+  DVT
Sbjct: 187 SKSTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGIQNGDVT 246

Query: 271 VFFGLSGTGKTTLSADPNRLLIGDDEHCWSDHGVFNIEGGCYAKCIGLTREKEPEIFDAI 330
           +FFGLSGTGKTTLSADP+RLLIGDDEHCWSDHGVFNIEGGCYAKCI L+ EKEPEIFDAI
Sbjct: 247 LFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCINLSAEKEPEIFDAI 306

Query: 331 RFGSVLENVTYNELNHKVDYNDCAITENTRCAYPIDYIKSAKIPCLANSHPKNLILLTCD 390
           +FG+VLENV Y+E +H VDY+D +ITENTRCAYPIDYI SAKIPCLA+SHPKN+ILLTCD
Sbjct: 307 KFGAVLENVKYDEKSHVVDYDDSSITENTRCAYPIDYIPSAKIPCLADSHPKNIILLTCD 366

Query: 391 ASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALHPITYAT 450
           ASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPE TFSSCFGQPFLALHPI YAT
Sbjct: 367 ASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALHPIRYAT 426

Query: 451 MLAKKMDQYKSNAWLINTGWTGSSYSAGGSRCPLKYTRAILDAIHDGTLANENYETLPVF 510
           MLA KM Q+K+NA+LINTGWTGSSY +GG RCPLKYTRAILD+IHDG+LANE YE+LP+F
Sbjct: 427 MLAAKMSQHKANAYLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLANETYESLPIF 486

Query: 511 NLQIPTHVNGVPNEILNPENSWNSPANKNNISYNKAVNKLAALFVENFKIYQDKATDDVL 570
           NLQ+PT V GVP E+LNP  +W+    K    Y  AV  LA LFVENFKIYQD+AT DVL
Sbjct: 487 NLQVPTKVKGVPAELLNPAKNWSQGETK----YKGAVTSLATLFVENFKIYQDRATPDVL 542

Query: 571 AAGPQ 575
           AAGPQ
Sbjct: 543 AAGPQ 547

>KNAG0C06640 Chr3 (1288896..1290539) [1644 bp, 547 aa] {ON}
           Anc_5.708 YKR097W
          Length = 547

 Score =  898 bits (2321), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 421/541 (77%), Positives = 479/541 (88%), Gaps = 8/541 (1%)

Query: 34  LSMEDQLLSQLNWDGSKDSSLINIKHNPSAAILYEDALKEPKTVISSSGALIAYSGAKTG 93
           +S+E ++  +LN   SK+  +I I+ N  AA+LYEDAL E KTVI+SSGALIAYSG KTG
Sbjct: 13  ISVEQKIRRELNL--SKE--VITIRRNAPAAVLYEDALHERKTVIASSGALIAYSGEKTG 68

Query: 94  RSPKDKRIVYEDGSKDNVWWGPVNKPCSEKTWQINRERTLDYLGTRSNLYVIDAYVGWDP 153
           RSPKDKRIV E+ SKDNVWWGPVNKPCSE+TW+INRER  DYL TR +LY++DA+ GWDP
Sbjct: 69  RSPKDKRIVEEETSKDNVWWGPVNKPCSERTWEINRERAADYLRTRDHLYIVDAFAGWDP 128

Query: 154 RYRLKVRVVCARAYHALFMTNMLIRPTEEELKNFNEPDFTVWNAGGFSANSYTADMTSKT 213
           +YR+KVRVVCARAYHALFMTNMLIRP++EEL NF EPDFTVWNAG F AN +T DM+SK+
Sbjct: 129 KYRIKVRVVCARAYHALFMTNMLIRPSKEELANFGEPDFTVWNAGQFPANMHTQDMSSKS 188

Query: 214 SVEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPIHHNILTLHSSANEGIEKKDVTVFF 273
           ++EINFKAMEM+ILGTEYAGEMKKGIFTVMFYLMP+HHN+LTLHSSAN+GI+  DVT+FF
Sbjct: 189 TIEINFKAMEMVILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGIKNGDVTLFF 248

Query: 274 GLSGTGKTTLSADPNRLLIGDDEHCWSDHGVFNIEGGCYAKCIGLTREKEPEIFDAIRFG 333
           GLSGTGKTTLSADP+RLLIGDDEHCWSD GVFNIEGGCYAKCI L+ EKEPEIFDAIRFG
Sbjct: 249 GLSGTGKTTLSADPHRLLIGDDEHCWSDQGVFNIEGGCYAKCINLSAEKEPEIFDAIRFG 308

Query: 334 SVLENVTYNELNHKVDYNDCAITENTRCAYPIDYIKSAKIPCLANSHPKNLILLTCDASG 393
           SVLENV Y+E +H+VDY+D  ITENTRCAYPI+YI SAKIPCLA+SHPKN+ILLTCDASG
Sbjct: 309 SVLENVAYDEKSHEVDYDDSTITENTRCAYPIEYIPSAKIPCLADSHPKNIILLTCDASG 368

Query: 394 VLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALHPITYATMLA 453
           VLPPV+KL+PEQVMYHFISGYTSKMAGTEQGVTEPE TFSSCFGQPFLALHPI YA MLA
Sbjct: 369 VLPPVAKLSPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALHPIRYAKMLA 428

Query: 454 KKMDQYKSNAWLINTGWTGSSYSAGGSRCPLKYTRAILDAIHDGTLANENYETLPVFNLQ 513
            KM ++K+NA+LINTGWTGSSY +GG RCPLKYTRAILDAIHDG+LA  NYE+LP+FNL+
Sbjct: 429 AKMSEHKANAYLINTGWTGSSYVSGGKRCPLKYTRAILDAIHDGSLAQANYESLPIFNLE 488

Query: 514 IPTHVNGVPNEILNPENSWNSPANKNNISYNKAVNKLAALFVENFKIYQDKATDDVLAAG 573
           +PT VNGVP+E+LNP  +W     K    YN AV+ LA+LFVENFKIYQDKAT DVLAAG
Sbjct: 489 VPTAVNGVPHELLNPAKNWAQGEAK----YNGAVSNLASLFVENFKIYQDKATPDVLAAG 544

Query: 574 P 574
           P
Sbjct: 545 P 545

>TDEL0B02120 Chr2 complement(377690..379336) [1647 bp, 548 aa] {ON}
           Anc_5.708 YKR097W
          Length = 548

 Score =  896 bits (2316), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 421/550 (76%), Positives = 475/550 (86%), Gaps = 4/550 (0%)

Query: 27  PSLKKQKLSMEDQLLSQLNWDGSKDSSLINIKHNPSAAILYEDALKEPKTVISSSGALIA 86
           PS   + ++   ++  ++  + S  + +I I+ N  AAILYEDAL E KT I+SSGALIA
Sbjct: 3   PSKMNRSVTDVSEVEQKIRDELSLSNEVITIRRNAPAAILYEDALNEKKTTIASSGALIA 62

Query: 87  YSGAKTGRSPKDKRIVYEDGSKDNVWWGPVNKPCSEKTWQINRERTLDYLGTRSNLYVID 146
           YSG KTGRSPKDKRI+ E+ SKDN+WWGPVNKP  EKTW INRER  DYL TR++LY++D
Sbjct: 63  YSGDKTGRSPKDKRIIEEETSKDNIWWGPVNKPLPEKTWSINRERAADYLRTRTHLYIVD 122

Query: 147 AYVGWDPRYRLKVRVVCARAYHALFMTNMLIRPTEEELKNFNEPDFTVWNAGGFSANSYT 206
           A+ GWDPRYR+KVRVVCARAYHALFMTNMLIRPT+EEL +F EPDFTVWNAG F AN +T
Sbjct: 123 AFAGWDPRYRIKVRVVCARAYHALFMTNMLIRPTDEELAHFGEPDFTVWNAGQFPANYHT 182

Query: 207 ADMTSKTSVEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPIHHNILTLHSSANEGIEK 266
             M+SKT+VEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMP+HHN+LTLHSSAN+GI+K
Sbjct: 183 QGMSSKTTVEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGIQK 242

Query: 267 KDVTVFFGLSGTGKTTLSADPNRLLIGDDEHCWSDHGVFNIEGGCYAKCIGLTREKEPEI 326
            DVT+FFGLSGTGKTTLSADP+R LIGDDEHCWSDHGVFNIEGGCYAKCIGLT EKEPEI
Sbjct: 243 NDVTLFFGLSGTGKTTLSADPHRKLIGDDEHCWSDHGVFNIEGGCYAKCIGLTAEKEPEI 302

Query: 327 FDAIRFGSVLENVTYNELNHKVDYNDCAITENTRCAYPIDYIKSAKIPCLANSHPKNLIL 386
           ++AI+FGS+LENV Y+     VDY D +ITENTRCAYPI++I SAKIPCLA+SHP+NL+L
Sbjct: 303 YNAIKFGSILENVVYDPKTRDVDYEDSSITENTRCAYPIEHIPSAKIPCLADSHPQNLVL 362

Query: 387 LTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALHPI 446
           LTCDASGVLPP+SKLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALHPI
Sbjct: 363 LTCDASGVLPPISKLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALHPI 422

Query: 447 TYATMLAKKMDQYKSNAWLINTGWTGSSYSAGGSRCPLKYTRAILDAIHDGTLANENYET 506
            YATMLAKKM ++++NAWLINTGWTGSSY AGG RCPLKYTRAILDAIHDG+LA E+YET
Sbjct: 423 RYATMLAKKMSEHRANAWLINTGWTGSSYVAGGKRCPLKYTRAILDAIHDGSLAKESYET 482

