Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0E016905.709ON48848824800.0
Kpol_2001.775.709ON41333510201e-135
NDAI0F002405.709ON46434810021e-131
NCAS0G002005.709ON4384179861e-129
ZYRO0B16478g5.709ON3913549561e-125
Suva_9.355.709ON3933359451e-124
YIL153W (RRD1)5.709ON3933349411e-123
TDEL0B021105.709ON3893389401e-123
Skud_9.155.709ON4023409371e-122
KLTH0E00880g5.709ON3713609261e-121
SAKL0E15070g5.709ON3853539281e-121
Smik_9.165.709ON3933349261e-121
CAGL0H06655g5.709ON4244459041e-117
Ecym_40125.709ON3953408921e-116
TPHA0D046505.709ON4213378921e-115
Kwal_55.196615.709ON3713398841e-115
KAFR0D021905.709ON4263398861e-114
AFR293C5.709ON3653418471e-109
KLLA0A00462g5.709ON3533647831e-100
KNAG0L021705.709ON3963577744e-98
NCAS0C016908.674ON3593183897e-42
Ecym_23998.674ON3513173826e-41
SAKL0H06622g8.674ON3553163827e-41
KAFR0H024408.674ON3533173792e-40
NDAI0E024108.674ON3592653774e-40
ZYRO0F07326g8.674ON3522603764e-40
Kpol_1013.48.674ON3583183731e-39
KLLA0F11187g8.674ON3603153722e-39
TBLA0C018608.674ON3562753695e-39
Kwal_26.87838.674ON3553163678e-39
CAGL0M02255g8.674ON3583153688e-39
ACR139C8.674ON3593143608e-38
KLTH0D11176g8.674ON3533173601e-37
TDEL0A062008.674ON3552653582e-37
TPHA0D012408.674ON3593213555e-37
Skud_16.1308.674ON3582363538e-37
Suva_16.1588.674ON3582673521e-36
KNAG0J016908.674ON3633173531e-36
Smik_6.3498.674ON3582433442e-35
YPL152W (RRD2)8.674ON3582673432e-35
Kpol_1058.148.20ON941130761.0
ZYRO0B03058g7.379ON11674711.2
Kpol_1003.72.232ON249371742.2
KLTH0H14256g1.457ON1264161723.2
YHL035C (VMR1)4.6ON159286723.8
TPHA0N012106.180ON1274188697.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0E01690
         (488 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0E01690 Chr5 (406884..408350) [1467 bp, 488 aa] {ON} Anc_5.7...   959   0.0  
Kpol_2001.77 s2001 complement(211870..213111) [1242 bp, 413 aa] ...   397   e-135
NDAI0F00240 Chr6 (46047..47441) [1395 bp, 464 aa] {ON} Anc_5.709      390   e-131
NCAS0G00200 Chr7 (29159..30475) [1317 bp, 438 aa] {ON} Anc_5.709      384   e-129
ZYRO0B16478g Chr2 complement(1336755..1337930) [1176 bp, 391 aa]...   372   e-125
Suva_9.35 Chr9 (49860..51041) [1182 bp, 393 aa] {ON} YIL153W (REAL)   368   e-124
YIL153W Chr9 (55198..56379) [1182 bp, 393 aa] {ON}  RRD1Peptidyl...   367   e-123
TDEL0B02110 Chr2 (376429..377598) [1170 bp, 389 aa] {ON} Anc_5.7...   366   e-123
Skud_9.15 Chr9 (32255..33463) [1209 bp, 402 aa] {ON} YIL153W (REAL)   365   e-122
KLTH0E00880g Chr5 (87353..88468) [1116 bp, 371 aa] {ON} similar ...   361   e-121
SAKL0E15070g Chr5 complement(1253760..1254917) [1158 bp, 385 aa]...   362   e-121
Smik_9.16 Chr9 (32798..33979) [1182 bp, 393 aa] {ON} YIL153W (REAL)   361   e-121
CAGL0H06655g Chr8 complement(661713..662987) [1275 bp, 424 aa] {...   352   e-117
Ecym_4012 Chr4 (29674..30861) [1188 bp, 395 aa] {ON} similar to ...   348   e-116
TPHA0D04650 Chr4 complement(1015658..1016923) [1266 bp, 421 aa] ...   348   e-115
Kwal_55.19661 s55 (69740..70855) [1116 bp, 371 aa] {ON} YIL153W ...   345   e-115
KAFR0D02190 Chr4 (439664..440944) [1281 bp, 426 aa] {ON} Anc_5.7...   345   e-114
AFR293C Chr6 complement(967308..968405) [1098 bp, 365 aa] {ON} S...   330   e-109
KLLA0A00462g Chr1 (38766..39827) [1062 bp, 353 aa] {ON} similar ...   306   e-100
KNAG0L02170 Chr12 complement(388956..390146) [1191 bp, 396 aa] {...   302   4e-98
NCAS0C01690 Chr3 complement(311102..312181) [1080 bp, 359 aa] {O...   154   7e-42
Ecym_2399 Chr2 (778448..779503) [1056 bp, 351 aa] {ON} similar t...   151   6e-41
SAKL0H06622g Chr8 (583484..584551) [1068 bp, 355 aa] {ON} simila...   151   7e-41
KAFR0H02440 Chr8 (467656..468717) [1062 bp, 353 aa] {ON} Anc_8.6...   150   2e-40
NDAI0E02410 Chr5 complement(500623..501702) [1080 bp, 359 aa] {O...   149   4e-40
ZYRO0F07326g Chr6 complement(592906..593964) [1059 bp, 352 aa] {...   149   4e-40
Kpol_1013.4 s1013 complement(5948..7024) [1077 bp, 358 aa] {ON} ...   148   1e-39
KLLA0F11187g Chr6 (1031839..1032921) [1083 bp, 360 aa] {ON} simi...   147   2e-39
TBLA0C01860 Chr3 complement(437987..439057) [1071 bp, 356 aa] {O...   146   5e-39
Kwal_26.8783 s26 complement(941317..942384) [1068 bp, 355 aa] {O...   145   8e-39
CAGL0M02255g Chr13 (270614..271690) [1077 bp, 358 aa] {ON} highl...   146   8e-39
ACR139C Chr3 complement(592864..593943) [1080 bp, 359 aa] {ON} S...   143   8e-38
KLTH0D11176g Chr4 complement(913077..914138) [1062 bp, 353 aa] {...   143   1e-37
TDEL0A06200 Chr1 complement(1085066..1086133) [1068 bp, 355 aa] ...   142   2e-37
TPHA0D01240 Chr4 complement(259089..260168) [1080 bp, 359 aa] {O...   141   5e-37
Skud_16.130 Chr16 (236660..237736) [1077 bp, 358 aa] {ON} YPL152...   140   8e-37
Suva_16.158 Chr16 (274228..275304) [1077 bp, 358 aa] {ON} YPL152...   140   1e-36
KNAG0J01690 Chr10 complement(308576..309667) [1092 bp, 363 aa] {...   140   1e-36
Smik_6.349 Chr6 complement(558150..559226) [1077 bp, 358 aa] {ON...   137   2e-35
YPL152W Chr16 (265028..266104) [1077 bp, 358 aa] {ON}  RRD2Activ...   136   2e-35
Kpol_1058.14 s1058 (45433..48258) [2826 bp, 941 aa] {ON} (45433....    34   1.0  
ZYRO0B03058g Chr2 (249023..249373) [351 bp, 116 aa] {ON} similar...    32   1.2  
Kpol_1003.7 s1003 complement(12681..20162) [7482 bp, 2493 aa] {O...    33   2.2  
KLTH0H14256g Chr8 complement(1238169..1241963) [3795 bp, 1264 aa...    32   3.2  
YHL035C Chr8 complement(27978..32756) [4779 bp, 1592 aa] {ON}  V...    32   3.8  
TPHA0N01210 Chr14 (260932..264756) [3825 bp, 1274 aa] {ON} Anc_6...    31   7.2  

>TBLA0E01690 Chr5 (406884..408350) [1467 bp, 488 aa] {ON} Anc_5.709
           YIL153W
          Length = 488

 Score =  959 bits (2480), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 468/488 (95%), Positives = 468/488 (95%)

Query: 1   MESIPIYKLDSNCVFSAPTKQIFDSQGTQYFNRSIAFHRIQYFISKYTQLIQEENIPPTD 60
           MESIPIYKLDSNCVFSAPTKQIFDSQGTQYFNRSIAFHRIQYFISKYTQLIQEENIPPTD
Sbjct: 1   MESIPIYKLDSNCVFSAPTKQIFDSQGTQYFNRSIAFHRIQYFISKYTQLIQEENIPPTD 60

Query: 61  YTSSNDTISGVSKIINDLIKLVEETPPLPGPRRYGNLSCRQWHKRVDDNINELFEKYLTI 120
           YTSSNDTISGVSKIINDLIKLVEETPPLPGPRRYGNLSCRQWHKRVDDNINELFEKYLTI
Sbjct: 61  YTSSNDTISGVSKIINDLIKLVEETPPLPGPRRYGNLSCRQWHKRVDDNINELFEKYLTI 120

Query: 121 SNTKFNKDQLFLELIYYFNASLGSPTRLDYGTGHELSFLAFIGALDMLNLLTDISGTDIL 180
           SNTKFNKDQLFLELIYYFNASLGSPTRLDYGTGHELSFLAFIGALDMLNLLTDISGTDIL
Sbjct: 121 SNTKFNKDQLFLELIYYFNASLGSPTRLDYGTGHELSFLAFIGALDMLNLLTDISGTDIL 180

Query: 181 FIFNEYYRLIRKLILNYTLEPAGSHGVWGLDDHFHLIYIFGSSQWCPENADMTEPSISEP 240
           FIFNEYYRLIRKLILNYTLEPAGSHGVWGLDDHFHLIYIFGSSQWCPENADMTEPSISEP
Sbjct: 181 FIFNEYYRLIRKLILNYTLEPAGSHGVWGLDDHFHLIYIFGSSQWCPENADMTEPSISEP 240

Query: 241 KFKAPIKPVDILNKNLIEKFKSSNFYCQSILFILTVKTGPFPEHSPILFDIAKNVHNWKK 300
           KFKAPIKPVDILNKNLIEKFKSSNFYCQSILFILTVKTGPFPEHSPILFDIAKNVHNWKK
Sbjct: 241 KFKAPIKPVDILNKNLIEKFKSSNFYCQSILFILTVKTGPFPEHSPILFDIAKNVHNWKK 300

Query: 301 VRSGLLKMYMVEVLNKFPVVQHFWFGTGFYPWINSSTLMKLPTYELAPDDNNTTYTINKP 360
           VRSGLLKMYMVEVLNKFPVVQHFWFGTGFYPWINSSTLMKLPTYELAPDDNNTTYTINKP
Sbjct: 301 VRSGLLKMYMVEVLNKFPVVQHFWFGTGFYPWINSSTLMKLPTYELAPDDNNTTYTINKP 360

Query: 361 TDLSKSGSKKTLENMLNTDKEKIDPNSCVTTTINHGSNRAKQPTLSSSNISTRKQARIPN 420
           TDLSKSGSKKTLENMLNTDKEKIDPNSCVTTTINHGSNRAKQPTLSSSNISTRKQARIPN
Sbjct: 361 TDLSKSGSKKTLENMLNTDKEKIDPNSCVTTTINHGSNRAKQPTLSSSNISTRKQARIPN 420

Query: 421 DMLRSSQMSSEGPTAPLERSTNMITGMNPPSSTSIRHSIXXXXXXXXXXXXXXXXXXXXF 480
           DMLRSSQMSSEGPTAPLERSTNMITGMNPPSSTSIRHSI                    F
Sbjct: 421 DMLRSSQMSSEGPTAPLERSTNMITGMNPPSSTSIRHSILRTNRNSRNNNDRTSNNLSRF 480

Query: 481 RNNANDSK 488
           RNNANDSK
Sbjct: 481 RNNANDSK 488

>Kpol_2001.77 s2001 complement(211870..213111) [1242 bp, 413 aa]
           {ON} complement(211870..213111) [1242 nt, 414 aa]
          Length = 413

 Score =  397 bits (1020), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 191/335 (57%), Positives = 241/335 (71%), Gaps = 18/335 (5%)

Query: 15  FSAPTKQIFDSQGTQYFNRSIAFHRIQYFISKYTQLIQEENIPPTDYTSSNDTISGVSKI 74
           F  P K+I+DSQGT  F  S+A  R++YFISKY +L+   +IP   Y S   T++ + K+
Sbjct: 15  FCLPVKRIYDSQGTSLFQSSVAIFRLKYFISKYIKLVPNVDIPDESYVSEIPTVNKLVKL 74

Query: 75  INDLIKLVEETPPLPGPRRYGNLSCRQWHKRVDDNINELFEKYLTISNTKFN---KDQLF 131
           I++L  LV+ETPP PGPRR+GNLSCR+WHK+VD N+  L  K LT      +   KD + 
Sbjct: 75  ISELSLLVDETPPAPGPRRFGNLSCREWHKKVDLNLKSLLMKMLTDDKQNISSKCKDSV- 133

Query: 132 LELIYYFNASLGSPTRLDYGTGHELSFLAFIGALDMLNLLTD-ISGTDILFIFNEYYRLI 190
           +EL YY   S GS TRLDYGTGHELSF+A I  +DML L T+ I G D+L IFNEYY+L+
Sbjct: 134 VELSYYLGNSFGSSTRLDYGTGHELSFIAVIAGIDMLGLWTENIKGGDLLIIFNEYYKLM 193

Query: 191 RKLILNYTLEPAGSHGVWGLDDHFHLIYIFGSSQWCPENADMTEPSISEPKFKAPIKPVD 250
           +KLIL YTLEPAGSHGVWGLDDHFH  YI GS+QW   N               P+KP+D
Sbjct: 194 KKLILTYTLEPAGSHGVWGLDDHFHFAYILGSAQWSETN-------------NPPLKPMD 240

Query: 251 ILNKNLIEKFKSSNFYCQSILFILTVKTGPFPEHSPILFDIAKNVHNWKKVRSGLLKMYM 310
           I+NK+L+ ++ ++N YC +I FI  VK+GPF EHSP+L+DI+++VHNW KV SGLLKMYM
Sbjct: 241 IVNKDLVCEYANTNMYCSAIKFIDCVKSGPFSEHSPMLYDISQSVHNWSKVESGLLKMYM 300

Query: 311 VEVLNKFPVVQHFWFGTGFYPWINSSTLMKLPTYE 345
           VEVLNKFPVVQHFWFGTG +PWI+++T   LP YE
Sbjct: 301 VEVLNKFPVVQHFWFGTGLFPWIDNNTKKSLPLYE 335

>NDAI0F00240 Chr6 (46047..47441) [1395 bp, 464 aa] {ON} Anc_5.709
          Length = 464

 Score =  390 bits (1002), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 187/348 (53%), Positives = 239/348 (68%), Gaps = 22/348 (6%)

Query: 5   PIYKLDSNCV-FSAPTKQIFDSQGTQYFNRSIAFHRIQYFISKYTQLIQEENIPP--TDY 61
           PIY LD     FS P K+IFDSQ TQ F  SIA  R+++F+ +Y +L+    IPP    Y
Sbjct: 10  PIYLLDLKATNFSLPVKRIFDSQTTQDFQSSIALQRLRFFLQRYIELVANVEIPPHPDSY 69

Query: 62  TSSNDTISGVSKIINDLIKLVEETPPLPGPRRYGNLSCRQWHKRVDDNINELFEKYLTIS 121
            S    ++ +  ++N+L  +V++TPPL GPRRYGNL+CR WH +++  + +L EK +   
Sbjct: 70  VSEILMVNSIIHLLNELSTIVQDTPPLKGPRRYGNLACRDWHSKIEVELPKLLEKAIPSP 129

Query: 122 NTKFNKDQLFLELIYYFNASLGSPTRLDYGTGHELSFLAFIGALDMLNLLTDISGTDILF 181
           + + +     +EL YY   S GS TRLDYGTGHELSF+AFI ALDML L  D++G D+L 
Sbjct: 130 DLQPS----IIELNYYIANSFGSSTRLDYGTGHELSFMAFIAALDMLGLFPDLTGKDLLI 185

Query: 182 IFNEYYRLIRKLILNYTLEPAGSHGVWGLDDHFHLIYIFGSSQWCPENADMTEPSISEPK 241
           +FN YY L+R+LIL YTLEPAGSHGVWGLDDHFHL YI GSSQW                
Sbjct: 186 MFNAYYSLVRELILTYTLEPAGSHGVWGLDDHFHLAYILGSSQWLN-------------- 231

Query: 242 FKAPIKPVDILNKNLIEKFKSSNFYCQSILFILTVKTGPFPEHSPILFDIAKNVHNWKKV 301
             AP+ P +I N  L++ + + N YCQ I F+LTVK+GPF EHSPIL+DI+ +V  W+KV
Sbjct: 232 -NAPLTPKEITNSRLVKDYSTKNLYCQCIEFVLTVKSGPFAEHSPILYDISTSVSAWRKV 290

Query: 302 RSGLLKMYMVEVLNKFPVVQHFWFGTGFYPWINSSTLMKLPTYELAPD 349
           + GL+KMYM EVLNKFPVVQHFWFGTGFYPWIN  TL +LP YE +P+
Sbjct: 291 QRGLIKMYMDEVLNKFPVVQHFWFGTGFYPWINFQTLRELPVYEHSPE 338

>NCAS0G00200 Chr7 (29159..30475) [1317 bp, 438 aa] {ON} Anc_5.709
          Length = 438

 Score =  384 bits (986), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 204/417 (48%), Positives = 263/417 (63%), Gaps = 33/417 (7%)

Query: 15  FSAPTKQIFDSQGTQYFNRSIAFHRIQYFISKYTQLIQEENIPPTDYTSSNDTISGVSKI 74
           FS P K+IFDSQ TQ F  SIA +R+++F+ KY  ++     PP    SS   ++ + ++
Sbjct: 40  FSLPAKRIFDSQTTQDFQSSIALNRLRFFLQKYISMVTNVQTPPEGTLSSVTLVNSIVQL 99

Query: 75  INDLIKLVEETPPLPGPRRYGNLSCRQWHKRVDDNI----NELFEKYL-TISNTKFNKDQ 129
           +N L  L++ETPPL GPRRYGNL+CR WH +++  +    NE+ + YL  +S    +   
Sbjct: 100 LNHLSTLIDETPPLVGPRRYGNLACRDWHTKMEAQLPALLNEILDPYLPKVSGESSSMHP 159

Query: 130 LFLELIYYFNASLGSPTRLDYGTGHELSFLAFIGALDMLNLLTD-ISGTDILFIFNEYYR 188
              EL YY + + GS TRLD+GTGHELSF+AFI A+DML L TD + GTDIL +FN YY 
Sbjct: 160 CIQELNYYISNAFGSSTRLDFGTGHELSFMAFIAAIDMLGLWTDGMQGTDILLLFNTYYA 219

Query: 189 LIRKLILNYTLEPAGSHGVWGLDDHFHLIYIFGSSQWCPENADMTEPSISEPKFKAPIKP 248
           L+RKLIL YTLEPAGSHGVWGLDDHFHL YI GSSQW                  AP++P
Sbjct: 220 LVRKLILTYTLEPAGSHGVWGLDDHFHLAYILGSSQWIR---------------NAPMRP 264

Query: 249 VDILNKNLIEKFKSSNFYCQSILFILTVKTGPFPEHSPILFDIAKNVHNWKKVRSGLLKM 308
            D+ + +L++++  SN YCQ I FI  VK+GPF EHSPIL+DIA +V  W KV+ GL+KM
Sbjct: 265 RDVKDISLVKQYAKSNLYCQCIAFIFQVKSGPFSEHSPILYDIATSVTTWSKVQRGLIKM 324

Query: 309 YMVEVLNKFPVVQHFWFGTGFYPWINSSTLMKLPTYELAPDDNNTTYTINKPTDLSKSGS 368
           YM EVL KFPVVQHFWFG GFYPWIN  T   LP YE +P+D+ T     +  ++ +   
Sbjct: 325 YMDEVLKKFPVVQHFWFGDGFYPWINQHTGKPLPIYEHSPEDDET----EQEREIQQYAP 380

Query: 369 KKTLENM-LNTDKEKIDPNSCVT---TTINHGSNR---AKQPTLSS-SNISTRKQAR 417
               EN  + T K  I     VT   T +   S+R   +  PT+SS    STR QAR
Sbjct: 381 HWHKENAHVRTAKPGITAMPSVTNTRTNMAPPSSRMMNSHDPTISSLLKRSTRDQAR 437

>ZYRO0B16478g Chr2 complement(1336755..1337930) [1176 bp, 391 aa]
           {ON} similar to uniprot|P40454 Saccharomyces cerevisiae
           YIL153W RRD1 Resistant to Rapamycin Deletion
          Length = 391

 Score =  372 bits (956), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 185/354 (52%), Positives = 239/354 (67%), Gaps = 26/354 (7%)

Query: 10  DSNCVFSAPTKQIFDSQGTQYFNRSIAFHRIQYFISKYTQLIQEENIP--PTDYTSSNDT 67
           + N  F+ P K+IFDSQ T  F  S+A  R++YFI KY ++I   NIP  P+  +  N+ 
Sbjct: 6   NENTQFNTPVKRIFDSQCTLEFQASVAIVRLKYFIQKYAKIINRVNIPQGPSRISVVNEF 65

Query: 68  ISGVSKIINDLIKLVEETPPLPGPRRYGNLSCRQWHKRVDDNINELFEKYLTISNTKFNK 127
           +     ++N +  LV++TPPL GPRRYGNL+CR WH ++D+ +  L+ K L     +F+ 
Sbjct: 66  VG----VLNHMSLLVDQTPPLEGPRRYGNLACRDWHAKIDEQMPSLWRKVLP---DRFH- 117

Query: 128 DQLFLELIYYFNASLGSPTRLDYGTGHELSFLAFIGALDMLNLLTD-ISGTDILFIFNEY 186
               +EL++Y   S GS TRLDYGTGHELSFLA +GA+DML L TD   G D L I N Y
Sbjct: 118 -HCIVELVHYLGNSFGSATRLDYGTGHELSFLAVVGAIDMLGLFTDEFQGEDFLLIMNAY 176

Query: 187 YRLIRKLILNYTLEPAGSHGVWGLDDHFHLIYIFGSSQWCPENADMTEPSISEPKFKAPI 246
           Y ++RKLIL YTLEPAGSHGVWGLDDHFHL Y+FGS+QW    A+  E         AP+
Sbjct: 177 YAVVRKLILTYTLEPAGSHGVWGLDDHFHLAYVFGSAQW----ANYKE---------APL 223

Query: 247 KPVDILNKNLIEKFKSSNFYCQSILFILTVKTGPFPEHSPILFDIAKNVHNWKKVRSGLL 306
           +P DILN +L++++   N YCQ+I FI  VK GPF EHS +L+D+A  VH W K+ SGL+
Sbjct: 224 RPRDILNHHLVQEYAHLNLYCQTIGFIYQVKRGPFREHSSMLYDLATTVHTWAKLESGLM 283

Query: 307 KMYMVEVLNKFPVVQHFWFGTGFYPWINSSTLMKLPTYELA-PDDNNTTYTINK 359
           KMY VEVLNKFPVVQHFWFGTGFYPW+++ T  +L  Y+ A  D  NT+ T  K
Sbjct: 284 KMYAVEVLNKFPVVQHFWFGTGFYPWVDNQTGKQLLIYDPADADRRNTSSTGGK 337

>Suva_9.35 Chr9 (49860..51041) [1182 bp, 393 aa] {ON} YIL153W (REAL)
          Length = 393

 Score =  368 bits (945), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 174/335 (51%), Positives = 227/335 (67%), Gaps = 18/335 (5%)

Query: 12  NCVFSAPTKQIFDSQGTQYFNRSIAFHRIQYFISKYTQLIQEENIP-PTDYTSSNDTISG 70
           +  FS P K+IFD+Q TQ F  S+A HRI+Y + KYT L+     P P    SS   ++G
Sbjct: 10  HAAFSTPVKRIFDTQTTQDFQSSLAIHRIKYHLHKYTTLMSHCADPDPHATASSIPMVNG 69

Query: 71  VSKIINDLIKLVEETPPLPGPRRYGNLSCRQWHKRVDDNINELFEKYLTISNTKFNKDQL 130
           +  +++   +L+++TPPLPGPRRYGNL+CR+WH ++D ++ +   + L           +
Sbjct: 70  LMAVLDRFAQLIDDTPPLPGPRRYGNLACREWHYKLDAHLAQWLREVLPA-----QYHAV 124

Query: 131 FLELIYYFNASLGSPTRLDYGTGHELSFLAFIGALDMLNLLTDISGTDILFIFNEYYRLI 190
             EL YY   S GS TRLDYGTGHELSF+A + ALD+L L   + GTD+  +F++YY ++
Sbjct: 125 VPELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDLLGLFPHLRGTDVFLLFSKYYAIM 184

Query: 191 RKLILNYTLEPAGSHGVWGLDDHFHLIYIFGSSQWCPENADMTEPSISEPKFKAPIKPVD 250
           R+LIL YTLEPAGSHGVWGLDDHFHL+YI GSSQW   +A            +AP++P D
Sbjct: 185 RRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDA------------QAPLQPRD 232

Query: 251 ILNKNLIEKFKSSNFYCQSILFILTVKTGPFPEHSPILFDIAKNVHNWKKVRSGLLKMYM 310
           +L+K+L+ +++ +NFYCQ I FI  VK GPF EHSPIL+DIA  V  W KV  GLLKMY 
Sbjct: 233 VLDKSLVREYQDTNFYCQGINFINQVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYS 292

Query: 311 VEVLNKFPVVQHFWFGTGFYPWINSSTLMKLPTYE 345
           VEVL KFPVVQHFWFGTGF+PWIN      LP +E
Sbjct: 293 VEVLQKFPVVQHFWFGTGFFPWINVQNGTDLPVFE 327

>YIL153W Chr9 (55198..56379) [1182 bp, 393 aa] {ON}
           RRD1Peptidyl-prolyl cis/trans-isomerase; activator of
           the phosphotyrosyl phosphatase activity of PP2A;
           involved in G1 phase progression, microtubule dynamics,
           bud morphogenesis and DNA repair; required for rapid
           reduction of Sgs1p levels in response to rapamycin;
           subunit of the Tap42p-Sit4p-Rrd1p complex
          Length = 393