Query: 507 LPVFNLQIPTHVNGVPNEILNPENSWNSPANKNNISYNKAVNKLAALFVENFKIYQDKAT 566
           LP FNL IPT VNGVP E+LNP  +W     K    YN AVN LA LFVENFKIYQD+AT
Sbjct: 483 LPTFNLHIPTKVNGVPKELLNPSKNWVEGEAK----YNTAVNNLAKLFVENFKIYQDRAT 538

Query: 567 DDVLAAGPQV 576
            +VLAAGPQV
Sbjct: 539 PEVLAAGPQV 548

>CAGL0H06633g Chr8 (659326..660960) [1635 bp, 544 aa] {ON} highly
           similar to uniprot|P10963 Saccharomyces cerevisiae
           YKR097w PCK1
          Length = 544

 Score =  896 bits (2315), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 420/542 (77%), Positives = 475/542 (87%), Gaps = 8/542 (1%)

Query: 35  SMEDQLLSQLNWDGSKDSSLINIKHNPSAAILYEDALKEPKTVISSSGALIAYSGAKTGR 94
           S+E+++ S+L    SK+ +LI  + N  AA+LY+DALKE KTVISS+GALIAYSG KTGR
Sbjct: 11  SVEERIRSELGL--SKEVTLI--RRNAPAAVLYQDALKEKKTVISSAGALIAYSGEKTGR 66

Query: 95  SPKDKRIVYEDGSKDNVWWGPVNKPCSEKTWQINRERTLDYLGTRSNLYVIDAYVGWDPR 154
           SPKDKRIV E+ S+DNVWWGPVNKPCSE+TW INRER  DYL TR  LYV+DA+ GWDP+
Sbjct: 67  SPKDKRIVEEETSRDNVWWGPVNKPCSERTWAINRERAADYLRTRETLYVVDAFAGWDPK 126

Query: 155 YRLKVRVVCARAYHALFMTNMLIRPTEEELKNFNEPDFTVWNAGGFSANSYTADMTSKTS 214
           YR+KVRVVCARAYHALFMTNMLIRPTEEEL NF EPDFTVWNAG F AN+ T DMTSKT+
Sbjct: 127 YRIKVRVVCARAYHALFMTNMLIRPTEEELANFGEPDFTVWNAGQFPANARTQDMTSKTT 186

Query: 215 VEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPIHHNILTLHSSANEGIEKKDVTVFFG 274
           +EINFKAMEM+ILGTEYAGEMKKGIFTVMFYLMP+HHN+LTLHSS N+GI+  DVT+FFG
Sbjct: 187 IEINFKAMEMVILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSCNQGIKNGDVTLFFG 246

Query: 275 LSGTGKTTLSADPNRLLIGDDEHCWSDHGVFNIEGGCYAKCIGLTREKEPEIFDAIRFGS 334
           LSGTGKTTLSADP+RLLIGDDEHCWSD GVFNIEGGCYAKCI L+REKEPEIFDAIRFGS
Sbjct: 247 LSGTGKTTLSADPHRLLIGDDEHCWSDEGVFNIEGGCYAKCINLSREKEPEIFDAIRFGS 306

Query: 335 VLENVTYNELNHKVDYNDCAITENTRCAYPIDYIKSAKIPCLANSHPKNLILLTCDASGV 394
           VLENV Y+  +H+VDY+D +ITENTRCAYPID+I SAKIPCLA +HPKN+ILLTCDASGV
Sbjct: 307 VLENVIYDSESHEVDYDDSSITENTRCAYPIDFIPSAKIPCLAPAHPKNIILLTCDASGV 366

Query: 395 LPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALHPITYATMLAK 454
           LPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPE TFSSCFGQPFL+LHP+ YATMLA+
Sbjct: 367 LPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLSLHPMRYATMLAE 426

Query: 455 KMDQYKSNAWLINTGWTGSSYSAGGSRCPLKYTRAILDAIHDGTLANENYETLPVFNLQI 514
           KM ++ +NAWLINTGWTGSSY +GG RC LKYTRAILDAIHDG+LA   +E+LP+FNLQ+
Sbjct: 427 KMHEHSANAWLINTGWTGSSYVSGGKRCALKYTRAILDAIHDGSLAKAEFESLPIFNLQV 486

Query: 515 PTHVNGVPNEILNPENSWNSPANKNNISYNKAVNKLAALFVENFKIYQDKATDDVLAAGP 574
           P  V GVP+E+LNP  +W+    K    Y  AV+KLA LFVENFK YQDKAT DVLAAGP
Sbjct: 487 PKAVEGVPSELLNPARNWSEGEAK----YQSAVSKLAGLFVENFKTYQDKATSDVLAAGP 542

Query: 575 QV 576
           Q+
Sbjct: 543 QL 544

>Skud_11.337 Chr11 (612752..614401) [1650 bp, 549 aa] {ON} YKR097W
           (REAL)
          Length = 549

 Score =  895 bits (2313), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 418/545 (76%), Positives = 471/545 (86%), Gaps = 18/545 (3%)

Query: 31  KQKLSMEDQLLSQLNWDGSKDSSLINIKHNPSAAILYEDALKEPKTVISSSGALIAYSGA 90
           +Q+L++ D++ +              I+ N  AA+LYED LKE KTVISSSGALIAYSG 
Sbjct: 21  RQELALSDEVTT--------------IRRNAPAAVLYEDGLKEKKTVISSSGALIAYSGV 66

Query: 91  KTGRSPKDKRIVYEDGSKDNVWWGPVNKPCSEKTWQINRERTLDYLGTRSNLYVIDAYVG 150
           KTGRSPKDKRIV E  SKD +WWGPVNKPCSE+TW INRER  DYL TR ++Y++DA+ G
Sbjct: 67  KTGRSPKDKRIVEESTSKDEIWWGPVNKPCSERTWSINRERAADYLRTRDHIYIVDAFAG 126

Query: 151 WDPRYRLKVRVVCARAYHALFMTNMLIRPTEEELKNFNEPDFTVWNAGGFSANSYTADMT 210
           WDP+YR+KVRVVCARAYHALFMTNMLIRPTEEEL +F EPDFTVWNAG F AN +T DM+
Sbjct: 127 WDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELAHFGEPDFTVWNAGQFPANLHTQDMS 186

Query: 211 SKTSVEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPIHHNILTLHSSANEGIEKKDVT 270
           SK+++EINFKAMEMIILGTEYAGEMKKGIFTVMFYLMP+HHN+LTLHSSAN+GI+  DVT
Sbjct: 187 SKSTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGIQNGDVT 246

Query: 271 VFFGLSGTGKTTLSADPNRLLIGDDEHCWSDHGVFNIEGGCYAKCIGLTREKEPEIFDAI 330
           +FFGLSGTGKTTLSADP+RLLIGDDEHCWSDHGVFNIEGGCYAKCI L+ EKEPEIFDAI
Sbjct: 247 LFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCINLSAEKEPEIFDAI 306

Query: 331 RFGSVLENVTYNELNHKVDYNDCAITENTRCAYPIDYIKSAKIPCLANSHPKNLILLTCD 390
           +FG+VLENV Y+E +H VDY+D +ITENTRCAYPIDYI SAKIPCLA+SHPKN+ILLTCD
Sbjct: 307 KFGAVLENVKYDEKSHVVDYDDSSITENTRCAYPIDYIPSAKIPCLADSHPKNIILLTCD 366

Query: 391 ASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALHPITYAT 450
           ASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPE TFSSCFGQPFLALHPI YAT
Sbjct: 367 ASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALHPIRYAT 426

Query: 451 MLAKKMDQYKSNAWLINTGWTGSSYSAGGSRCPLKYTRAILDAIHDGTLANENYETLPVF 510
           MLA KM  +KSNA+LINTGW+GSSY +GG RCPLKYTRAILD+IHDG+LANE YE+LP+F
Sbjct: 427 MLATKMSHHKSNAYLINTGWSGSSYVSGGKRCPLKYTRAILDSIHDGSLANETYESLPIF 486

Query: 511 NLQIPTHVNGVPNEILNPENSWNSPANKNNISYNKAVNKLAALFVENFKIYQDKATDDVL 570
           NLQ+PT V GVP E+LNP  +W+    K    Y  +V  LA LFVENFKIYQD+AT DVL
Sbjct: 487 NLQVPTKVKGVPAELLNPAKNWSQGEAK----YKGSVTNLANLFVENFKIYQDRATPDVL 542

Query: 571 AAGPQ 575
           AAGPQ
Sbjct: 543 AAGPQ 547

>Suva_11.334 Chr11 (615967..617613) [1647 bp, 548 aa] {ON} YKR097W
           (REAL)
          Length = 548

 Score =  890 bits (2301), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 419/545 (76%), Positives = 472/545 (86%), Gaps = 18/545 (3%)

Query: 31  KQKLSMEDQLLSQLNWDGSKDSSLINIKHNPSAAILYEDALKEPKTVISSSGALIAYSGA 90
           +Q+L++ D++ +              I+ N  AA+LYED LKE KTVISSSGALIAYSG 
Sbjct: 21  RQELALSDEVTT--------------IRRNAPAAVLYEDGLKEKKTVISSSGALIAYSGV 66

Query: 91  KTGRSPKDKRIVYEDGSKDNVWWGPVNKPCSEKTWQINRERTLDYLGTRSNLYVIDAYVG 150
           KTGRSPKDKRIV E  SKD +WWGPVNKPCSE+TW INRER  DYL TR ++Y++DA+ G
Sbjct: 67  KTGRSPKDKRIVEEPTSKDEIWWGPVNKPCSERTWSINRERAADYLRTRDHIYIVDAFAG 126