 Score =  367 bits (941), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 175/334 (52%), Positives = 231/334 (69%), Gaps = 18/334 (5%)

Query: 12  NCVFSAPTKQIFDSQGTQYFNRSIAFHRIQYFISKYTQLIQEENIP-PTDYTSSNDTISG 70
           +  FS P K+IFD+Q T  F  S+A HRI+Y + KYT LI   + P P    SS   ++G
Sbjct: 10  HATFSTPVKRIFDTQTTLDFQSSLAIHRIKYHLHKYTTLISHCSDPDPHATASSIAMVNG 69

Query: 71  VSKIINDLIKLVEETPPLPGPRRYGNLSCRQWHKRVDDNINELFEKYLTISNTKFNKDQL 130
           +  +++ L  L++ETPPLPGPRRYGNL+CR+WH ++D+ + +  ++ L    ++++  ++
Sbjct: 70  LMGVLDKLAHLIDETPPLPGPRRYGNLACREWHHKLDERLPQWLQEMLP---SEYH--EV 124

Query: 131 FLELIYYFNASLGSPTRLDYGTGHELSFLAFIGALDMLNLLTDISGTDILFIFNEYYRLI 190
             EL YY   S GS TRLDYGTGHELSF+A + ALDML +   + G D+  +FN+YY ++
Sbjct: 125 VPELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDMLGMFPHMRGADVFLLFNKYYTIM 184

Query: 191 RKLILNYTLEPAGSHGVWGLDDHFHLIYIFGSSQWCPENADMTEPSISEPKFKAPIKPVD 250
           R+LIL YTLEPAGSHGVWGLDDHFHL+YI GSSQW   +A            +AP++P +
Sbjct: 185 RRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDA------------QAPLQPRE 232

Query: 251 ILNKNLIEKFKSSNFYCQSILFILTVKTGPFPEHSPILFDIAKNVHNWKKVRSGLLKMYM 310
           IL+K+L+ ++K +NFYCQ I FI  VK GPF EHSPIL+DIA  V  W KV  GLLKMY 
Sbjct: 233 ILDKSLVREYKDTNFYCQGINFINEVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYS 292

Query: 311 VEVLNKFPVVQHFWFGTGFYPWINSSTLMKLPTY 344
           VEVL KFPVVQHFWFGTGF+PW+N      LP +
Sbjct: 293 VEVLKKFPVVQHFWFGTGFFPWVNIQNGTDLPVF 326

>TDEL0B02110 Chr2 (376429..377598) [1170 bp, 389 aa] {ON} Anc_5.709
           YIL153W
          Length = 389

 Score =  366 bits (940), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 180/338 (53%), Positives = 227/338 (67%), Gaps = 21/338 (6%)

Query: 11  SNCVFSAPTKQIFDSQGTQYFNRSIAFHRIQYFISKYTQLIQEENIPPTDYTSSNDTISG 70
           S   F +P K IFDSQG   F +S+A  R++Y + KY ++I  +  P     S  + ++ 
Sbjct: 10  SQTKFESPVKCIFDSQGASDFQQSVAIDRLKYHLEKYARMIHGQ--PIVHEPSGIEVVNR 67

Query: 71  VSKIINDLIKLVEETPPLPGPRRYGNLSCRQWHKRVDDNINELFEKYLTISNTKFNKDQL 130
           V  +++ L +LV+ETPP  GPRRYGNL+CR WH ++D N+ EL ++ L     K      
Sbjct: 68  VVSLLSRLSELVDETPPFSGPRRYGNLACRDWHDKLDANLTELLQQVLPQDYHK-----C 122

Query: 131 FLELIYYFNASLGSPTRLDYGTGHELSFLAFIGALDMLNLLT-DISGTDILFIFNEYYRL 189
             EL YY   S GS TRLDYGTGHELSFLA +GALDML L T + SG D+L +F+ YY+L
Sbjct: 123 IPELSYYLGNSFGSSTRLDYGTGHELSFLAVLGALDMLGLWTSEFSGKDVLLLFDTYYKL 182

Query: 190 IRKLILNYTLEPAGSHGVWGLDDHFHLIYIFGSSQWCPENADMTEPSISEPKFKAPIKPV 249
           +RKLIL YTLEPAGSHGVWGLDDHFH+IYI GSSQW       ++P++       P+ P 
Sbjct: 183 VRKLILTYTLEPAGSHGVWGLDDHFHIIYILGSSQWS------SDPAV-------PMTPR 229

Query: 250 DILNKNLIEKFKSSNFYCQSILFILTVKTGPFPEHSPILFDIAKNVHNWKKVRSGLLKMY 309
           D+ NK L++ +  +N YCQ+I FI  VK+GPF EHS +L+DIA  V  W KV+SGLLKMY
Sbjct: 230 DVKNKVLVQDYADTNLYCQAIDFIFHVKSGPFSEHSSMLYDIASTVQTWSKVQSGLLKMY 289

Query: 310 MVEVLNKFPVVQHFWFGTGFYPWINSSTLMKLPTYELA 347
            VEVL KFPVVQHFWFG GFYPWI+     KLP YE A
Sbjct: 290 YVEVLKKFPVVQHFWFGPGFYPWISDRNGQKLPIYENA 327

>Skud_9.15 Chr9 (32255..33463) [1209 bp, 402 aa] {ON} YIL153W (REAL)
          Length = 402

 Score =  365 bits (937), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 173/340 (50%), Positives = 230/340 (67%), Gaps = 18/340 (5%)

Query: 12  NCVFSAPTKQIFDSQGTQYFNRSIAFHRIQYFISKYTQLIQEENIPPTDYTSSN-DTISG 70
           +  FS P K+IFD+Q T  F  S+A HRI+Y + KYT L+     P     SS+   ++G
Sbjct: 19  HATFSTPVKRIFDTQTTLDFQSSLAIHRIKYHLHKYTTLMSHCPDPDAHAASSSIAMVNG 78

Query: 71  VSKIINDLIKLVEETPPLPGPRRYGNLSCRQWHKRVDDNINELFEKYLTISNTKFNKDQL 130
           +  +++ L +L++ETPPLPGPRRYGNL+CR+WH ++D+++++  ++ L           +
Sbjct: 79  LMGVLDKLAQLIDETPPLPGPRRYGNLACREWHYKLDEHLSQWLQEMLPA-----EYHVV 133

Query: 131 FLELIYYFNASLGSPTRLDYGTGHELSFLAFIGALDMLNLLTDISGTDILFIFNEYYRLI 190
             EL YY   S GS TRLDYGTGHELSF+A + ALD+L +   + G D+  +FN+YY ++
Sbjct: 134 VPELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDLLGVFPHLRGNDVFLLFNKYYTIM 193

Query: 191 RKLILNYTLEPAGSHGVWGLDDHFHLIYIFGSSQWCPENADMTEPSISEPKFKAPIKPVD 250
           R+LIL YTLEPAGSHGVWGLDDHFHL+YI GSSQW   +A            +AP++P +
Sbjct: 194 RRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDA------------RAPLQPRE 241

Query: 251 ILNKNLIEKFKSSNFYCQSILFILTVKTGPFPEHSPILFDIAKNVHNWKKVRSGLLKMYM 310
           +L+K+L+  +K +NFYCQ I FI  VK GPF EHSPIL+DIA  V  W KV  GLLKMY 
Sbjct: 242 VLDKSLVHDYKDTNFYCQGINFINEVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYS 301

Query: 311 VEVLNKFPVVQHFWFGTGFYPWINSSTLMKLPTYELAPDD 350
           VEVL KFPVVQHFWFGTGF+PW+N      LP +E   D+
Sbjct: 302 VEVLKKFPVVQHFWFGTGFFPWVNIQNGTDLPVFEEKEDE 341

>KLTH0E00880g Chr5 (87353..88468) [1116 bp, 371 aa] {ON} similar to
           uniprot|P40454 Saccharomyces cerevisiae YIL153W RRD1
           Resistant to Rapamycin Deletion
          Length = 371

 Score =  361 bits (926), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 175/360 (48%), Positives = 234/360 (65%), Gaps = 25/360 (6%)

Query: 11  SNCVFSAPTKQIFDSQGTQYFNRSIAFHRIQYFISKYTQLIQEENIPPTDYTSSNDTISG 70
           S+  F+ PTK+IFDS+G+  F  S+A  R++ ++ KY   +    IP T   S+N  +  
Sbjct: 9   SSATFTEPTKRIFDSRGSHVFQSSVAMGRLKSYLHKYVSSMSGVKIPET---STNHEVRS 65

Query: 71  VSKIINDLIKLVEETPPLPGPRRYGNLSCRQWHKRVDDNINELFEKYLTISNTKFNKDQL 130
            ++++  L +LV+ TP LPGPRRYGNL+CR WH +VD+++  L  K+L     K      
Sbjct: 66  FAELLKTLSELVDSTPALPGPRRYGNLACRTWHDKVDESLEALLHKFLPEPCHK-----S 120

Query: 131 FLELIYYFNASLGSPTRLDYGTGHELSFLAFIGALDMLNLL-TDISGTDILFIFNEYYRL 189
            +EL YY   + GS  RLDYGTGHELSF A I ALDML +   D   +D+LF+F++YY L
Sbjct: 121 IVELQYYLGNAFGSRERLDYGTGHELSFFAEICALDMLGVWGADFQASDVLFLFDKYYAL 180

Query: 190 IRKLILNYTLEPAGSHGVWGLDDHFHLIYIFGSSQWCPENADMTEPSISEPKFKAPIKPV 249
           +RKL+L YTLEPAGSHGVWGLDDHFHLIYIFG+SQW                  API P 
Sbjct: 181 VRKLVLTYTLEPAGSHGVWGLDDHFHLIYIFGASQWVDGKC-------------APIAPR 227

Query: 250 DILNKNLIEKFKSSNFYCQSILFILTVKTGPFPEHSPILFDIAKNVHNWKKVRSGLLKMY 309
           ++ +K +++++  +NFYCQ+I FI  VK+GPF EHSP+LFDI+++V  W KV+ GLLKMY
Sbjct: 228 EVQDKLIVDEYTKTNFYCQAISFIFQVKSGPFSEHSPMLFDISRSVPTWSKVQRGLLKMY 287

Query: 310 MVEVLNKFPVVQHFWFGTGFYPWINSSTLMKLPTYELAPDDNNTTY---TINKPTDLSKS 366
             EVLNKFPVVQHFWFGTG +PW +      LPTYE + +         T   PT+L+ +
Sbjct: 288 FAEVLNKFPVVQHFWFGTGLFPWTSLGDGYALPTYEASQEAQGQVLQHTTAPAPTNLNSA 347

>SAKL0E15070g Chr5 complement(1253760..1254917) [1158 bp, 385 aa]
           {ON} similar to uniprot|P40454 Saccharomyces cerevisiae
           YIL153W RRD1 Resistant to Rapamycin Deletion
          Length = 385

 Score =  362 bits (928), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 176/353 (49%), Positives = 242/353 (68%), Gaps = 23/353 (6%)

Query: 1   MESIPIYKLD-SNCVFSAPTKQIFDSQGTQYFNRSIAFHRIQYFISKYTQLIQEENIPPT 59
           + +I   K+D S+  F+ P K+IFD+QGTQ F  S+  +R+Q ++ KY  L+  +NIP T
Sbjct: 2   ISTITTPKIDVSHTKFTEPVKKIFDTQGTQDFQSSVTMYRLQSYLHKYITLVGTKNIPST 61

Query: 60  DYTSSNDTISGVSKIINDLIKLVEETPPLPGPRRYGNLSCRQWHKRVDDNINELFEKYLT 119
              S+ND ++  ++II+ L + ++ETPPLPGPRR+GN +CR WH ++  +++ L + ++ 
Sbjct: 62  ---SNNDAVNRFTQIIDALSRTIDETPPLPGPRRFGNFACRTWHVKMRGSLDALLQAFIP 118

Query: 120 ISNTKFNKDQLFLELIYYFNASLGSPTRLDYGTGHELSFLAFIGALDMLNLL-TDISGTD 178
               K++     +E+ YY   + GS  RLDYGTGHELSFLA + A+DML+L  ++ SG D
Sbjct: 119 ---EKYH--VCIVEIRYYLGNAFGSKERLDYGTGHELSFLAVVSAIDMLDLWGSNPSGED 173

Query: 179 ILFIFNEYYRLIRKLILNYTLEPAGSHGVWGLDDHFHLIYIFGSSQWCPENADMTEPSIS 238
           ILF+FN YY L++KLI  YTLEPAGSHGVWGLDDHFHL YI GSSQ  P + +       
Sbjct: 174 ILFLFNGYYTLVKKLIATYTLEPAGSHGVWGLDDHFHLAYILGSSQLAPISHN------- 226

Query: 239 EPKFKAPIKPVDILNKNLIEKFKSSNFYCQSILFILTVKTGPFPEHSPILFDIAKNVHNW 298
                 P++P DIL+++ +E +  +N Y Q+I FI  VK+G F EHSP+L+DIAK V  W
Sbjct: 227 ------PLRPSDILDRHTVEDYAKTNLYFQAIAFIDKVKSGSFSEHSPMLYDIAKTVSTW 280

Query: 299 KKVRSGLLKMYMVEVLNKFPVVQHFWFGTGFYPWINSSTLMKLPTYELAPDDN 351
            KV+ GLLKMY  EVLNKFPVVQHFWFGTGF+PW+N  +   LPTYE   ++N
Sbjct: 281 SKVQRGLLKMYSAEVLNKFPVVQHFWFGTGFFPWVNVKSGAILPTYEANQEEN 333

>Smik_9.16 Chr9 (32798..33979) [1182 bp, 393 aa] {ON} YIL153W (REAL)
          Length = 393

 Score =  361 bits (926), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 174/334 (52%), Positives = 226/334 (67%), Gaps = 18/334 (5%)

Query: 12  NCVFSAPTKQIFDSQGTQYFNRSIAFHRIQYFISKYTQLIQEENIP-PTDYTSSNDTISG 70
           +  FS P K+IFD+Q T  F  S+A HRI+Y + KYT L+     P P    SS    +G
Sbjct: 10  HATFSTPVKRIFDTQTTLDFQSSLAIHRIKYHLHKYTTLMSHCADPDPQAVASSIPMDNG 69

Query: 71  VSKIINDLIKLVEETPPLPGPRRYGNLSCRQWHKRVDDNINELFEKYLTISNTKFNKDQL 130
           + ++++ L  L++ETPPLPGPRRYGNL+CR+WH ++D+ + +   + L           +
Sbjct: 70  LMQVLDKLAHLIDETPPLPGPRRYGNLACREWHHKLDERLPQWLREMLPP-----EYHVV 124

Query: 131 FLELIYYFNASLGSPTRLDYGTGHELSFLAFIGALDMLNLLTDISGTDILFIFNEYYRLI 190
             EL YY   S GS TRLDYGTGHELSF+A + ALD+L +   + GTD+  +FN+YY ++
Sbjct: 125 VPELQYYLGNSFGSSTRLDYGTGHELSFMATVTALDLLGMFPHLRGTDVFLLFNKYYTIM 184

Query: 191 RKLILNYTLEPAGSHGVWGLDDHFHLIYIFGSSQWCPENADMTEPSISEPKFKAPIKPVD 250
           R+LIL YTLEPAGSHGVWGLDDHFHL+YI GSSQW   +A            +AP++P +
Sbjct: 185 RRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDA------------QAPLQPRE 232

Query: 251 ILNKNLIEKFKSSNFYCQSILFILTVKTGPFPEHSPILFDIAKNVHNWKKVRSGLLKMYM 310
           IL+K+L+ ++K++NFYCQ I FI  VK GPF EHSPIL+DIA  V  W KV  GLLKMY 
Sbjct: 233 ILDKSLVREYKNTNFYCQGINFINEVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYS 292

Query: 311 VEVLNKFPVVQHFWFGTGFYPWINSSTLMKLPTY 344
           VEVL KFPVVQHFWFGTGF+PW+N      LP +
Sbjct: 293 VEVLKKFPVVQHFWFGTGFFPWVNIQNGTNLPVF 326

>CAGL0H06655g Chr8 complement(661713..662987) [1275 bp, 424 aa] {ON}
           similar to uniprot|P40454 Saccharomyces cerevisiae
           YIL153w RRD1
          Length = 424

 Score =  352 bits (904), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 188/445 (42%), Positives = 261/445 (58%), Gaps = 30/445 (6%)

Query: 14  VFSAPTKQIFDSQGTQYFNRSIAFHRIQYFISKYTQLIQEENIPPTDYTSSNDTISGVSK 73
           +FS P K+I+DSQG  YF  S A  R++  I KYT L++  ++   + +        V K
Sbjct: 1   MFSEPVKRIYDSQGAYYFQSSEAIRRLEGAIVKYTDLVESRDVADLELSGVVGG---VVK 57

Query: 74  IINDLIKLVEETPPLPGPRRYGNLSCRQWHKRVDDNINELFEKYLTISNTKFNKDQLFLE 133
           +++ L +LV ETPP+PGPRRYGN++CR WH++++  I  L E    IS+   ++ Q  +E
Sbjct: 58  VLDRLDQLVSETPPIPGPRRYGNMACRDWHEKIEREIPGLLEDL--ISSHFPSELQCVVE 115

Query: 134 LIYYFNASLGSPTRLDYGTGHELSFLAFIGALDMLNLLTDISGTDILFIFNEYYRLIRKL 193
           L YY   S GS TRLD+GTGHELSFLA + ALDML    D  G  +L+IF+ YY L+ +L
Sbjct: 116 LRYYLANSFGSATRLDFGTGHELSFLATVAALDMLGASFD--GDQVLYIFDRYYSLVHRL 173

Query: 194 ILNYTLEPAGSHGVWGLDDHFHLIYIFGSSQWCPENADMTEPSISEPKFKAPIKPVDILN 253
           IL+YTLEPAGSHGVWGLDDHFHL YI GSSQWC                K  ++P D+ +
Sbjct: 174 ILSYTLEPAGSHGVWGLDDHFHLAYILGSSQWCNRK-------------KLAMEPNDLSD 220

Query: 254 KNLIEKFKSSNFYCQSILFILTVKTGPFPEHSPILFDIAKNVHNWKKVRSGLLKMYMVEV 313
             L+E++  +N +C+++ F+ TVK+G F EHSP+LFDI+++V  W KVR GL KMY  EV
Sbjct: 221 PVLVEQYSRTNIFCKTLNFVFTVKSGAFREHSPMLFDISRSVRTWAKVRKGLWKMYKDEV 280

Query: 314 LNKFPVVQHFWFGTGFYPWINSSTLMKLPTYELAPDDNNTTYTINKPTDLSKSGSKKTLE 373
           LNKFPV+QHFWFGTGFYPW++      LP YE +PD + T   +      +  G++    
Sbjct: 281 LNKFPVIQHFWFGTGFYPWVDYKNGKPLPNYENSPDIDETN-DLKTQAQANMDGTRVVES 339

Query: 374 NMLNTDKEKIDPNSCVTTTINHGSNRAKQPTLSSSNISTRKQARIPNDMLRSSQMSSEGP 433
             L+   E       +      G+ R+  P     N++TR          RS+    +G 
Sbjct: 340 RFLSPGNETFVRRPQLPQDSGVGTMRSSTPESRLMNVTTRST--------RSTAGPGQGR 391

Query: 434 TAPLERSTNMITGMNPPSSTSIRHS 458
             P   S  ++    P S+TS  H+
Sbjct: 392 MGP-PTSMGIVQTRMPSSTTSQAHA 415

>Ecym_4012 Chr4 (29674..30861) [1188 bp, 395 aa] {ON} similar to
           Ashbya gossypii AFR293C
          Length = 395

 Score =  348 bits (892), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 163/340 (47%), Positives = 228/340 (67%), Gaps = 24/340 (7%)

Query: 15  FSAPTKQIFDSQGTQYFNRSIAFHRIQYFISKYTQLIQEENIPPTDYTSSNDTISG-VSK 73
           FSAP K+IFDS GT  F RS+  +R+Q  + +Y  L+  + +P     S+N ++S  VS 
Sbjct: 10  FSAPVKRIFDSHGTHDFQRSLTMYRLQSHLERYLGLVHNQEVPKV---STNGSVSSFVSI 66

Query: 74  IINDLIKLVEETPPLPG-PRRYGNLSCRQWHKRVDDNINELFEKYLTISNTKFNKDQLFL 132
            ++  ++L++ETPP    PRR+GN++CR WH +V + ++ L+ ++L I       +   +
Sbjct: 67  FLDRFLELIDETPPTTNTPRRFGNMACRDWHAKVQEEMDSLWRRFLPIERDA-AYENCII 125

Query: 133 ELIYYFNASLGSPTRLDYGTGHELSFLAFIGALDMLNLLT------DISGTDILFIFNEY 186
           EL YY   + GSP RLDYGTGHELSFLA + A+DML L         ++GTD+L+++N+Y
Sbjct: 126 ELRYYLGNAFGSPERLDYGTGHELSFLAVVVAVDMLGLWETSESGHGLTGTDLLYLWNKY 185

Query: 187 YRLIRKLILNYTLEPAGSHGVWGLDDHFHLIYIFGSSQWCPENADMTEPSISEPKFKAPI 246
           Y ++ KLIL YTLEPAGSHGVWGLDDH HL YI G+SQW  ++ +            API
Sbjct: 186 YSIVHKLILTYTLEPAGSHGVWGLDDHIHLAYIIGASQWSDKDQN------------API 233

Query: 247 KPVDILNKNLIEKFKSSNFYCQSILFILTVKTGPFPEHSPILFDIAKNVHNWKKVRSGLL 306
           +  DIL+   + +++ +N YC SI F++ VK+GPF +HSP+L+DI++ V  W K  SGL+
Sbjct: 234 QLSDILDMKSLYQYEDTNLYCNSIAFVMKVKSGPFSQHSPMLYDISRTVPTWSKATSGLI 293

Query: 307 KMYMVEVLNKFPVVQHFWFGTGFYPWINSSTLMKLPTYEL 346
           KMY VEVLNKFPVVQHFWFGTGF+PW++    M LP YEL
Sbjct: 294 KMYQVEVLNKFPVVQHFWFGTGFFPWVDMKKGMSLPNYEL 333

>TPHA0D04650 Chr4 complement(1015658..1016923) [1266 bp, 421 aa]
           {ON} Anc_5.709 YIL153W
          Length = 421

 Score =  348 bits (892), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 175/337 (51%), Positives = 218/337 (64%), Gaps = 20/337 (5%)

Query: 15  FSAPTKQIFDSQGTQYFNRSIAFHRIQYFISKYTQLIQEENIPPTDYTSSNDTISGVSKI 74
           FS P K+I+DSQ T  F  SIA +R++Y++ KY  ++    IP   Y S    ++ +S +
Sbjct: 14  FSLPLKRIYDSQSTFTFQSSIAIYRLKYYLHKYINMVHNVEIPDLTYVSEITIVNEMSSL 73

Query: 75  INDLIKLVEETPPLPGPRRYGNLSCRQWHKRVDDNINELFEKYLTISNTKFNKDQL---- 130
           + +L   ++  PP  GPRRYGNL+CR WH  +D  +  L EK L  SN    K +     
Sbjct: 74  LTELSNDIDTIPPFEGPRRYGNLACRNWHSLIDSKVPLLLEKVLGCSNHATEKGEFEKLK 133

Query: 131 --FLELIYYFNASLGSPTRLDYGTGHELSFLAFIGALDMLNLLTD-ISGTDILFIFNEYY 187
              +EL YY   SLGS TRLDYGTGHELSFLA I A+DML L T+   G D+L +F+ YY
Sbjct: 134 GCIIELNYYLCNSLGSATRLDYGTGHELSFLAVIAAMDMLGLWTENFKGVDLLHMFHCYY 193

Query: 188 RLIRKLILNYTLEPAGSHGVWGLDDHFHLIYIFGSSQWCPENADMTEPSISEPKFKAPIK 247
            L++KLI+ YTLEPAGSHGVWGLDDHFHL YI GSSQ   EN +             P  
Sbjct: 194 ELVKKLIVTYTLEPAGSHGVWGLDDHFHLSYILGSSQ-LSENPN------------PPFS 240

Query: 248 PVDILNKNLIEKFKSSNFYCQSILFILTVKTGPFPEHSPILFDIAKNVHNWKKVRSGLLK 307
           P DI+NK ++ ++   NFYC +I FI  VK+GPF EHSPIL+DI+  V++W KV SGL+K
Sbjct: 241 PSDIINKKIVTEYMHKNFYCYTIDFIYKVKSGPFSEHSPILYDISTTVNSWLKVNSGLVK 300

Query: 308 MYMVEVLNKFPVVQHFWFGTGFYPWINSSTLMKLPTY 344
           MYMVEVLNKFPVVQHFWFG GFYPW N  T   L  Y
Sbjct: 301 MYMVEVLNKFPVVQHFWFGEGFYPWKNVKTHKLLDVY 337

>Kwal_55.19661 s55 (69740..70855) [1116 bp, 371 aa] {ON} YIL153W
           (RRD1) - Resistant to Rapamycin Deletion [contig 159]
           FULL
          Length = 371

 Score =  345 bits (884), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 168/339 (49%), Positives = 227/339 (66%), Gaps = 22/339 (6%)

Query: 15  FSAPTKQIFDSQGTQYFNRSIAFHRIQYFISKYTQLIQEENIPPTDYTSSNDTISGVSKI 74
           F+ P K+IFDS+GT  F  S+A  R++  + KY  ++  + IP     +SN  +  + KI
Sbjct: 13  FTEPVKRIFDSRGTHVFQSSVAMIRLKKHLHKYLGMLSGQRIPSE---TSNPNVISLRKI 69

Query: 75  INDLIKLVEETPPLPGPRRYGNLSCRQWHKRVDDNINELFEKYLTISNTKFNKDQLFLEL 134
           ++   KLV+ETP LPGPRRYGNL+CR WH ++++ I E  +++L     K+      +EL
Sbjct: 70  LHFFSKLVDETPALPGPRRYGNLACRDWHDKMEEQIREQLQEFLP---EKYYPS--IVEL 124

Query: 135 IYYFNASLGSPTRLDYGTGHELSFLAFIGALDMLNLL-TDISGTDILFIFNEYYRLIRKL 193
            YY   + GS  RLDYGTGHELSF + I ALDML +  +     D+L++FNEYY L+RKL
Sbjct: 125 AYYLGNAFGSRERLDYGTGHELSFFSVICALDMLGIWGSGFQAKDLLYLFNEYYSLVRKL 184