Query: 151 WDPRYRLKVRVVCARAYHALFMTNMLIRPTEEELKNFNEPDFTVWNAGGFSANSYTADMT 210
           WDP+YR+KVRVVCARAYHALFMTNMLIRPTEEEL +F EPDFTVWNAG F AN +T DM+
Sbjct: 127 WDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELAHFGEPDFTVWNAGQFPANLHTQDMS 186

Query: 211 SKTSVEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPIHHNILTLHSSANEGIEKKDVT 270
           SK+++EINFKAMEMIILGTEYAGEMKKGIFTVMFYLMP+HHNILTLHSSAN+GI+  DVT
Sbjct: 187 SKSTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNILTLHSSANQGIKNGDVT 246

Query: 271 VFFGLSGTGKTTLSADPNRLLIGDDEHCWSDHGVFNIEGGCYAKCIGLTREKEPEIFDAI 330
           +FFGLSGTGKTTLSADP+RLLIGDDEHCWSD+GVFNIEGGCYAKCI L+ EKEPEIFDAI
Sbjct: 247 LFFGLSGTGKTTLSADPHRLLIGDDEHCWSDNGVFNIEGGCYAKCINLSAEKEPEIFDAI 306

Query: 331 RFGSVLENVTYNELNHKVDYNDCAITENTRCAYPIDYIKSAKIPCLANSHPKNLILLTCD 390
           RFG+VLENV Y+E +H VDY+D +ITENTRCAYPIDYI SAKIPCLA+SHPKN+ILLTCD
Sbjct: 307 RFGAVLENVKYDENSHVVDYDDSSITENTRCAYPIDYIPSAKIPCLADSHPKNIILLTCD 366

Query: 391 ASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALHPITYAT 450
           ASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPE TFSSCFGQPFLALHPI YAT
Sbjct: 367 ASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALHPIRYAT 426

Query: 451 MLAKKMDQYKSNAWLINTGWTGSSYSAGGSRCPLKYTRAILDAIHDGTLANENYETLPVF 510
           MLA KM Q+++NA+LINTGWTGSSY +GGSRC LKYTRAILD+IHDG+LA  +YE+LP+F
Sbjct: 427 MLATKMSQHRANAYLINTGWTGSSYVSGGSRCALKYTRAILDSIHDGSLAKASYESLPIF 486

Query: 511 NLQIPTHVNGVPNEILNPENSWNSPANKNNISYNKAVNKLAALFVENFKIYQDKATDDVL 570
           NLQ+PT VNGVP E+LNP  +W+    K    Y  AV  LA LFVENFKIYQD+AT DVL
Sbjct: 487 NLQVPTKVNGVPAELLNPAKNWSQGEAK----YKGAVTNLANLFVENFKIYQDRATPDVL 542

Query: 571 AAGPQ 575
           AAGPQ
Sbjct: 543 AAGPQ 547

>SAKL0E15048g Chr5 (1251927..1253555) [1629 bp, 542 aa] {ON} highly
           similar to uniprot|P10963 Saccharomyces cerevisiae
           YKR097W PCK1 Phosphoenolpyruvate carboxykinase key
           enzyme in gluconeogenesis catalyzes early reaction in
           carbohydrate biosynthesis glucose represses
           transcription and accelerates mRNA degradation regulated
           by Mcm1p and Cat8p located in the cytosol
          Length = 542

 Score =  881 bits (2277), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 415/549 (75%), Positives = 466/549 (84%), Gaps = 8/549 (1%)

Query: 28  SLKKQKLSMEDQLLSQLNWDGSKDSSLINIKHNPSAAILYEDALKEPKTVISSSGALIAY 87
           S  K   S E ++ ++L+        ++ I+ N  AA+LYEDALKE KT ISSSGALIAY
Sbjct: 2   SPSKTYASAEQRIRNELDLS----DEVVTIRRNAPAALLYEDALKERKTTISSSGALIAY 57

Query: 88  SGAKTGRSPKDKRIVYEDGSKDNVWWGPVNKPCSEKTWQINRERTLDYLGTRSNLYVIDA 147
           SG KTGRSP+DKRIV E  S DNVWWGPVNK CSE+TWQINRER  DYL TR +LY++DA
Sbjct: 58  SGEKTGRSPRDKRIVDESTSTDNVWWGPVNKKCSERTWQINRERAADYLRTRDHLYIVDA 117

Query: 148 YVGWDPRYRLKVRVVCARAYHALFMTNMLIRPTEEELKNFNEPDFTVWNAGGFSANSYTA 207
           Y GWDPRYR+KVRVVCARAYHALFMTNMLIRPTE+EL  F EPDFTVWNAG F AN++T 
Sbjct: 118 YAGWDPRYRIKVRVVCARAYHALFMTNMLIRPTEQELAEFGEPDFTVWNAGQFPANTHTT 177

Query: 208 DMTSKTSVEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPIHHNILTLHSSANEGIEKK 267
            MTSKT+VEINFK MEMIILGTEYAGEMKKGIFTVMFYLMP++HN+LTLHSSAN+GI   
Sbjct: 178 GMTSKTTVEINFKEMEMIILGTEYAGEMKKGIFTVMFYLMPVNHNVLTLHSSANQGIADN 237

Query: 268 DVTVFFGLSGTGKTTLSADPNRLLIGDDEHCWSDHGVFNIEGGCYAKCIGLTREKEPEIF 327
           DVT+FFGLSGTGKTTLSADP+RLLIGDDEHCWSDHGVFNIEGGCYAKCIGL+ EKEPEI+
Sbjct: 238 DVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCIGLSAEKEPEIY 297

Query: 328 DAIRFGSVLENVTYNELNHKVDYNDCAITENTRCAYPIDYIKSAKIPCLANSHPKNLILL 387
           +AI+FGSVLENV YN    +VDY D +ITENTRCAYPIDYI SAKIPCLA++HP N++LL
Sbjct: 298 NAIKFGSVLENVIYNPQTREVDYEDSSITENTRCAYPIDYIPSAKIPCLADNHPSNIVLL 357

Query: 388 TCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALHPIT 447
           TCDASGVLPPVS+LTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALHP+ 
Sbjct: 358 TCDASGVLPPVSRLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALHPMK 417

Query: 448 YATMLAKKMDQYKSNAWLINTGWTGSSYSAGGSRCPLKYTRAILDAIHDGTLANENYETL 507
           YATMLA+KM ++ +NAWLINTGWTGSSY +GG RCPLKYTRAILD+IHDG+LA E YETL
Sbjct: 418 YATMLAEKMAKHNANAWLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLAKEKYETL 477

Query: 508 PVFNLQIPTHVNGVPNEILNPENSWNSPANKNNISYNKAVNKLAALFVENFKIYQDKATD 567
           P FNL+IPT VN VP+E+LNP  +W     K    Y  AV  LA LFVENFK YQD+AT 
Sbjct: 478 PTFNLEIPTRVNNVPSELLNPAKNWIEGEAK----YTSAVQNLAQLFVENFKTYQDRATS 533

Query: 568 DVLAAGPQV 576
            VL+AGPQ+
Sbjct: 534 QVLSAGPQL 542

>ZYRO0B16456g Chr2 (1334967..1336613) [1647 bp, 548 aa] {ON} highly
           similar to uniprot|P10963 Saccharomyces cerevisiae
           YKR097W PCK1 Phosphoenolpyruvate carboxykinase key
           enzyme in gluconeogenesis catalyzes early reaction in
           carbohydrate biosynthesis glucose represses
           transcription and accelerates mRNA degradation regulated
           by Mcm1p and Cat8p located in the cytosol
          Length = 548

 Score =  879 bits (2271), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 412/540 (76%), Positives = 460/540 (85%), Gaps = 8/540 (1%)

Query: 36  MEDQLLSQLNWDGSKDSSLINIKHNPSAAILYEDALKEPKTVISSSGALIAYSGAKTGRS 95
           +E+Q+  +L    +  S ++ I+HN  AA LYED LKE KT + SSGAL AYSG+KTGRS
Sbjct: 16  VEEQIRKEL----ALGSEVVTIRHNAPAATLYEDGLKEKKTAVVSSGALAAYSGSKTGRS 71

Query: 96  PKDKRIVYEDGSKDNVWWGPVNKPCSEKTWQINRERTLDYLGTRSNLYVIDAYVGWDPRY 155
           PKDKRI+ E+ SK+ VWWGPVNKP SEKTW INRER  DYL TR +LY+IDAY GWDPRY
Sbjct: 72  PKDKRIIEEETSKNEVWWGPVNKPASEKTWSINRERAADYLRTRDHLYIIDAYAGWDPRY 131

Query: 156 RLKVRVVCARAYHALFMTNMLIRPTEEELKNFNEPDFTVWNAGGFSANSYTADMTSKTSV 215
           R+KVRV+CARAYHALFMTNMLIRP+ EEL NF EPDFTVWNAG F AN  T  MTSKT+V
Sbjct: 132 RIKVRVICARAYHALFMTNMLIRPSPEELANFGEPDFTVWNAGQFPANRNTEGMTSKTTV 191

Query: 216 EINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPIHHNILTLHSSANEGIEKKDVTVFFGL 275
           EINFKAMEMIILGTEYAGEMKKGIFTVMFYLMP+HHN+LTLHSSAN+GIE+ DVT+FFGL
Sbjct: 192 EINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGIERGDVTLFFGL 251