Query: 194 ILNYTLEPAGSHGVWGLDDHFHLIYIFGSSQWCPENADMTEPSISEPKFKAPIKPVDILN 253
           I  Y+LEPAGSHGVWGLDDHFHLIYIFG+SQW    AD  +   S         P +I +
Sbjct: 185 ITKYSLEPAGSHGVWGLDDHFHLIYIFGASQW----ADSKDAEAS---------PREIQS 231

Query: 254 KNLIEKFKSSNFYCQSILFILTVKTGPFPEHSPILFDIAKNVHNWKKVRSGLLKMYMVEV 313
           K +++++  SNFYCQ+I FI  VK+GPF EHSP+L+DI+++V  W KV+ GLLKMY  EV
Sbjct: 232 KMIVDEYAGSNFYCQAISFIFKVKSGPFSEHSPMLYDISRSVPTWSKVQRGLLKMYFAEV 291

Query: 314 LNKFPVVQHFWFGTGFYPWINSSTLMKLPTYELAPDDNN 352
           LNKFPVVQHFWFGT  +PW ++     LPTYE++ + + 
Sbjct: 292 LNKFPVVQHFWFGTALFPWTSTDGGDVLPTYEVSQETDT 330

>KAFR0D02190 Chr4 (439664..440944) [1281 bp, 426 aa] {ON} Anc_5.709
           YIL153W
          Length = 426

 Score =  345 bits (886), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 176/339 (51%), Positives = 229/339 (67%), Gaps = 32/339 (9%)

Query: 15  FSAPTKQIFDSQGTQYFNRSIAFHRIQYFISKYTQLIQEENIPPTDYTSSNDTISGVSKI 74
           FS P K+IFDSQ TQYF  S+A +R++YF +KY  L++   +P     S N T++ +++ 
Sbjct: 17  FSIPAKRIFDSQTTQYFQHSVANYRLKYFTNKYINLVRGVPLP----VSRNITMT-ITRY 71

Query: 75  INDLI----KLVEETPPLPGPRRYGNLSCRQWHKRVDD----NINELFEKYLTISNTKFN 126
           I DL+    + ++ETPPL  PRR+GNLSCR WH +++      +  + + + TI N    
Sbjct: 72  ILDLLDKCSQFIDETPPLIEPRRFGNLSCRTWHDKINSYLPGELKTIIDNFSTIEN---- 127

Query: 127 KDQLFLELIYYFNASLGSPTRLDYGTGHELSFLAFIGALDMLNLLTDISGTDILFIFNEY 186
            + +F EL YY   S GS TRLDYGTGHELSFLAFI  +DM+ +L D++  D L I+  Y
Sbjct: 128 -ENMFNELNYYLLNSFGSKTRLDYGTGHELSFLAFISCIDMIRMLQDMTADDFLLIWQSY 186

Query: 187 YRLIRKLILNYTLEPAGSHGVWGLDDHFHLIYIFGSSQWCPENADMTEPSISEPKFKAPI 246
           Y L RKLIL YTLEPAGSHGVWGLDDHFHL YIFGSSQ     +D++            +
Sbjct: 187 YNLTRKLILTYTLEPAGSHGVWGLDDHFHLAYIFGSSQLI---SDISH-----------L 232

Query: 247 KPVDILNKNLIEKFKSSNFYCQSILFILTVKTGPFPEHSPILFDIAKNVHNWKKVRSGLL 306
            P DIL K+++ + K +N YCQ+I FI TVK GPF EHSPIL+DI+KNV +W KV  GLL
Sbjct: 233 APKDILKKDVVAEHKENNLYCQAINFIFTVKKGPFNEHSPILYDISKNVKSWSKVLKGLL 292

Query: 307 KMYMVEVLNKFPVVQHFWFGTGFYPWINSSTLMKLPTYE 345
           KMY  EVLNKFPVVQHFWFG GF+PW ++++   LP +E
Sbjct: 293 KMYNDEVLNKFPVVQHFWFGDGFFPWKDNNSGKDLPVFE 331

>AFR293C Chr6 complement(967308..968405) [1098 bp, 365 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL153W
           (RRD1)
          Length = 365

 Score =  330 bits (847), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 160/341 (46%), Positives = 217/341 (63%), Gaps = 25/341 (7%)

Query: 15  FSAPTKQIFDSQGTQYFNRSIAFHRIQYFISKYTQLIQEENIPPTDYTSSNDTISGVSKI 74
           FS P K+IFD+ GT  F +S+  +R+Q  + +Y +L+Q + IP +   S N  +     I
Sbjct: 10  FSPPVKRIFDTAGTHDFQKSLTMYRLQSHLERYLKLVQGQKIPKS---SQNRAVVRFVCI 66

Query: 75  INDLIKLVEETPPLPG-PRRYGNLSCRQWHKRVDDNINELFEKYLTISNTKFNKDQLFLE 133
           +  L  L++ETPP  G  RR+G+L+CR WH R+   ++ L E  L  +  +        E
Sbjct: 67  LERLDALMDETPPRTGSARRFGDLACRDWHDRMQGELDGLLETLLPEAARRSAA-----E 121

Query: 134 LIYYFNASLGSPTRLDYGTGHELSFLAFIGALDMLNLLTD--ISGTDILFIFNEYYRLIR 191
           L YY  ++ GS  RLDYGTGHEL+FLA + ALDML L T+   +G D+L+++  YY L+ 
Sbjct: 122 LRYYLGSAFGSRERLDYGTGHELAFLAVVVALDMLGLWTEDKFTGEDMLYVWARYYALVH 181

Query: 192 KLILNYTLEPAGSHGVWGLDDHFHLIYIFGSSQWCPENADMTEPSISEPKFKAPIKPVDI 251
           +LIL Y LEPAGSHGVWGLDDH HL YI G+SQW  +                P++P DI
Sbjct: 182 RLILTYNLEPAGSHGVWGLDDHLHLAYILGASQWAQDR-------------NVPMQPSDI 228

Query: 252 LNKNLIEKFKSSNFYCQSILFILTVKTGPFPEHSPILFDIAKNVHNWKKVRSGLLKMYMV 311
           L+   + ++  +N YC SI F+L VKTG F +HSP+L DIA+ V  W KV +GL+KMY V
Sbjct: 229 LDPKAVARYSETNLYCNSIAFLLRVKTGHFAQHSPMLHDIAQTVPTWSKVTTGLIKMYRV 288

Query: 312 EVLNKFPVVQHFWFGTGFYPWINSSTLMKLPTYELAPDDNN 352
           EVLNKFPVVQHFWFGTGF+PW++ +  M LP YE AP + +
Sbjct: 289 EVLNKFPVVQHFWFGTGFFPWVDMAHGMSLPNYE-APSETS 328

>KLLA0A00462g Chr1 (38766..39827) [1062 bp, 353 aa] {ON} similar to
           uniprot|P40454 Saccharomyces cerevisiae YIL153W RRD1
           Resistant to Rapamycin Deletion
          Length = 353

 Score =  306 bits (783), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 168/364 (46%), Positives = 218/364 (59%), Gaps = 28/364 (7%)

Query: 12  NCVFSAPTKQIFDSQGTQYFNRSIAFHRIQYFISKYTQLIQEENIPPTDYTSSNDTISGV 71
           N  FS P K+IFDSQGT  F  S+A  RIQY + KY  L + + IP T   S    I  V
Sbjct: 7   NAKFSMPEKRIFDSQGTLDFQNSVAMVRIQYHLQKYITLCKGQQIPDTIKESFFTNI--V 64

Query: 72  SKIINDLIKLVEETPPLPGPRRYGNLSCRQWHKRVDDNINELFEKYLTISNTKFNKDQLF 131
            +++  L  L++ETPP     RYGNLS R W  +  + +     + L     K+N     
Sbjct: 65  VELLKRLSALIDETPPERMHSRYGNLSYRDWQTKFQNQLENWLHELLP---EKYNNS--I 119

Query: 132 LELIYYFNASLGSPTRLDYGTGHELSFLAFIGALDMLNLLTDISGTDILFIFNEYYRLIR 191
           +EL YY + + GS  R+DYGTGHELSFLA I  LDML + T I G  +L+ FN YY +I+
Sbjct: 120 IELSYYISNAFGSKERIDYGTGHELSFLAVIICLDMLKIET-IKGPALLYCFNSYYDVIQ 178

Query: 192 KLILNYTLEPAGSHGVWGLDDHFHLIYIFGSSQWCPENADMTEPSISEPKFKAPIKPVDI 251
           KLIL Y LEPAGSHGVWGLDDHFH  YI G++Q    N  +               P DI
Sbjct: 179 KLILTYKLEPAGSHGVWGLDDHFHFSYILGATQLLDVNTSLI--------------PKDI 224

Query: 252 LNKNLIEKFKSSNFYCQSILFILTVKTGPFPEHSPILFDIAKNVHNWKKVRSGLLKMYMV 311
            N  L+E+  SSN +C+SI FI  VK+GPF  HSP+L++I+++VH W K++ GL+KMY V
Sbjct: 225 SNTRLMEQNSSSNLFCKSIRFINVVKSGPFSNHSPLLYNISRSVHTWHKMQQGLIKMYKV 284

Query: 312 EVLNKFPVVQHFWFGTGFYPWINSSTLMKLPTYELAPDDNNTTY------TINKPTDLSK 365
           EVLNKFPVVQHFWFGT F+PW +      LP Y+ A ++++  +      T   P  LS 
Sbjct: 285 EVLNKFPVVQHFWFGTAFFPWTSYGNNHSLPIYQPAENNDDADFLTANNATTKMPPPLST 344

Query: 366 SGSK 369
           S S+
Sbjct: 345 STSR 348

>KNAG0L02170 Chr12 complement(388956..390146) [1191 bp, 396 aa] {ON}
           Anc_5.709 YIL153W
          Length = 396

 Score =  302 bits (774), Expect = 4e-98,   Method: Compositional matrix adjust.
 Identities = 153/357 (42%), Positives = 215/357 (60%), Gaps = 39/357 (10%)

Query: 12  NCVFSAPTKQIFDSQGTQYFNRSIAFHRIQYFISKYTQLIQEENIPPTDYTSSNDTISGV 71
           + VF  P K+IFDSQ T  F  S+A  RI++ I KY ++++             DT  G+
Sbjct: 20  HAVFRQPQKRIFDSQTTATFQESVALARIRFHIEKYMRMMR------------GDTSGGI 67

Query: 72  S-------KIINDLIKLVEETPPLPGPRRYGNLSCRQWHKRVDDNINELFEKYLTISNTK 124
           S       +I++ L  LV+ETPPL GPRRYGNL+CR WH +VD ++  L  +   ++   
Sbjct: 68  SASVARMLQILDRLDALVDETPPLVGPRRYGNLACRDWHDKVDSSLPGLTSQVDCLAGGG 127

Query: 125 FNKDQLFLELIYYFNASLGSPTRLDYGTGHELSFLAFIGALDMLNLLTDISGTDILFIFN 184
                  +E  YY   S GS  RLDYGTGHELSFLAF+ ALDM++    I+  ++  +++
Sbjct: 128 -----ACIEAEYYLRNSFGSKIRLDYGTGHELSFLAFVAALDMMSQPRGITPVELSRLWD 182

Query: 185 EYYRLIRKLILNYTLEPAGSHGVWGLDDHFHLIYIFGSSQWCPENADMTEPSISEPKFKA 244
            YYRL+R+LI++Y LEPAGSHGVWGLDDHFHL Y++G+SQ+                   
Sbjct: 183 RYYRLVRRLIVDYNLEPAGSHGVWGLDDHFHLAYLWGASQFANNPVG------------- 229

Query: 245 PIKPVDILNKNLIEKFKS-SNFYCQSILFILTVKTGPFPEHSPILFDIAKNVHNWKKVRS 303
            ++P D+L+  +  +  + +NF  ++I F+ +VK GPF E+SP+L DI   V +W+K++ 
Sbjct: 230 -VQPRDVLSGVIPGRDDAPANFLVEAIGFVKSVKHGPFWENSPMLNDILSGVSSWRKIQR 288

Query: 304 GLLKMYMVEVLNKFPVVQHFWFGTGFYPWINSSTLMKLPTYELAPDDNNTTYTINKP 360
           GL +MY  EVLNKFPVVQHFWFGT F+PW +      LP YE + D    T+    P
Sbjct: 289 GLFRMYNAEVLNKFPVVQHFWFGTAFFPWTSVRDGTPLPVYEQSADTEQETFDSGAP 345

>NCAS0C01690 Chr3 complement(311102..312181) [1080 bp, 359 aa] {ON}
           Anc_8.674
          Length = 359

 Score =  154 bits (389), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 107/318 (33%), Positives = 166/318 (52%), Gaps = 35/318 (11%)

Query: 17  APTKQIFDSQGTQYFNRSIAFHRIQYFISKYTQLIQ-EENIPPTDYTSSNDTISGVSKII 75
            P K+I      + +  S     +  FIS   + ++  EN    +  S   +I+ +S ++
Sbjct: 2   VPEKRILTENDMEVWKNSATRKDLLNFISTLAESVEGHENSQIVEPISP--SIASLSSLL 59

Query: 76  NDLIKLVEETPPLPGPR--RYGNLSCRQWHKRVDDNINELFEKYLTISNTKFN--KDQLF 131
           +++ KLV++ P +   +  R+G +  R       D  +EL EK  ++  T+F+   D+  
Sbjct: 60  DEVNKLVDKHPVIKEAKVSRFGKVEFR-------DFYDELNEKSSSLIKTRFSTLSDEQL 112

Query: 132 LELIYYFNASLGSPTRLDYGTGHELSFLAFIGAL---DMLNLLTDISGTDILFIFNEYYR 188
            +L  Y + S G+  R+DYG+GHEL+F+ F+  L    + +L  D     +L +F +Y  
Sbjct: 113 EQLSIYLDESWGNKRRIDYGSGHELNFICFLFGLYSYGLFDLEKDAINL-VLVVFLKYLN 171

Query: 189 LIRKLILNYTLEPAGSHGVWGLDDHFHLIYIFGSSQWCPENADMTEPSISEPKFKAPIKP 248
           ++R L   Y LEPAGSHGVWGLDD+  L ++FG+ Q  P                  +KP
Sbjct: 172 IMRVLETKYWLEPAGSHGVWGLDDYHFLPFLFGAFQLVPHKH---------------LKP 216

Query: 249 VDILNKNLIEKFKSSNFYCQSILFILTVKTG-PFPEHSPILFDIAKNVHNWKKVRSGLLK 307
           + I N+ L+E FK    Y   I FI +VKT      HSP+L DI+  V  W KV  G++K
Sbjct: 217 MSIHNEELVELFKDKFLYFGCISFINSVKTTTSLRWHSPMLDDIS-GVKKWSKVAEGMIK 275

Query: 308 MYMVEVLNKFPVVQHFWF 325
           MY  EVL K P++QHF+F
Sbjct: 276 MYTAEVLGKLPIMQHFYF 293

>Ecym_2399 Chr2 (778448..779503) [1056 bp, 351 aa] {ON} similar to
           Ashbya gossypii ACR139C
          Length = 351

 Score =  151 bits (382), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 102/317 (32%), Positives = 160/317 (50%), Gaps = 29/317 (9%)

Query: 20  KQIFDSQGTQYFNRSIAFHRIQYFISKYTQLIQ-EENIPPTDYTSSNDTISGVSKIINDL 78
           K++      Q +  S  +  +  F+++  + +  +EN       SS   I  +  +++ +
Sbjct: 5   KRLLTEDDLQKWLNSETYESVVSFVTQLGEAVNGKENAAYEQPISSQ--IENLCALLDTV 62

Query: 79  IKLVEETPPL--PGPRRYGNLSCRQWHKRVDDNINELFEKYLTISNTKFNKDQLFLELIY 136
            K+V++ P +   G  R+G +  R ++  V +   EL       S +    D+   EL  
Sbjct: 63  AKIVDKHPVVQDKGTSRFGKVEFRDFYDEVRETTKELIS-----SLSSELTDEQVEELAV 117

Query: 137 YFNASLGSPTRLDYGTGHELSFLAFIGALDMLNLLTDISGTD-ILFIFNEYYRLIRKLIL 195
           YF  S G   R+DYG+GHEL+F+ F+  L   ++L+D    + +L +F +Y  ++R L  
Sbjct: 118 YFTESWGDRKRIDYGSGHELNFICFLYGLTHYSVLSDADKVNLVLKVFIKYLDVMRLLET 177

Query: 196 NYTLEPAGSHGVWGLDDHFHLIYIFGSSQWCPENADMTEPSISEPKFKAPIKPVDILNKN 255
            Y LEPAGSHGVWGLDD+  L ++FG+ Q                     +KP  I N  
Sbjct: 178 KYWLEPAGSHGVWGLDDYHFLPFLFGAFQLTTHKH---------------LKPKSIHNPE 222

Query: 256 LIEKFKSSNFYCQSILFILTVKT-GPFPEHSPILFDIAKNVHNWKKVRSGLLKMYMVEVL 314
           ++E F+    Y + + FI  VKT      HSP+L DI+  V  W KV  G++KMY  EVL
Sbjct: 223 IVEVFEKRYMYFECVAFINKVKTTASLRWHSPMLDDIS-GVRTWSKVAEGMVKMYKAEVL 281

Query: 315 NKFPVVQHFWFGTGFYP 331
            K P++QHF+F T F P
Sbjct: 282 GKLPIMQHFFFST-FLP 297

>SAKL0H06622g Chr8 (583484..584551) [1068 bp, 355 aa] {ON} similar
           to uniprot|Q12461 Saccharomyces cerevisiae YPL152W
          Length = 355

 Score =  151 bits (382), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 104/316 (32%), Positives = 164/316 (51%), Gaps = 29/316 (9%)

Query: 17  APTKQIFDSQGTQYFNRSIAFHRIQYFISKYTQLIQ-EENIPPTDYTSSNDTISGVSKII 75
           AP K++      + +  S  F+ +  FI+K  + ++  EN    +  SS  +I  +  ++
Sbjct: 2   APQKRLLSQHDMEIWTESNTFNELTGFITKLGESVKGRENTQYVEPISS--SIDELCSLL 59

Query: 76  NDLIKLVEETPPL--PGPRRYGNLSCRQWHKRVDDNINELFEKYLTISNTKFNKDQLFLE 133
           + + K+V   P +      R+G +  R ++    D+++    + ++  + K +  Q+  E
Sbjct: 60  DKVNKVVSSHPVIQDANTSRFGKVEFRDFY----DDLSSRSSEMISSLSDKLSTPQV-DE 114

Query: 134 LIYYFNASLGSPTRLDYGTGHELSFLAFIGALDMLNL--LTDISGTDILFIFNEYYRLIR 191
           L  YF  S G+ TR+DYG+GHEL+F+ F+  L+  N   L   +   +L +F +Y  ++R
Sbjct: 115 LAAYFRKSWGNRTRIDYGSGHELNFICFLYGLNKCNFFDLEKDATNVVLRVFIKYLDVMR 174

Query: 192 KLILNYTLEPAGSHGVWGLDDHFHLIYIFGSSQWCPENADMTEPSISEPKFKAPIKPVDI 251
            L   Y LEPAGSHGVWGLDD+  L ++FG+ Q                     +KP  I
Sbjct: 175 TLETKYWLEPAGSHGVWGLDDYHFLPFLFGAFQLATHKH---------------LKPKSI 219

Query: 252 LNKNLIEKFKSSNFYCQSILFILTVKTG-PFPEHSPILFDIAKNVHNWKKVRSGLLKMYM 310
            NK  +E F+    Y   I FI +VKT      HSP+L DI+  V  W KV  G++KMY 
Sbjct: 220 HNKEFVEMFEKRYLYFGCIGFINSVKTSISLRWHSPMLDDIS-GVKTWSKVAEGMVKMYK 278

Query: 311 VEVLNKFPVVQHFWFG 326
            EVL K P++QHF+FG
Sbjct: 279 AEVLGKLPIMQHFYFG 294

>KAFR0H02440 Chr8 (467656..468717) [1062 bp, 353 aa] {ON} Anc_8.674
           YPL152W
          Length = 353

 Score =  150 bits (379), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 103/317 (32%), Positives = 168/317 (52%), Gaps = 32/317 (10%)

Query: 16  SAPTKQIFDSQGTQYFNRSIAFHRIQYFISKYTQLIQE-ENIPPTDYTSSNDTISGVSKI 74
           S P K++      + ++ S     +  FI+   + +++ +N    +  S+   +S    +
Sbjct: 3   SCPQKRLLTKDDMEIWDSSQTKKELINFITDLAEAVKDRDNTQFKEPISAE--VSSTLAL 60

Query: 75  INDLIKLVEETPPL-PGPRRYGNLSCRQWHKRVDDNINELFEK-YLTISNTKFNKDQLFL 132
           ++ ++ +V+E P L     R+G    R +++ V  N + L  K + T++  +        
Sbjct: 61  LDSVLSVVDEHPVLNDTTSRFGKTEFRSFYQDVKSNCHNLLSKAFDTLTTNQIE------ 114

Query: 133 ELIYYFNASLGSPTRLDYGTGHELSFLAFIGAL---DMLNLLTDISGTDILFIFNEYYRL 189
           +L  YF  S G+  R+DYG+GHEL+F+ F+  L   D+  L  D S   ++ +F +Y ++
Sbjct: 115 QLSIYFYESWGNEERIDYGSGHELNFICFLYGLYKYDVFRLERD-STNIVILVFVKYLKI 173

Query: 190 IRKLILNYTLEPAGSHGVWGLDDHFHLIYIFGSSQWCPENADMTEPSISEPKFKAPIKPV 249
           +R+L   Y LEPAGSHGVWGLDD+  L ++FG+ Q            +S  K    +KP 
Sbjct: 174 MRRLETLYWLEPAGSHGVWGLDDYHFLPFLFGAFQ------------LSNHKH---LKPK 218

Query: 250 DILNKNLIEKFKSSNFYCQSILFILTVKT-GPFPEHSPILFDIAKNVHNWKKVRSGLLKM 308
            I N  +++ FK    Y   I FI +VKT      HSP+L DI+  V  W KV  G++KM
Sbjct: 219 SIHNDEIVDMFKDKYLYFGCIAFINSVKTTASLRWHSPMLDDIS-GVKKWSKVSEGMIKM 277

Query: 309 YMVEVLNKFPVVQHFWF 325
           Y+ EVL+K PV+QHF+F
Sbjct: 278 YVAEVLSKLPVMQHFYF 294

>NDAI0E02410 Chr5 complement(500623..501702) [1080 bp, 359 aa] {ON}
           Anc_8.674
          Length = 359

 Score =  149 bits (377), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 97/265 (36%), Positives = 143/265 (53%), Gaps = 28/265 (10%)

Query: 67  TISGVSKIINDLIKLVEETPPLPGPR--RYGNLSCRQWHKRVDDNINELFEKYLTISNTK 124
            I+ + +I+  + K++++ P L      R+G    R ++    D INE+ EK +  +   
Sbjct: 51  AINTLEQILVSIDKIIDKHPVLEDKEISRFGKKEFRGFY----DEINEVSEKLIHENFPS 106

Query: 125 FNKDQLFLELIYYFNASLGSPTRLDYGTGHELSFLAFIGAL---DMLNLLTDISGTDILF 181
              +QL  +L  Y + S G+  R+DYG+GHEL+F+ F+  L   D+L L  D     +L 
Sbjct: 107 LTHEQL-EQLTIYLDESWGNKQRIDYGSGHELNFMCFLFGLYKYDVLKLDIDARNM-VLI 164

Query: 182 IFNEYYRLIRKLILNYTLEPAGSHGVWGLDDHFHLIYIFGSSQWCPENADMTEPSISEPK 241
           IF +Y  ++R L   Y LEPAGSHGVWGLDD+  L ++FG+ Q                 
Sbjct: 165 IFIKYLDIMRSLETKYWLEPAGSHGVWGLDDYHFLPFLFGAYQLATHKH----------- 213

Query: 242 FKAPIKPVDILNKNLIEKFKSSNFYCQSILFILTVKT-GPFPEHSPILFDIAKNVHNWKK 300
               +KP+ I N+ L+E F     Y   I FI +VKT      HSP+L DI+  V  W K
Sbjct: 214 ----LKPLSIHNEELVEMFAKKYLYFGCIAFINSVKTTASLRWHSPMLDDIS-GVKRWSK 268

Query: 301 VRSGLLKMYMVEVLNKFPVVQHFWF 325
           V  G++KMY  EVL+K P++QHF+F
Sbjct: 269 VAEGMVKMYNAEVLSKLPIMQHFYF 293

>ZYRO0F07326g Chr6 complement(592906..593964) [1059 bp, 352 aa] {ON}
           highly similar to uniprot|Q12461 Saccharomyces
           cerevisiae YPL152W
          Length = 352

 Score =  149 bits (376), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 98/260 (37%), Positives = 142/260 (54%), Gaps = 31/260 (11%)

Query: 73  KIINDLIKLVEETPPLPGPR--RYGNLSCRQWHKRVDDNINELFEKYLTISNTKFNKDQL 130
           K +NDLI   ++ P +      R+G +  R ++    D++    E+ +  +    NKDQ+
Sbjct: 60  KKVNDLI---DKYPVIQDANTSRFGKVEFRDFY----DDLQTHAEELVATTYPSLNKDQV 112

Query: 131 FLELIYYFNASLGSPTRLDYGTGHELSFLAFIGAL---DMLNLLTDISGTDILFIFNEYY 187
             EL  Y   S G+  R+DYG+GHEL+F+ FI  L    + +L  D +   +L +F EY 
Sbjct: 113 -EELAVYLYESWGNKRRIDYGSGHELNFVCFIYGLYVYKVFDLERDAADL-VLKVFVEYL 170

Query: 188 RLIRKLILNYTLEPAGSHGVWGLDDHFHLIYIFGSSQWCPENADMTEPSISEPKFKAPIK 247
           R++R L   Y LEPAGSHGVWGLDD+  L ++FG+ Q        T P +         +
Sbjct: 171 RIMRILETKYWLEPAGSHGVWGLDDYHFLPFLFGAHQLA------THPHL---------R 215