Query: 276 SGTGKTTLSADPNRLLIGDDEHCWSDHGVFNIEGGCYAKCIGLTREKEPEIFDAIRFGSV 335
           SGTGKTTLSADP+R LIGDDEHCWSDHGVFNIEGGCYAKCI LT EKEPEI++AI+FGSV
Sbjct: 252 SGTGKTTLSADPHRALIGDDEHCWSDHGVFNIEGGCYAKCIDLTAEKEPEIYNAIKFGSV 311

Query: 336 LENVTYNELNHKVDYNDCAITENTRCAYPIDYIKSAKIPCLANSHPKNLILLTCDASGVL 395
           LENV ++  N +VDY D +ITENTRCAYPIDYI SAKIPCLA+ HP N++LLTCDASGVL
Sbjct: 312 LENVVFDASNREVDYTDNSITENTRCAYPIDYIPSAKIPCLADKHPSNIVLLTCDASGVL 371

Query: 396 PPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALHPITYATMLAKK 455
           PPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPE TFSSCFGQPFLALHP+ YATMLAKK
Sbjct: 372 PPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPETTFSSCFGQPFLALHPMRYATMLAKK 431

Query: 456 MDQYKSNAWLINTGWTGSSYSAGGSRCPLKYTRAILDAIHDGTLANENYETLPVFNLQIP 515
           M Q+ +NAWL+NTGWTGSSY+AGG RCPLKYTRAILD+IHDG+L+  +YETLP+FNL  P
Sbjct: 432 MHQHNANAWLVNTGWTGSSYTAGGKRCPLKYTRAILDSIHDGSLSKADYETLPIFNLHTP 491

Query: 516 THVNGVPNEILNPENSWNSPANKNNISYNKAVNKLAALFVENFKIYQDKATDDVLAAGPQ 575
             VNGVP+ +LNP  SW     K    YN AV  LA  F ENFKIYQD+AT DVLAAGPQ
Sbjct: 492 AKVNGVPDSLLNPAKSWVEGPTK----YNSAVKTLATKFTENFKIYQDQATPDVLAAGPQ 547

>NCAS0A03160 Chr1 complement(619303..620961) [1659 bp, 552 aa] {ON}
           Anc_5.708 YKR097W
          Length = 552

 Score =  878 bits (2268), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 406/523 (77%), Positives = 463/523 (88%), Gaps = 4/523 (0%)

Query: 54  LINIKHNPSAAILYEDALKEPKTVISSSGALIAYSGAKTGRSPKDKRIVYEDGSKDNVWW 113
           +  I+ N  AA+LYEDAL E KTVI+SSGALIAYSG+KTGRSP+DKRIV E+ SKDNVWW
Sbjct: 34  VTTIRRNAPAAVLYEDALHERKTVIASSGALIAYSGSKTGRSPRDKRIVEEETSKDNVWW 93

Query: 114 GPVNKPCSEKTWQINRERTLDYLGTRSNLYVIDAYVGWDPRYRLKVRVVCARAYHALFMT 173
           GPVNKPCSEKTW INRER  DYL TR +LY++DA+ GWDP+YR+KVRVVCARAYHA+FMT
Sbjct: 94  GPVNKPCSEKTWTINRERAADYLRTRDHLYIVDAFAGWDPKYRIKVRVVCARAYHAIFMT 153

Query: 174 NMLIRPTEEELKNFNEPDFTVWNAGGFSANSYTADMTSKTSVEINFKAMEMIILGTEYAG 233
           NMLIRPT+EEL  F EPDFT+WNAG F AN  T DM+SKT++EINFKAMEMIILGTEYAG
Sbjct: 154 NMLIRPTQEELATFGEPDFTIWNAGQFPANKNTQDMSSKTTIEINFKAMEMIILGTEYAG 213

Query: 234 EMKKGIFTVMFYLMPIHHNILTLHSSANEGIEKKDVTVFFGLSGTGKTTLSADPNRLLIG 293
           EMKKGIFTVMFYLMP++HNILTLHSSAN+GI+  DVT+FFGLSGTGKTTLSADP+RLLIG
Sbjct: 214 EMKKGIFTVMFYLMPVYHNILTLHSSANQGIQNGDVTLFFGLSGTGKTTLSADPHRLLIG 273

Query: 294 DDEHCWSDHGVFNIEGGCYAKCIGLTREKEPEIFDAIRFGSVLENVTYNELNHKVDYNDC 353
           DDEHCWSD GVFNIEGGCYAKCI L+ EKEPEIF+AI++GS+LENV Y++    VDY+D 
Sbjct: 274 DDEHCWSDTGVFNIEGGCYAKCINLSAEKEPEIFNAIKYGSILENVIYDKNTRVVDYDDT 333

Query: 354 AITENTRCAYPIDYIKSAKIPCLANSHPKNLILLTCDASGVLPPVSKLTPEQVMYHFISG 413
           +ITENTRCAYPI+YI SAKIPCLA+SHPKN+ILLTCDASGVLPPVSKLTPEQVMYHFISG
Sbjct: 334 SITENTRCAYPIEYIPSAKIPCLADSHPKNIILLTCDASGVLPPVSKLTPEQVMYHFISG 393

Query: 414 YTSKMAGTEQGVTEPEATFSSCFGQPFLALHPITYATMLAKKMDQYKSNAWLINTGWTGS 473
           YTSKMAGTE+GVTEPE+TFSSCFGQPFLALHPI YATMLA+K+  + ++AWLINTGWTGS
Sbjct: 394 YTSKMAGTEEGVTEPESTFSSCFGQPFLALHPIRYATMLAEKISHHSADAWLINTGWTGS 453

Query: 474 SYSAGGSRCPLKYTRAILDAIHDGTLANENYETLPVFNLQIPTHVNGVPNEILNPENSWN 533
           SY  GG RCPLKYTRAILD+IHDG+LA ++YETLP+FNL +PT VNGVP EILNP  +W+
Sbjct: 454 SYVNGGKRCPLKYTRAILDSIHDGSLAKQSYETLPIFNLSVPTAVNGVPKEILNPAKNWS 513

Query: 534 SPANKNNISYNKAVNKLAALFVENFKIYQDKATDDVLAAGPQV 576
               K    Y+ AV+KL +LFVENFK YQD+AT DVLAAGPQ+
Sbjct: 514 EGEAK----YSTAVSKLGSLFVENFKTYQDRATPDVLAAGPQI 552

>TPHA0E00170 Chr5 complement(16873..18609) [1737 bp, 578 aa] {ON}
           Anc_5.708 YKR097W
          Length = 578

 Score =  872 bits (2254), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 408/536 (76%), Positives = 461/536 (86%), Gaps = 4/536 (0%)

Query: 39  QLLSQLNWDGSKDSSLINIKHNPSAAILYEDALKEPKTVISSSGALIAYSGAKTGRSPKD 98
           +LL +   D   +  LINIK NP  A LYED LKE KT +SS+GALIAYSG KTGRSPKD
Sbjct: 45  KLLEEFISDNLSNHQLINIKRNPPVATLYEDGLKENKTTLSSTGALIAYSGVKTGRSPKD 104

Query: 99  KRIVYEDGSKDNVWWGPVNKPCSEKTWQINRERTLDYLGTRSNLYVIDAYVGWDPRYRLK 158
           KRIV E+ SKDN+WWGPVNK CSE+TW INRER +DYL TR  LYVIDA+VGWDPRYR+K
Sbjct: 105 KRIVEEELSKDNIWWGPVNKQCSERTWAINRERAVDYLNTRDTLYVIDAFVGWDPRYRIK 164

Query: 159 VRVVCARAYHALFMTNMLIRPTEEELKNFNEPDFTVWNAGGFSANSYTADMTSKTSVEIN 218
           +RVVCARAYHALFM NMLIRPT+EEL+NF +PDFTVWNAG F ANS T DM+SKTSVEIN
Sbjct: 165 IRVVCARAYHALFMNNMLIRPTKEELENFGKPDFTVWNAGQFFANSLTNDMSSKTSVEIN 224

Query: 219 FKAMEMIILGTEYAGEMKKGIFTVMFYLMPIHHNILTLHSSANEGIEKKDVTVFFGLSGT 278
           FK MEM ILGTEYAGEMKKGIFTVMFYLMPI+HN+LTLHSSAN+     DVT+FFGLSGT
Sbjct: 225 FKEMEMTILGTEYAGEMKKGIFTVMFYLMPIYHNVLTLHSSANQENNNGDVTLFFGLSGT 284

Query: 279 GKTTLSADPNRLLIGDDEHCWSDHGVFNIEGGCYAKCIGLTREKEPEIFDAIRFGSVLEN 338
           GKTTLSADP+R LIGDDEHCWSD+GVFNIEGGCYAKCIGL++EKEP+IF+AI+FGSVLEN
Sbjct: 285 GKTTLSADPHRQLIGDDEHCWSDNGVFNIEGGCYAKCIGLSKEKEPDIFNAIKFGSVLEN 344

Query: 339 VTYNELNHKVDYNDCAITENTRCAYPIDYIKSAKIPCLANSHPKNLILLTCDASGVLPPV 398
             Y+E  H+VDY++  ITENTRCAYPIDYI +AKIPCLA+ HP NLILLTCDASGVLPPV
Sbjct: 345 CIYDEETHEVDYDNSTITENTRCAYPIDYISNAKIPCLADKHPTNLILLTCDASGVLPPV 404

Query: 399 SKLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALHPITYATMLAKKMDQ 458
           SKLTPEQVMYHFISGYTSKMAGTE GVTEP+ TFSSCFGQPFLALHP+ YA+MLA+KMD+
Sbjct: 405 SKLTPEQVMYHFISGYTSKMAGTEVGVTEPQPTFSSCFGQPFLALHPMKYASMLAEKMDK 464

Query: 459 YKSNAWLINTGWTGSSYSAGGSRCPLKYTRAILDAIHDGTLANENYETLPVFNLQIPTHV 518
           +K+NAWL+NTGWTGSSY +GGSRCPLKYTRAILDAIHDG+L NE YETLP+FNLQIP + 
Sbjct: 465 HKANAWLLNTGWTGSSYVSGGSRCPLKYTRAILDAIHDGSLQNEEYETLPIFNLQIPKNA 524

Query: 519 NGVPNEILNPENSWNSPANKNNISYNKAVNKLAALFVENFKIYQDKATDDVLAAGP 574
           NGVP+E+LNP  SW   +      Y  AV +L  LF ENFK Y+DKAT++V+ AGP
Sbjct: 525 NGVPSELLNPAGSWTDSSE----DYMTAVQRLGKLFNENFKTYEDKATNEVIKAGP 576

>Kpol_1043.75 s1043 (162051..163727) [1677 bp, 558 aa] {ON}
           (162051..163727) [1677 nt, 559 aa]
          Length = 558

 Score =  871 bits (2250), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 404/522 (77%), Positives = 455/522 (87%), Gaps = 4/522 (0%)

Query: 55  INIKHNPSAAILYEDALKEPKTVISSSGALIAYSGAKTGRSPKDKRIVYEDGSKDNVWWG 114
           I IK NP  A LYED LKE  T +SS+GAL+AYSG KTGRSPKDKRIV E  SKDN+WWG
Sbjct: 41  ITIKRNPPIAELYEDGLKEDSTTLSSTGALMAYSGVKTGRSPKDKRIVEEPSSKDNIWWG 100

Query: 115 PVNKPCSEKTWQINRERTLDYLGTRSNLYVIDAYVGWDPRYRLKVRVVCARAYHALFMTN 174
           PVNKPCSE TW INRER +DYL TR  LYVIDAY GWD  YR+K+RVVCAR YHALFM N
Sbjct: 101 PVNKPCSELTWSINRERAIDYLNTRKILYVIDAYAGWDANYRIKIRVVCARPYHALFMNN 160

Query: 175 MLIRPTEEELKNFNEPDFTVWNAGGFSANSYTADMTSKTSVEINFKAMEMIILGTEYAGE 234
           MLIRPT EEL+NF EPDFT+WNAG F ANS T DMTSKTS+EINFK+MEM+ILGTEYAGE
Sbjct: 161 MLIRPTTEELENFGEPDFTIWNAGSFYANSLTKDMTSKTSIEINFKSMEMVILGTEYAGE 220

Query: 235 MKKGIFTVMFYLMPIHHNILTLHSSANEGIEKKDVTVFFGLSGTGKTTLSADPNRLLIGD 294
           MKKGIFTVMFYLMP++HN+LTLHSSAN+G+   DVT+FFGLSGTGKTTLSADP+R LIGD
Sbjct: 221 MKKGIFTVMFYLMPVYHNVLTLHSSANQGVNNGDVTLFFGLSGTGKTTLSADPHRELIGD 280

Query: 295 DEHCWSDHGVFNIEGGCYAKCIGLTREKEPEIFDAIRFGSVLENVTYNELNHKVDYNDCA 354
           DEHCWSDHGVFNIEGGCYAKCIGLT EKEPEIF+AI+FGSVLEN  Y+E  H VDY+D  
Sbjct: 281 DEHCWSDHGVFNIEGGCYAKCIGLTEEKEPEIFNAIKFGSVLENCVYDENTHVVDYDDSR 340

Query: 355 ITENTRCAYPIDYIKSAKIPCLANSHPKNLILLTCDASGVLPPVSKLTPEQVMYHFISGY 414
           ITENTRCAYPID+I+SAKIPCL + HP NLILLTCDASGVLPPVSKLTPEQVMYHFISGY
Sbjct: 341 ITENTRCAYPIDFIESAKIPCLTDKHPTNLILLTCDASGVLPPVSKLTPEQVMYHFISGY 400

Query: 415 TSKMAGTEQGVTEPEATFSSCFGQPFLALHPITYATMLAKKMDQYKSNAWLINTGWTGSS 474
           TSKMAGTEQGVTEPE TFS+CFGQPFLALHP+ YA MLA KM+ +K++AWLINTGWTG+S
Sbjct: 401 TSKMAGTEQGVTEPEPTFSACFGQPFLALHPMKYAQMLADKMNHHKASAWLINTGWTGAS 460

Query: 475 YSAGGSRCPLKYTRAILDAIHDGTLANENYETLPVFNLQIPTHVNGVPNEILNPENSWNS 534
           Y+AGG RCPLKYTRAILDAIH+G+LANE YETLPVFNL IP +V  VP+E+LNP  +W+ 
Sbjct: 461 YTAGGKRCPLKYTRAILDAIHNGSLANEEYETLPVFNLPIPKNVENVPSELLNPSKTWSD 520

Query: 535 PANKNNISYNKAVNKLAALFVENFKIYQDKATDDVLAAGPQV 576
           P    +++Y++AV KL +LFV+NF IYQD+ATDDV+AAGP +
Sbjct: 521 P----DVTYSQAVKKLGSLFVQNFTIYQDQATDDVIAAGPAL 558

>NDAI0E05080 Chr5 (1165969..1167624) [1656 bp, 551 aa] {ON}
           Anc_5.708 YKR097W
          Length = 551

 Score =  870 bits (2247), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 406/541 (75%), Positives = 466/541 (86%), Gaps = 8/541 (1%)

Query: 36  MEDQLLSQLNWDGSKDSSLINIKHNPSAAILYEDALKEPKTVISSSGALIAYSGAKTGRS 95
           +E ++  +L  D SKD  +  I+ N  AAILYEDAL E  T+ISS+GAL+AYSG KTGRS
Sbjct: 19  VEQKIRQEL--DLSKD--VTTIRRNAPAAILYEDALHERNTIISSTGALVAYSGEKTGRS 74

Query: 96  PKDKRIVYEDGSKDNVWWGPVNKPCSEKTWQINRERTLDYLGTRSNLYVIDAYVGWDPRY 155
           P+DKRIV E+ SKD++WWGPVNKPCSE+TW INRER  DYL TR +LY++DA+ GWDP Y
Sbjct: 75  PRDKRIVEEETSKDDIWWGPVNKPCSERTWSINRERAADYLRTRDHLYIVDAFAGWDPEY 134

Query: 156 RLKVRVVCARAYHALFMTNMLIRPTEEELKNFNEPDFTVWNAGGFSANSYTADMTSKTSV 215
           R+KVRVVCARAYHALFMTNMLIRPT+EEL  F EPDFTVWNAG F AN +T DM+SKT++
Sbjct: 135 RIKVRVVCARAYHALFMTNMLIRPTQEELAEFGEPDFTVWNAGQFPANFHTQDMSSKTTI 194

Query: 216 EINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPIHHNILTLHSSANEGIEKKDVTVFFGL 275
           EINFKAMEM+ILGTEYAGEMKKGIFTVMFYLMP+HHNILTLHSSAN+GI   DVT+FFGL
Sbjct: 195 EINFKAMEMVILGTEYAGEMKKGIFTVMFYLMPVHHNILTLHSSANQGIRNGDVTLFFGL 254

Query: 276 SGTGKTTLSADPNRLLIGDDEHCWSDHGVFNIEGGCYAKCIGLTREKEPEIFDAIRFGSV 335
           SGTGKTTLSADP+RLLIGDDEHCWSD GVFNIEGGCYAKCI L+ EKEPEIF+AI++GS+
Sbjct: 255 SGTGKTTLSADPHRLLIGDDEHCWSDKGVFNIEGGCYAKCINLSHEKEPEIFEAIKYGSI 314

Query: 336 LENVTYNELNHKVDYNDCAITENTRCAYPIDYIKSAKIPCLANSHPKNLILLTCDASGVL 395
           LENV Y+     V Y+D  +TENTRCAYPI++I SAKIPCLA++HP N+ILLTCDASGVL
Sbjct: 315 LENVIYDPKTRVVHYDDSTLTENTRCAYPIEFIPSAKIPCLADTHPSNIILLTCDASGVL 374

Query: 396 PPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALHPITYATMLAKK 455
           PPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPE TFSSCFGQPFLALHPI YATMLAKK
Sbjct: 375 PPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALHPIRYATMLAKK 434

Query: 456 MDQYKSNAWLINTGWTGSSYSAGGSRCPLKYTRAILDAIHDGTLANENYETLPVFNLQIP 515
           + ++ +NAWLINTGWTGSSY +GG RCPLKYTRAILD+IHDG+LA + +ETLPVFNLQ+P
Sbjct: 435 ISKHSANAWLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLAKQEFETLPVFNLQVP 494

Query: 516 THVNGVPNEILNPENSWNSPANKNNISYNKAVNKLAALFVENFKIYQDKATDDVLAAGPQ 575
           T+VN VP E+LNP  +W     K    YN AV+ LA+LFVENFKIYQDKAT +VLAA P+
Sbjct: 495 TNVNNVPKELLNPAKNWAQGEAK----YNAAVSNLASLFVENFKIYQDKATPEVLAAAPR 550