Query: 248 PVDILNKNLIEKFKSSNFYCQSILFILTVK-TGPFPEHSPILFDIAKNVHNWKKVRSGLL 306
           P  I N+ ++E F     Y   I FI +VK T     HSP+L DI+  V  W KV  G++
Sbjct: 216 PKSIHNEEVVEMFMDKYIYFGCIAFINSVKSTASLRWHSPMLDDIS-GVKTWAKVAEGMI 274

Query: 307 KMYMVEVLNKFPVVQHFWFG 326
           KMY  EVL+K P++QHF+FG
Sbjct: 275 KMYKAEVLSKLPIMQHFYFG 294

>Kpol_1013.4 s1013 complement(5948..7024) [1077 bp, 358 aa] {ON}
           complement(5948..7024) [1077 nt, 359 aa]
          Length = 358

 Score =  148 bits (373), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 104/318 (32%), Positives = 163/318 (51%), Gaps = 35/318 (11%)

Query: 18  PTKQIFDSQGTQYFNRSIAFHRIQYFISKYTQLIQ-EENIPPTD-YTSSNDTISGVSKII 75
           P K++   +  + +++S   H +  FI K  + ++  EN    +  T   ++  G+ K +
Sbjct: 3   PEKRLLTPEDLELWDKSQTKHDLLEFIEKLAKSVEGHENKQYQEPITPQIESFMGLLKSV 62

Query: 76  NDLIKLVEETPPLPGPR--RYGNLSCRQWHKRVDDNINELFEKYLTISNT--KFNKDQLF 131
           N++I   ++ P +   +  R+G +  R ++  +      L      ISN      +DQL 
Sbjct: 63  NNII---DKHPVVQDAKSSRFGKIEFRDFYDELTSQSKTL------ISNAYPSLTEDQL- 112

Query: 132 LELIYYFNASLGSPTRLDYGTGHELSFLAFIGALDMLNLLTDISGTD--ILFIFNEYYRL 189
            +L  Y + S G+  R+DYG+GHEL+FL  +  L    +  +       +L IF EY R+
Sbjct: 113 DQLYVYLDESWGNKQRIDYGSGHELNFLCLLYGLHKYKIFDESKDFTNMVLKIFIEYLRV 172

Query: 190 IRKLILNYTLEPAGSHGVWGLDDHFHLIYIFGSSQWCPENADMTEPSISEPKFKAPIKPV 249
           +R L   Y LEPAGSHGVWGLDD+  L ++FG+ Q                     +KP+
Sbjct: 173 MRILETKYWLEPAGSHGVWGLDDYHFLPFLFGAFQLATHKH---------------LKPL 217

Query: 250 DILNKNLIEKFKSSNFYCQSILFILTVKTG-PFPEHSPILFDIAKNVHNWKKVRSGLLKM 308
            I N+ L+E F+    Y   + FI +VKT      HSP+L DI+  V  W KV  G++KM
Sbjct: 218 SIHNEELVEMFQDKYLYFSCVAFINSVKTSTSLRFHSPMLDDIS-GVKKWSKVAEGMIKM 276

Query: 309 YMVEVLNKFPVVQHFWFG 326
           Y  EVL+K P++QHF+FG
Sbjct: 277 YRAEVLSKLPIMQHFYFG 294

>KLLA0F11187g Chr6 (1031839..1032921) [1083 bp, 360 aa] {ON} similar
           to uniprot|Q12461 Saccharomyces cerevisiae YPL152W RRD2
           Resistant to Rapamycin Deletion 2; similar to
           hosphotyrosyl phosphatase activator (PTPA) from several
           organisms
          Length = 360

 Score =  147 bits (372), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 105/315 (33%), Positives = 161/315 (51%), Gaps = 30/315 (9%)

Query: 20  KQIFDSQGTQYFNRSIAFHRIQYFISKYTQLIQEENIPPTDYTSS-NDTISGVSKIINDL 78
           K++ +    + +N S  F  +  FI+  T  +        DYT   +D +  VS +++ +
Sbjct: 4   KRLINEHDMELWNNSKTFEDVIGFIN--TLALSVRGRENNDYTQPISDNVQRVSNLLSKV 61

Query: 79  IKLV--EETPPLPGPRRYGNLSCRQWHKRVDDNINELFEK-YLTISNTKFNKDQLFLELI 135
            +++   E        R+G +  R ++  + ++ NEL  K +  I      K     ++ 
Sbjct: 62  TEIIGKHEVIKDANTSRFGKIEFRDFYDDISEHSNELISKIFEGIEKPDTGK---LDDIC 118

Query: 136 YYFNASLGSPTRLDYGTGHELSFLAFIGAL---DMLNLLTDISGTDILFIFNEYYRLIRK 192
            YF  S G  +R+DYG+GHEL+F+ F+  L    + +L  D S   +L +F +Y  ++R 
Sbjct: 119 TYFINSWGDRSRIDYGSGHELNFICFLYCLTESKVFDLENDSSNI-VLMLFIKYLGIMRS 177

Query: 193 LILNYTLEPAGSHGVWGLDDHFHLIYIFGSSQWCPENADMTEPSISEPKFKAPIKPVDIL 252
           L L Y LEPAGSHGVWGLDD+  L ++FG+ Q            +S  K    +KP  I 
Sbjct: 178 LELKYWLEPAGSHGVWGLDDYHFLPFLFGAFQ------------LSTHK---HLKPKSIH 222

Query: 253 NKNLIEKFKSSNFYCQSILFILTVKT-GPFPEHSPILFDIAKNVHNWKKVRSGLLKMYMV 311
           N  ++E F+    Y   I FI  VKT      HSP+L DI+  V  W KV  G++KMY  
Sbjct: 223 NPEVVEMFQDRYLYFGCIAFINKVKTTASLRWHSPMLDDIS-GVKRWSKVAEGMVKMYKA 281

Query: 312 EVLNKFPVVQHFWFG 326
           EVL K P++QHF+FG
Sbjct: 282 EVLQKLPIMQHFYFG 296

>TBLA0C01860 Chr3 complement(437987..439057) [1071 bp, 356 aa] {ON}
           Anc_8.674 YPL152W
          Length = 356

 Score =  146 bits (369), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 99/275 (36%), Positives = 151/275 (54%), Gaps = 31/275 (11%)

Query: 65  NDTISGVSKIINDLIKLVEETPPLPG----PRRYGNLSCRQWHKRVDDNINELFEKYLTI 120
           +D+I+    ++ D+  ++E  P          R+G +  + ++    D+IN+  EK +  
Sbjct: 48  SDSINNAFSLLQDIRDIIERYPVESDIESTKSRFGKVEFKSFY----DDINQNSEKLIKS 103

Query: 121 SNTKFNKDQLFLELIYYFNASLGSPTRLDYGTGHELSFLAFIGAL---DMLNLLTDISGT 177
                + +Q+  EL  Y   S G+  R+DYG+GHEL+F+ F+  L   ++ NLL D S  
Sbjct: 104 HFNGLDPNQI-QELSIYLVESWGNRQRIDYGSGHELNFICFLYGLTKYNIFNLLED-STN 161

Query: 178 DILFIFNEYYRLIRKLILNYTLEPAGSHGVWGLDDHFHLIYIFGSSQWCPENADMTEPSI 237
            +L IF EY  ++R +   Y LEPAGSHGVWGLDD+  L ++FG+ Q            +
Sbjct: 162 LVLKIFMEYINIMRIIETKYWLEPAGSHGVWGLDDYHFLPFLFGAFQ------------L 209

Query: 238 SEPKFKAPIKPVDILNKNLIEKFKSSNFYCQSILFILTVKT-GPFPEHSPILFDIAKNVH 296
           S+ K    +KP+ I N+ ++E FK    Y   I FI ++KT      HSP+L DI+  V 
Sbjct: 210 SKHKH---LKPISIHNEEMVEMFKDKYMYFGCIDFINSIKTTATLRWHSPMLDDIS-GVK 265

Query: 297 NWKKVRSGLLKMYMVEVLNKFPVVQHFWFGTGFYP 331
            W KV  G++KMY  EVL K P++QHF+F + F P
Sbjct: 266 KWSKVSEGMIKMYSAEVLGKLPIMQHFYF-SDFLP 299

>Kwal_26.8783 s26 complement(941317..942384) [1068 bp, 355 aa] {ON}
           YPL152W (RRD2) - similar to hosphotyrosyl phosphatase
           activator (PTPA) from several organisms [contig 67] FULL
          Length = 355

 Score =  145 bits (367), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 100/316 (31%), Positives = 153/316 (48%), Gaps = 29/316 (9%)

Query: 18  PTKQIFDSQGTQYFNRSIAFHRIQYFISKYTQLIQEENIPPTDYTSS-NDTISGVSKIIN 76
           P K++  SQ  + +     F ++  FIS+  + ++   +    Y      +I     +++
Sbjct: 3   PQKRLLTSQDIETWVDCATFDQLIEFISELAESVK--GLENNQYQEPIGASIDKCCSLLD 60

Query: 77  DLIKLVEETPPLPGPR--RYGNLSCRQWHKRVDDNINELFEKYLTISNTKFNKDQLFLEL 134
           ++  + ++ P        R+G +  R ++  +     +L  K       + ++DQ   EL
Sbjct: 61  EVFSIAKQHPVKEDAETSRFGKIEFRHFYDDLRIKAQDLISKEFD----QLSQDQA-EEL 115

Query: 135 IYYFNASLGSPTRLDYGTGHELSFLAFIGALDMLNLLTDISGTD--ILFIFNEYYRLIRK 192
           + YF  S G   R+DYG+GHEL+F+ F+  L    L          +L +F  Y  L+R 
Sbjct: 116 VAYFVESWGDRERIDYGSGHELNFICFLYGLKDCGLFERSRDYRNLVLKVFIHYLELMRV 175

Query: 193 LILNYTLEPAGSHGVWGLDDHFHLIYIFGSSQWCPENADMTEPSISEPKFKAPIKPVDIL 252
           L   Y LEPAGSHGVWGLDD+  L ++FG+SQ  P                  +KP  I 
Sbjct: 176 LETTYWLEPAGSHGVWGLDDYHFLPFLFGASQLAPHKH---------------LKPKSIH 220

Query: 253 NKNLIEKFKSSNFYCQSILFILTVKT-GPFPEHSPILFDIAKNVHNWKKVRSGLLKMYMV 311
           N  L++ F S   Y   I FI  VKT      HSP+L DI+    +W KV  G++KMY  
Sbjct: 221 NNELVDMFASRYLYFGCIDFINRVKTTASLRWHSPMLDDIS-GAKSWSKVAEGMIKMYRK 279

Query: 312 EVLNKFPVVQHFWFGT 327
           EVL K P++QHF FG+
Sbjct: 280 EVLAKLPIMQHFLFGS 295

>CAGL0M02255g Chr13 (270614..271690) [1077 bp, 358 aa] {ON} highly
           similar to uniprot|Q12461 Saccharomyces cerevisiae
           YPL152w RRD2
          Length = 358

 Score =  146 bits (368), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 98/315 (31%), Positives = 158/315 (50%), Gaps = 31/315 (9%)

Query: 18  PTKQIFDSQGTQYFNRSIAFHRIQYFISKYTQLIQE-ENIPPTDYTSSNDTISGVSKIIN 76
           P+K+I   +  + +  S     I  FI    + ++  EN   ++  S  D++     ++ 
Sbjct: 3   PSKRILTDKDVKIWEESETREDILSFIESLAKAVEGFENDQVSEPVS--DSVQSTIAVLT 60

Query: 77  DLIKLVEETPPLPGP--RRYGNLSCRQWHKRVDDNINELFEKYLTISNTKFNKDQLFLEL 134
           ++ KL++  P +      R+G +  R ++  V +  ++L   +     +     +   +L
Sbjct: 61  EIDKLIKLHPVIQDKNTSRFGKVEFRDFYDDVCEKADDLLSSHFPALTS-----EQIEQL 115

Query: 135 IYYFNASLGSPTRLDYGTGHELSFLAFIGAL---DMLNLLTDISGTDILFIFNEYYRLIR 191
             Y   S G+  R+DYG+GHEL+F+ F+  L    + +L  D     +L +F EY +++R
Sbjct: 116 SIYLQESWGNKRRIDYGSGHELNFICFLYGLTHYKIFDLQRDARNL-VLVLFIEYLKIMR 174

Query: 192 KLILNYTLEPAGSHGVWGLDDHFHLIYIFGSSQWCPENADMTEPSISEPKFKAPIKPVDI 251
           ++   Y LEPAGSHGVWGLDD+  L ++FG+ Q  P                  +KP  I
Sbjct: 175 EIETLYWLEPAGSHGVWGLDDYHFLPFLFGAFQLAPHKH---------------LKPKSI 219

Query: 252 LNKNLIEKFKSSNFYCQSILFILTVKTG-PFPEHSPILFDIAKNVHNWKKVRSGLLKMYM 310
            N+ L+E F     Y   I FI +VKT      HSP+L DI+  V  W KV  G++KMY 
Sbjct: 220 HNEELVEMFADKYLYFGCIAFINSVKTSTSLRWHSPMLDDIS-GVKKWSKVAEGMIKMYK 278

Query: 311 VEVLNKFPVVQHFWF 325
            EVL K P++QHF+F
Sbjct: 279 AEVLGKLPIMQHFYF 293

>ACR139C Chr3 complement(592864..593943) [1080 bp, 359 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL152W
           (RRD2)
          Length = 359