Query: 576 V 576
           +
Sbjct: 551 I 551

>KLLA0A00484g Chr1 complement(40330..41961) [1632 bp, 543 aa] {ON}
           highly similar to uniprot|P10963 Saccharomyces
           cerevisiae YKR097W PCK1 Phosphoenolpyruvate
           carboxykinase key enzyme in gluconeogenesis catalyzes
           early reaction in carbohydrate biosynthesis glucose
           represses transcription and accelerates mRNA degradation
           regulated by Mcm1p and Cat8p located in the cytosol
          Length = 543

 Score =  868 bits (2244), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 407/547 (74%), Positives = 468/547 (85%), Gaps = 9/547 (1%)

Query: 31  KQKLSMEDQLLSQLNWDGSKDSSLINIKHNPSAAILYEDALKEPKTVISSSGALIAYSGA 90
           K + S E+ + ++L       + ++ I+ N  AA+LYEDALKE  T IS++GALIAYSG 
Sbjct: 5   KTQNSAEENIRAELGLS----AEVVTIRRNAPAALLYEDALKERDTAISNAGALIAYSGD 60

Query: 91  KTGRSPKDKRIVYEDGSKDNVWWGPVNKPCSEKTWQINRERTLDYLGTRSNLYVIDAYVG 150
           KTGRSP+DKRIV E+ SKDNVWWGPVNKPCSE+TW+INRER  DYL TR ++Y++DAY G
Sbjct: 61  KTGRSPRDKRIVEEETSKDNVWWGPVNKPCSERTWEINRERAADYLRTRDHIYIVDAYAG 120

Query: 151 WDPRYRLKVRVVCARAYHALFMTNMLIRPTEEELKNFNEPDFTVWNAGGFSANSYTADMT 210
           WDPRYR+KVRVVCARAYHALFMTNMLIRP++EEL+NF EPDFTVWNAG F AN++T+ MT
Sbjct: 121 WDPRYRIKVRVVCARAYHALFMTNMLIRPSKEELENFGEPDFTVWNAGQFPANTHTSGMT 180

Query: 211 SKTSVEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPIHHNILTLHSSANEGIEKKDVT 270
           SKT+VEINFK MEM+ILGTEYAGEMKKGIFTVMFYLMP++HN+LTLHSSAN+GI+  DVT
Sbjct: 181 SKTTVEINFKQMEMVILGTEYAGEMKKGIFTVMFYLMPVNHNVLTLHSSANQGIQDNDVT 240

Query: 271 VFFGLSGTGKTTLSADPNRLLIGDDEHCWSDHGVFNIEGGCYAKCIGLTREKEPEIFDAI 330
           +FFGLSGTGKTTLSADP+RLLIGDDEHCWSDHGVFNIEGGCYAKC+GL+ EKEPEIF+AI
Sbjct: 241 LFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCLGLSAEKEPEIFNAI 300

Query: 331 RFGSVLENVTYNELNHKVDYNDCAITENTRCAYPIDYIKSAKIPCLANSHPKNLILLTCD 390
           +FGSVLEN+ Y+    +VDY D  ITENTRCAYPI+YI SAKIPCLA+ HPKN++LLTCD
Sbjct: 301 KFGSVLENIIYDPNTREVDYEDSTITENTRCAYPIEYIPSAKIPCLADHHPKNIVLLTCD 360

Query: 391 ASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALHPITYAT 450
           ASGVLPPVSKLTP+QVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFL+LHP+ YAT
Sbjct: 361 ASGVLPPVSKLTPDQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLSLHPMKYAT 420

Query: 451 MLAKKMDQYKSNAWLINTGWTGSSYSAGGSRCPLKYTRAILDAIHDGTLANENYETLPVF 510
           MLA+KM ++ +NAWLINTGWTGSSY AGG RCPLKYTRAILDAIHDG+LA E YE LP+F
Sbjct: 421 MLAEKMAEHNANAWLINTGWTGSSYVAGGKRCPLKYTRAILDAIHDGSLAKEEYEVLPIF 480

Query: 511 NLQIPTHV-NGVPNEILNPENSWNSPANKNNISYNKAVNKLAALFVENFKIYQDKATDDV 569
           NLQIP  V + VP  +LNP  +W     K    Y   V  LA LFVENFK YQDKAT+ V
Sbjct: 481 NLQIPKAVGDKVPASLLNPSKNWAEGEAK----YTSNVKSLANLFVENFKTYQDKATEQV 536

Query: 570 LAAGPQV 576
           LAAGPQ+
Sbjct: 537 LAAGPQL 543

>KLTH0E00902g Chr5 complement(88552..90186) [1635 bp, 544 aa] {ON}
           highly similar to uniprot|P10963 Saccharomyces
           cerevisiae YKR097W PCK1 Phosphoenolpyruvate
           carboxykinase key enzyme in gluconeogenesis catalyzes
           early reaction in carbohydrate biosynthesis glucose
           represses transcription and accelerates mRNA degradation
           regulated by Mcm1p and Cat8p located in the cytosol
          Length = 544

 Score =  861 bits (2225), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 401/548 (73%), Positives = 461/548 (84%), Gaps = 8/548 (1%)

Query: 27  PSLKKQKLSMEDQLLSQLNWDGSKDSSLINIKHNPSAAILYEDALKEPKTVISSSGALIA 86
           P+  +  +S +D +  +L    +    ++ I+ N  AA+LYEDALKE KT I+SSGALIA
Sbjct: 3   PTKTRNHVSAKDHIRQEL----ALGEEVVTIRRNAPAALLYEDALKENKTTIASSGALIA 58

Query: 87  YSGAKTGRSPKDKRIVYEDGSKDNVWWGPVNKPCSEKTWQINRERTLDYLGTRSNLYVID 146
           +SG+KTGRSPKDKRIV E  S  N+WWGPVNK CSEKTW +NRER  DYL TR +LY++D
Sbjct: 59  FSGSKTGRSPKDKRIVDEPTSTHNIWWGPVNKKCSEKTWLVNRERAADYLRTRDHLYIVD 118

Query: 147 AYVGWDPRYRLKVRVVCARAYHALFMTNMLIRPTEEELKNFNEPDFTVWNAGGFSANSYT 206
           AY GWDPRYR+K+RVVCARAYHALFMTNMLIRPT+EEL+NF EPDFTVWNAG F AN++T
Sbjct: 119 AYAGWDPRYRIKIRVVCARAYHALFMTNMLIRPTKEELENFGEPDFTVWNAGQFPANTHT 178

Query: 207 ADMTSKTSVEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPIHHNILTLHSSANEGIEK 266
             MTSKT+VEINF+ MEM+ILGTEYAGEMKKGIFTVMFYLMP++HN+LTLHSSAN+GI  
Sbjct: 179 DGMTSKTTVEINFQKMEMVILGTEYAGEMKKGIFTVMFYLMPVNHNVLTLHSSANQGIRD 238

Query: 267 KDVTVFFGLSGTGKTTLSADPNRLLIGDDEHCWSDHGVFNIEGGCYAKCIGLTREKEPEI 326
           +DVT+FFGLSGTGKTTLSADP R LIGDDEHCWSDHGVFNIEGGCYAKCIGLT  KEPEI
Sbjct: 239 QDVTLFFGLSGTGKTTLSADPARKLIGDDEHCWSDHGVFNIEGGCYAKCIGLTEAKEPEI 298

Query: 327 FDAIRFGSVLENVTYNELNHKVDYNDCAITENTRCAYPIDYIKSAKIPCLANSHPKNLIL 386
           F+AI+FGSVLENV Y+ L   VDY DC ITENTRCAYPI+YI SAKIPCLANSHPKN++L
Sbjct: 299 FNAIKFGSVLENVAYDPLTRVVDYEDCEITENTRCAYPIEYIPSAKIPCLANSHPKNIVL 358

Query: 387 LTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALHPI 446
           LTCDASGVLPPVSKLTP QVMYHFISGYTSK+AGTE+GVTEPEATFSSCFGQPFLALHP+
Sbjct: 359 LTCDASGVLPPVSKLTPAQVMYHFISGYTSKVAGTEEGVTEPEATFSSCFGQPFLALHPL 418

Query: 447 TYATMLAKKMDQYKSNAWLINTGWTGSSYSAGGSRCPLKYTRAILDAIHDGTLANENYET 506
            YATMLA+KM Q+++NAWLINTGWTG+S+  GG+RCPLKYTRAILDA+HDG+LA E++ET
Sbjct: 419 KYATMLAEKMSQHRANAWLINTGWTGASFVDGGNRCPLKYTRAILDAVHDGSLAQEDFET 478

Query: 507 LPVFNLQIPTHVNGVPNEILNPENSWNSPANKNNISYNKAVNKLAALFVENFKIYQDKAT 566
           LP F L +P HVN VP  ILNP  +W     K    Y   V  LA LF ENFK YQD+A+
Sbjct: 479 LPTFRLHVPRHVNNVPEHILNPAKNWFEGETK----YKHRVGALAKLFTENFKKYQDRAS 534

Query: 567 DDVLAAGP 574
            DV++AGP
Sbjct: 535 ADVISAGP 542

>KAFR0H00160 Chr8 complement(16235..17884) [1650 bp, 549 aa] {ON}
           Anc_5.708 YKR097W
          Length = 549

 Score =  861 bits (2225), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 396/526 (75%), Positives = 467/526 (88%), Gaps = 5/526 (0%)

Query: 52  SSLINIKHNPSAAILYEDALKEPK-TVISSSGALIAYSGAKTGRSPKDKRIVYEDGSKDN 110
           S +  I+ N   ++LYEDALK+ K T+ISS+GALIAYSG KTGR PKDKRIV E  SK++
Sbjct: 28  SGVTTIRRNAPVSVLYEDALKDEKNTIISSTGALIAYSGEKTGRCPKDKRIVEESDSKED 87

Query: 111 VWWGPVNKPCSEKTWQINRERTLDYLGTRSNLYVIDAYVGWDPRYRLKVRVVCARAYHAL 170
           +WWGPVNKPCSE+TW+INRER  DYL TR ++Y++DA+ GWDP+YR+KVRVVCARAYHAL
Sbjct: 88  IWWGPVNKPCSERTWEINRERAADYLRTREHIYIVDAFAGWDPKYRIKVRVVCARAYHAL 147

Query: 171 FMTNMLIRPTEEELKNFNEPDFTVWNAGGFSANSYTADMTSKTSVEINFKAMEMIILGTE 230
           FMTNMLIRPT++EL+NF +PDFTVWNAG F AN +T DM+SKT++EINFKAMEMIILGTE
Sbjct: 148 FMTNMLIRPTKDELENFGDPDFTVWNAGQFPANFHTEDMSSKTTIEINFKAMEMIILGTE 207

Query: 231 YAGEMKKGIFTVMFYLMPIHHNILTLHSSANEGIEKKDVTVFFGLSGTGKTTLSADPNRL 290
           YAGEMKKGIFTVMFYLMPIHHN+LTLHSSANEGIEKKDVT+FFGLSGTGKTTLSADP+RL
Sbjct: 208 YAGEMKKGIFTVMFYLMPIHHNVLTLHSSANEGIEKKDVTLFFGLSGTGKTTLSADPHRL 267

Query: 291 LIGDDEHCWSDHGVFNIEGGCYAKCIGLTREKEPEIFDAIRFGSVLENVTYNELNHKVDY 350
           LIGDDEHCWSD GVFNIEGGCYAKCI L+ EKEPEIF++I+FGS+LENV Y+  + +VDY
Sbjct: 268 LIGDDEHCWSDTGVFNIEGGCYAKCINLSVEKEPEIFNSIKFGSILENVVYDPKSREVDY 327

Query: 351 NDCAITENTRCAYPIDYIKSAKIPCLANSHPKNLILLTCDASGVLPPVSKLTPEQVMYHF 410
           +D +ITENTRCAYPI++I SAKIPC+ANSHPKN+ILLTCDASGVLPPVSKLT +QVMYHF
Sbjct: 328 DDSSITENTRCAYPIEFIPSAKIPCIANSHPKNIILLTCDASGVLPPVSKLTSDQVMYHF 387

Query: 411 ISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALHPITYATMLAKKMDQYKSNAWLINTGW 470
           ISGYTSKMAGTEQGVTEP+ TFSSCFGQPFLALHP+ YATMLA+KM+++K+NAWLINTGW
Sbjct: 388 ISGYTSKMAGTEQGVTEPQPTFSSCFGQPFLALHPMKYATMLAEKMEKHKANAWLINTGW 447

Query: 471 TGSSYSAGGSRCPLKYTRAILDAIHDGTLANENYETLPVFNLQIPTHVNGVPNEILNPEN 530
           TGSSY AGG RCPL YTRAILDAIHDG+L  E++ETLP+FNL++P +VN VP ++LNP  
Sbjct: 448 TGSSYIAGGKRCPLPYTRAILDAIHDGSLEKESFETLPIFNLKVPKNVNNVPTKLLNPSK 507

Query: 531 SWNSPANKNNISYNKAVNKLAALFVENFKIYQDKATDDVLAAGPQV 576
           +W     +  + Y+ AV KL+ LF+ENFK Y+DKAT +VLAAGP++
Sbjct: 508 NW----YEGELKYSGAVKKLSKLFIENFKTYEDKATKEVLAAGPRL 549

>Ecym_4013 Chr4 complement(31078..32706) [1629 bp, 542 aa] {ON}
           similar to Ashbya gossypii AFR292W
          Length = 542

 Score =  858 bits (2217), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 405/542 (74%), Positives = 463/542 (85%), Gaps = 8/542 (1%)

Query: 35  SMEDQLLSQLNWDGSKDSSLINIKHNPSAAILYEDALKEPKTVISSSGALIAYSGAKTGR 94
           S E+++ S+L       S ++ I+ N  AA+LYEDAL E  T ISS+GALIAYSG KTGR
Sbjct: 9   SPEEKIRSELGLS----SGVLIIRRNAPAALLYEDALLERNTAISSTGALIAYSGEKTGR 64

Query: 95  SPKDKRIVYEDGSKDNVWWGPVNKPCSEKTWQINRERTLDYLGTRSNLYVIDAYVGWDPR 154
           SPKDKRIV E  S + VWWGPVN+  SE+TW INRER +DYL TR +LY++DA+ GWDPR
Sbjct: 65  SPKDKRIVDEPTSANKVWWGPVNRKVSERTWDINRERAVDYLRTREHLYIVDAFAGWDPR 124

Query: 155 YRLKVRVVCARAYHALFMTNMLIRPTEEELKNFNEPDFTVWNAGGFSANSYTADMTSKTS 214
           YR+K+R+VC RAYHALFMTNMLIRPTEEEL  F EPDFTVWNAG F AN++T  M+SKT+
Sbjct: 125 YRIKIRIVCCRAYHALFMTNMLIRPTEEELAEFGEPDFTVWNAGQFPANTHTEGMSSKTT 184

Query: 215 VEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPIHHNILTLHSSANEGIEKKDVTVFFG 274
           VEINFKAMEM+ILGTEYAGEMKKGIFTVMFYLMPI+HN+LTLHSSAN+GI K DVT+FFG
Sbjct: 185 VEINFKAMEMVILGTEYAGEMKKGIFTVMFYLMPINHNVLTLHSSANQGIAKGDVTLFFG 244

Query: 275 LSGTGKTTLSADPNRLLIGDDEHCWSDHGVFNIEGGCYAKCIGLTREKEPEIFDAIRFGS 334
           LSGTGKTTLSAD +RLLIGDDEHCWSD+GVFNIEGGCYAKCIGL+ EKEPEIF+AIR+GS
Sbjct: 245 LSGTGKTTLSADQHRLLIGDDEHCWSDYGVFNIEGGCYAKCIGLSAEKEPEIFNAIRYGS 304

Query: 335 VLENVTYNELNHKVDYNDCAITENTRCAYPIDYIKSAKIPCLANSHPKNLILLTCDASGV 394
           VLENV Y  ++  VDY+D +ITENTRCAYPI+YI SAKIPCL+NSHP N++LLTCDASGV
Sbjct: 305 VLENVVYEPVSRVVDYDDSSITENTRCAYPIEYIPSAKIPCLSNSHPSNIVLLTCDASGV 364

Query: 395 LPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALHPITYATMLAK 454
           LPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALHP+ YATMLA+
Sbjct: 365 LPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALHPMKYATMLAE 424

Query: 455 KMDQYKSNAWLINTGWTGSSYSAGGSRCPLKYTRAILDAIHDGTLANENYETLPVFNLQI 514
           KM Q+ +NAWLINTGWTG+SY +GG RCPLKYTRAILDAIH G+LAN +YETLPVF L I
Sbjct: 425 KMSQHNANAWLINTGWTGASYVSGGKRCPLKYTRAILDAIHGGSLANADYETLPVFGLSI 484

Query: 515 PTHVNGVPNEILNPENSWNSPANKNNISYNKAVNKLAALFVENFKIYQDKATDDVLAAGP 574
           P  V GVP+E+LNP  +W     K    Y+KAV  LA LFV+NFKIYQD+AT +VL AGP
Sbjct: 485 PRAVEGVPSELLNPSRNWVEGEEK----YSKAVTSLANLFVQNFKIYQDQATKEVLYAGP 540

Query: 575 QV 576
           Q+
Sbjct: 541 QL 542

>Kwal_55.19663 s55 complement(70935..72569) [1635 bp, 544 aa] {ON}
           YKR097W (PCK1) - phosphoenolpyruvate carboxylkinase
           [contig 159] FULL
          Length = 544

 Score =  844 bits (2180), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 396/548 (72%), Positives = 454/548 (82%), Gaps = 8/548 (1%)

Query: 27  PSLKKQKLSMEDQLLSQLNWDGSKDSSLINIKHNPSAAILYEDALKEPKTVISSSGALIA 86
           PS  +  +S++D++  +L    +    ++ I+ N  AA+LYEDALKE KT IS+SGALIA
Sbjct: 3   PSKIRNLVSVKDRIRKEL----ALGEEVVTIRRNAPAALLYEDALKENKTRISASGALIA 58

Query: 87  YSGAKTGRSPKDKRIVYEDGSKDNVWWGPVNKPCSEKTWQINRERTLDYLGTRSNLYVID 146
           +SG+KTGRSPKDKRIV E  S  N+WWGPVNK CSEKTW +NRER  D+L TR +LY++D
Sbjct: 59  FSGSKTGRSPKDKRIVDEPTSSQNIWWGPVNKKCSEKTWLVNRERAADFLRTRDHLYIVD 118

Query: 147 AYVGWDPRYRLKVRVVCARAYHALFMTNMLIRPTEEELKNFNEPDFTVWNAGGFSANSYT 206
           AY GWDPRYR+K+RVVCARAYHALFMTNMLI+PT +EL+ F EPDFTVWNAG F AN++T
Sbjct: 119 AYAGWDPRYRIKIRVVCARAYHALFMTNMLIQPTPQELEEFGEPDFTVWNAGQFPANTHT 178

Query: 207 ADMTSKTSVEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPIHHNILTLHSSANEGIEK 266
             MTSKT++EINF+ MEM+ILGTEYAGEMKKGIFTVMFYLMPI+H +LTLHSSAN+GI  
Sbjct: 179 DGMTSKTTIEINFQKMEMVILGTEYAGEMKKGIFTVMFYLMPINHGVLTLHSSANQGIRD 238

Query: 267 KDVTVFFGLSGTGKTTLSADPNRLLIGDDEHCWSDHGVFNIEGGCYAKCIGLTREKEPEI 326
            DVT+FFGLSGTGKTTLSADP R LIGDDEHCWSDHGVFNIEGGCYAKCIGLT  KEPEI
Sbjct: 239 NDVTLFFGLSGTGKTTLSADPARKLIGDDEHCWSDHGVFNIEGGCYAKCIGLTEAKEPEI 298

Query: 327 FDAIRFGSVLENVTYNELNHKVDYNDCAITENTRCAYPIDYIKSAKIPCLANSHPKNLIL 386
           F+AIRFGSVLENV Y+    +VD+ +C ITENTRCAYPI+YI SAKIPCLA+ HPKN++L
Sbjct: 299 FNAIRFGSVLENVAYDSFTREVDFENCEITENTRCAYPIEYIPSAKIPCLADEHPKNIVL 358

Query: 387 LTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALHPI 446
           LTCDASGVLPPVSKLTPEQVMYHFISGYTSK+AGTE+GVTEPEATFSSCFGQPFLALHP+
Sbjct: 359 LTCDASGVLPPVSKLTPEQVMYHFISGYTSKVAGTEEGVTEPEATFSSCFGQPFLALHPL 418

Query: 447 TYATMLAKKMDQYKSNAWLINTGWTGSSYSAGGSRCPLKYTRAILDAIHDGTLANENYET 506
            YATMLA KM  +K++AWLINTGWTG S+  GG RCPLKYTRAILDAIHDGTLA E YET
Sbjct: 419 KYATMLADKMSHHKADAWLINTGWTGQSFVDGGDRCPLKYTRAILDAIHDGTLAKEEYET 478

Query: 507 LPVFNLQIPTHVNGVPNEILNPENSWNSPANKNNISYNKAVNKLAALFVENFKIYQDKAT 566
           LP FNL IP HVN VP+ ILNP  SW     K    Y   V  LA LFVENFK Y+  A+
Sbjct: 479 LPTFNLHIPLHVNNVPSNILNPARSWVGGEAK----YKTKVRTLANLFVENFKKYEANAS 534

Query: 567 DDVLAAGP 574
            +++ AGP
Sbjct: 535 TEIMCAGP 542

>AFR292W Chr6 (965578..967203) [1626 bp, 541 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YKR097W (PCK1)
          Length = 541

 Score =  843 bits (2179), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 393/525 (74%), Positives = 449/525 (85%), Gaps = 5/525 (0%)

Query: 52  SSLINIKHNPSAAILYEDALKEPKTVISSSGALIAYSGAKTGRSPKDKRIVYEDGSKDNV 111
           S ++ I+ N  AA+LYEDAL E KT ISS+GALIAYSG KTGRSPKDKRIV E  S DN+
Sbjct: 22  SGVLTIRRNAPAAVLYEDALAERKTAISSTGALIAYSGEKTGRSPKDKRIVDEPTSSDNI 81

Query: 112 WWGPVNKPCSEKTWQINRERTLDYLGTRSNLYVIDAYVGWDPRYRLKVRVVCARAYHALF 171
           WWGPVN+  SEKTW INRER  D+L TR +LY++DAY GWDPRYR+K+R+VC RAYHALF
Sbjct: 82  WWGPVNRKASEKTWLINRERAADFLRTREHLYIVDAYAGWDPRYRIKIRIVCCRAYHALF 141

Query: 172 MTNMLIRPTEEELKNFNEPDFTVWNAGGFSANSYTADMTSKTSVEINFKAMEMIILGTEY 231
           MTNMLIRPTEEEL  F EPDFTVWNAG F AN++T  M+SKT+VEINF+AMEM+ILGTEY
Sbjct: 142 MTNMLIRPTEEELAEFGEPDFTVWNAGQFPANTHTEGMSSKTTVEINFRAMEMVILGTEY 201

Query: 232 AGEMKKGIFTVMFYLMPIHHNILTLHSSANEGIEKKDVTVFFGLSGTGKTTLSADPNRLL 291
           AGEMKKGIFTVMFYLMPI+HN+LTLHSSAN+G    DVT+FFGLSGTGKTTLSAD +R L
Sbjct: 202 AGEMKKGIFTVMFYLMPINHNVLTLHSSANQG-PNNDVTLFFGLSGTGKTTLSADQHRKL 260

Query: 292 IGDDEHCWSDHGVFNIEGGCYAKCIGLTREKEPEIFDAIRFGSVLENVTYNELNHKVDYN 351
           IGDDEHCWSD+GVFNIEGGCYAKCIGL+ EKEPEIF+AI++GSVLENV Y+ +   VDY 
Sbjct: 261 IGDDEHCWSDYGVFNIEGGCYAKCIGLSGEKEPEIFNAIKYGSVLENVVYDPVTRVVDYE 320

Query: 352 DCAITENTRCAYPIDYIKSAKIPCLANSHPKNLILLTCDASGVLPPVSKLTPEQVMYHFI 411
           D +ITENTRCAYPI+YI SA+IPCL+ +HP N++LLTCDASGVLPPVS+LTPEQVMYHFI
Sbjct: 321 DSSITENTRCAYPIEYIPSAQIPCLSENHPSNIVLLTCDASGVLPPVSRLTPEQVMYHFI 380

Query: 412 SGYTSKMAGTEQGVTEPEATFSSCFGQPFLALHPITYATMLAKKMDQYKSNAWLINTGWT 471
           SGYTSKMAGTEQGVTEPEATFSSCFGQPFLALHP+ YATMLA+KM Q+ ++AWLINTGWT
Sbjct: 381 SGYTSKMAGTEQGVTEPEATFSSCFGQPFLALHPMKYATMLAEKMSQHNASAWLINTGWT 440

Query: 472 GSSYSAGGSRCPLKYTRAILDAIHDGTLANENYETLPVFNLQIPTHVNGVPNEILNPENS 531
           GSSY+AGG RCPLKYTRAILD+IHDGTLA   YETLPVF L IP  V GVP E+LNP  +
Sbjct: 441 GSSYTAGGKRCPLKYTRAILDSIHDGTLAQAEYETLPVFGLSIPKAVEGVPAELLNPAKN 500

Query: 532 WNSPANKNNISYNKAVNKLAALFVENFKIYQDKATDDVLAAGPQV 576
           W     K    Y  AV+ LA+ F ENFKIYQD+AT++V+ AGPQ+
Sbjct: 501 WVEGEGK----YASAVSALASKFTENFKIYQDQATEEVVRAGPQI 541

>Suva_7.275 Chr7
           complement(476201..476281,476285..476410,476414..476494)
           [288 bp, 96 aa] {ON} YKR097W (REAL)
          Length = 96

 Score = 63.5 bits (153), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 45/113 (39%), Positives = 59/113 (52%), Gaps = 22/113 (19%)

Query: 401 LTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALHPITYATMLAKKMDQYK 460
           LT E+VMYHF SG+ S   G         +       +PFLALHPI+Y T++A KM  + 
Sbjct: 1   LTSEEVMYHFNSGHASN--GRNWAGCHLTSNVLLVLVKPFLALHPISYITVIATKM--FA 56

Query: 461 SNAWLINTGWTGSSYSAGGSRCPLKYTRAILDAIHDGTLANE-----NYETLP 508
            +A+LINTG+             LK TR   D+IHD +LA E      Y+ LP
Sbjct: 57  HSAYLINTGYA------------LK-TRVNFDSIHDDSLAKELFRAPTYKCLP 96

>TBLA0G03070 Chr7 complement(812624..816067) [3444 bp, 1147 aa] {ON}
           Anc_3.258 YBR050C
          Length = 1147

 Score = 32.3 bits (72), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 23/35 (65%)

Query: 481 RCPLKYTRAILDAIHDGTLANENYETLPVFNLQIP 515
           R P+ YTR+  +  H  +++++N+E L   N+QIP
Sbjct: 23  RVPIPYTRSKSNTTHYQSISSKNHELLQKNNMQIP 57

>TBLA0B00100 Chr2 (2396..7549) [5154 bp, 1717 aa] {ON} Anc_2.1 YNL242W
          Length = 1717

 Score = 31.6 bits (70), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 24/65 (36%), Positives = 33/65 (50%), Gaps = 10/65 (15%)

Query: 359  TRCAYPIDYI------KSAKIPCLANSHPKNLILLTCDASGVLPPVSKLTPEQVMYHFIS 412
            T  A  +DY+       S K+ CL  S     ILLT +AS    P S     +++YH+IS
Sbjct: 953  TALALILDYLIINGSLSSLKVKCLLKSGT---ILLTDNASTSSKPPSNKQSNRMLYHYIS 1009

Query: 413  -GYTS 416
             GYT+
Sbjct: 1010 QGYTT 1014

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.133    0.405 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 62,545,433
Number of extensions: 2879829
Number of successful extensions: 8276
Number of sequences better than 10.0: 28
Number of HSP's gapped: 8432
Number of HSP's successfully gapped: 28
Length of query: 576
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 461
Effective length of database: 40,294,809
Effective search space: 18575906949
Effective search space used: 18575906949
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 68 (30.8 bits)