 Score =  143 bits (360), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 99/314 (31%), Positives = 151/314 (48%), Gaps = 28/314 (8%)

Query: 17  APTKQIFDSQGTQYFNRSIAFHRIQYFISKYTQLIQ-EENIPPTDYTSSNDTISGVSKII 75
           A  K++        +  S  F  +  F+S   Q ++  EN    +  S    I  +  ++
Sbjct: 10  AAQKRLLTGSDLDKWKASKTFEELLRFVSSLAQSVRGRENSEHAEPVSP--AIEALEALL 67

Query: 76  NDLIKLVEETPPL--PGPRRYGNLSCRQWHKRVDDNINELFEKYLTISNTKFNKDQLFLE 133
            ++  +    P L      R+G +  R +HK V      L    L +  +    D+   E
Sbjct: 68  EEMQGIAAHHPVLQDAATSRFGKVEFRDFHKEVQARAEALV---LQVDPSL--TDEQAQE 122

Query: 134 LIYYFNASLGSPTRLDYGTGHELSFLAFIGALDMLNLLTDISGTD-ILFIFNEYYRLIRK 192
           L  Y   + G   R+DYG+GHEL+F+ F+  L    +L++   T+ +L +F +Y  ++R 
Sbjct: 123 LAVYLGNAWGDCKRIDYGSGHELNFVCFLYGLWKYGVLSEHDFTNAVLRVFVKYMDVMRV 182

Query: 193 LILNYTLEPAGSHGVWGLDDHFHLIYIFGSSQWCPENADMTEPSISEPKFKAPIKPVDIL 252
           L   Y LEPAGSHGVWGLDD+  L ++FG+ Q                     +KP  I 
Sbjct: 183 LETKYWLEPAGSHGVWGLDDYHFLPFLFGAFQLATHKH---------------LKPKSIH 227

Query: 253 NKNLIEKFKSSNFYCQSILFILTVKT-GPFPEHSPILFDIAKNVHNWKKVRSGLLKMYMV 311
           N  ++E F++   Y   I FI  VKT      HSP+L DI+  V +W KV  G++KMY  
Sbjct: 228 NPEVVELFENRYLYFGCIAFINRVKTTASLRWHSPMLDDIS-GVRSWTKVSEGMVKMYKA 286

Query: 312 EVLNKFPVVQHFWF 325
           EVL K P++QHF+F
Sbjct: 287 EVLGKLPIMQHFFF 300

>KLTH0D11176g Chr4 complement(913077..914138) [1062 bp, 353 aa] {ON}
           similar to uniprot|Q12461 Saccharomyces cerevisiae
           YPL152W RRD2 Resistant to Rapamycin
          Length = 353

 Score =  143 bits (360), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 98/317 (30%), Positives = 157/317 (49%), Gaps = 31/317 (9%)

Query: 18  PTKQIFDSQGTQYFNRSIAFHRIQYFISKYTQLIQEENIPPTDYTS-SNDTISGVSKIIN 76
           P K++        ++ S  F+ +  F+S   + ++   +   +Y   +  +I    +++ 
Sbjct: 3   PQKRLLTQDDMDIWSHSETFNNLISFLSGLAESVK--GLENNEYQKPTGSSIESCCQLLE 60

Query: 77  DLIKLVEETPPLPGPR--RYGNLSCRQWHKRVDDNINELFEK-YLTISNTKFNKDQLFLE 133
           ++  L E+ P        R+G +  R ++  +      L ++ +  +  T+        E
Sbjct: 61  EVASLAEQYPVKQDAETSRFGKVEFRYFYDDLKSKSQGLIQRAFDALDGTQCE------E 114

Query: 134 LIYYFNASLGSPTRLDYGTGHELSFLAFIGALDMLNLLTDISGTD--ILFIFNEYYRLIR 191
           L  YF  S G  +R+DYG+GHEL+FL F+  L    +  + +     +L +F +Y  ++R
Sbjct: 115 LSVYFAESWGDRSRIDYGSGHELNFLCFLYGLKEFGVFKEPADYRNMVLKLFIKYLGVMR 174

Query: 192 KLILNYTLEPAGSHGVWGLDDHFHLIYIFGSSQWCPENADMTEPSISEPKFKAPIKPVDI 251
            L   Y LEPAGSHGVWGLDD+  L ++FG+ Q            +S  K    +KP  I
Sbjct: 175 TLETKYWLEPAGSHGVWGLDDYHFLPFLFGAFQ------------LSTHKH---LKPKSI 219

Query: 252 LNKNLIEKFKSSNFYCQSILFILTVKT-GPFPEHSPILFDIAKNVHNWKKVRSGLLKMYM 310
            N  ++E F     Y   I FI  VKT      HSP+L DI+  V  W KV  G++KMY 
Sbjct: 220 HNSEVVEMFGKRYLYFGCIDFINKVKTTASLRWHSPMLDDIS-GVKTWAKVAEGMIKMYK 278

Query: 311 VEVLNKFPVVQHFWFGT 327
            EVLNK P++QHF+FG+
Sbjct: 279 AEVLNKLPIMQHFFFGS 295

>TDEL0A06200 Chr1 complement(1085066..1086133) [1068 bp, 355 aa]
           {ON} Anc_8.674 YPL152W
          Length = 355

 Score =  142 bits (358), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 93/265 (35%), Positives = 138/265 (52%), Gaps = 29/265 (10%)

Query: 67  TISGVSKIINDLIKLVEETP-PLPGPRRYGNLSCRQWHKRVDDNINELF-EKYLTISNTK 124
           +I  V  +I  + + +E  P    GP R+G    R  +  +    + L  EK+ +++   
Sbjct: 52  SIQSVEALIECVDQCIENHPVESTGPSRFGKGEFRDLYDDISGRSSVLIKEKFGSLT--- 108

Query: 125 FNKDQLFLELIYYFNASLGSPTRLDYGTGHELSFLAFIGALDMLNLLTDISGTD---ILF 181
              D+   +L  YFN S G  +R+DYG+GHEL+FL F+  L    +  D++  +   +L 
Sbjct: 109 ---DEQVAQLSVYFNESWGDKSRIDYGSGHELNFLCFLYGLYRCGVF-DLAKDNRNLVLI 164

Query: 182 IFNEYYRLIRKLILNYTLEPAGSHGVWGLDDHFHLIYIFGSSQWCPENADMTEPSISEPK 241
           +F +Y + +R +   Y LEPAGSHGVWGLDD+  L ++FG+SQ                 
Sbjct: 165 VFMKYLKTMRVIETVYWLEPAGSHGVWGLDDYHFLPFLFGASQLSTHRH----------- 213

Query: 242 FKAPIKPVDILNKNLIEKFKSSNFYCQSILFILTVKT-GPFPEHSPILFDIAKNVHNWKK 300
               +KP  I N  ++E F     Y   I FI +VKT      HSP+L DI+  V  W K
Sbjct: 214 ----LKPKSIHNPEVVEMFSEKYLYFGCIDFINSVKTTASLRWHSPMLDDIS-GVKEWAK 268

Query: 301 VRSGLLKMYMVEVLNKFPVVQHFWF 325
           V  G++KMY  EVL K P++QHF+F
Sbjct: 269 VYQGMVKMYDAEVLCKLPIMQHFYF 293

>TPHA0D01240 Chr4 complement(259089..260168) [1080 bp, 359 aa] {ON}
           Anc_8.674 YPL152W
          Length = 359

 Score =  141 bits (355), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 103/321 (32%), Positives = 171/321 (53%), Gaps = 35/321 (10%)

Query: 18  PTKQIFDSQGTQYFNRSIAFHRIQYFISKYTQLIQ-EENIPPTDYTSS-NDTISGVSKII 75
           P K++  +   + ++RS     +  F+ +  + ++ +EN   TDYT   +  +  + K++
Sbjct: 3   PQKRLLTNADMEIWDRSQTQADLLNFLKQLAKSVEGKEN---TDYTLPISQPVESMMKLL 59

Query: 76  NDLIKLVEETPPLPGPR--RYGNLSCRQWHKRVDDNINELF-EKYLTISNTKFNKDQLFL 132
           + +  ++ + P +      R+G +  R ++  +      L  E + ++++++   +QL++
Sbjct: 60  HKVQSILFKHPVVKDAHSSRFGKVEFRDFYDDLTSQSKTLLKECFPSLTDSQI--EQLYV 117

Query: 133 ELIYYFNASLGSPTRLDYGTGHELSFLAFIGAL---DMLNLLTDISGTDILFIFNEYYRL 189
               Y + S G+  R+DYG+GHEL+F+ FI  L    + +L  D +   +L +F +Y +L
Sbjct: 118 ----YVDESWGNKQRIDYGSGHELNFMCFIYGLTSFKIFDLERDATNL-VLKVFIQYLKL 172

Query: 190 IRKLILNYTLEPAGSHGVWGLDDHFHLIYIFGSSQWCPENADMTEPSISEPKFKAPIKPV 249
           +R L L Y LEPAGSHGVWGLDD+  L ++FG+ Q            +S  K    +KP 
Sbjct: 173 MRVLELQYWLEPAGSHGVWGLDDYHFLPFLFGAYQ------------LSTHKH---LKPS 217

Query: 250 DILNKNLIEKFKSSNFYCQSILFILTVKTGP-FPEHSPILFDIAKNVHNWKKVRSGLLKM 308
            I N +LIE F     Y   I FI +VKT      HSP+L DI+  V  W KV  G+ KM
Sbjct: 218 SIHNDDLIEMFADKYLYFGCIEFINSVKTTTTLRWHSPMLDDIS-GVKKWSKVAEGMFKM 276

Query: 309 YMVEVLNKFPVVQHFWFGTGF 329
           Y  EV+ K P++QHF+F   F
Sbjct: 277 YEAEVIKKLPIMQHFYFNDMF 297

>Skud_16.130 Chr16 (236660..237736) [1077 bp, 358 aa] {ON} YPL152W
           (REAL)
          Length = 358

 Score =  140 bits (353), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 88/236 (37%), Positives = 124/236 (52%), Gaps = 24/236 (10%)

Query: 93  RYGNLSCRQWHKRVDDNINELFEKYLTISNTKFNKDQLFLELIYYFNASLGSPTRLDYGT 152
           R+G +  R ++  V  N  +L       S      D+   +L  Y + S G+  R+DYG+
Sbjct: 79  RFGKVEFRDFYDEVSQNSRKLLR-----SEFPHLTDEQLEQLSIYLDESWGNKRRIDYGS 133

Query: 153 GHELSFLAFIGALDMLNL--LTDISGTDILFIFNEYYRLIRKLILNYTLEPAGSHGVWGL 210
           GHEL+F+  +  L    +  L+D S   IL +F EY +++R L   Y LEPAGSHGVWGL
Sbjct: 134 GHELNFMCLLYGLYNYGIFNLSDDSTNLILKVFIEYLQIMRILETKYWLEPAGSHGVWGL 193

Query: 211 DDHFHLIYIFGSSQWCPENADMTEPSISEPKFKAPIKPVDILNKNLIEKFKSSNFYCQSI 270
           DD+  L ++FG+ Q                     +KP+ I N  L+E F     Y   I
Sbjct: 194 DDYHFLPFLFGAFQLTTHKH---------------LKPISIHNNELVEMFAHRYLYFGCI 238

Query: 271 LFILTVKT-GPFPEHSPILFDIAKNVHNWKKVRSGLLKMYMVEVLNKFPVVQHFWF 325
            FI  VK+      HSP+L DI+  V  W KV  G++KMY VEVL+K P++QHF+F
Sbjct: 239 AFINKVKSSASLRWHSPMLDDIS-GVKTWSKVAEGMIKMYKVEVLSKLPIMQHFYF 293

>Suva_16.158 Chr16 (274228..275304) [1077 bp, 358 aa] {ON} YPL152W
           (REAL)
          Length = 358

 Score =  140 bits (352), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 90/267 (33%), Positives = 139/267 (52%), Gaps = 28/267 (10%)

Query: 65  NDTISGVSKIINDLIKLVEETPPLPG--PRRYGNLSCRQWHKRVDDNINELFEKYLTISN 122
           ++ I+ +  +++ +  ++E+ P +      R+G +  R ++  V  N  +L +   ++  
Sbjct: 49  SEQITRMLSLLSRVRDIIEKHPVVHDVDSSRFGKVEFRDFYDEVSQNSRKLLKSEFSLLT 108

Query: 123 TKFNKDQLFLELIYYFNASLGSPTRLDYGTGHELSFLAFIGAL---DMLNLLTDISGTDI 179
                D+   +L  Y + S G+  R+DYG+GHEL+F+  +  L    + NL  D S   I
Sbjct: 109 -----DEQLEQLSIYLDESWGNKRRIDYGSGHELNFMCLLYGLYNYGVFNLSND-STNLI 162

Query: 180 LFIFNEYYRLIRKLILNYTLEPAGSHGVWGLDDHFHLIYIFGSSQWCPENADMTEPSISE 239
           L +F EY  ++R L   Y LEPAGSHGVWGLDD+  L ++FG+ Q               
Sbjct: 163 LKVFIEYLDIMRVLETKYWLEPAGSHGVWGLDDYHFLPFLFGAFQLTTHKH--------- 213

Query: 240 PKFKAPIKPVDILNKNLIEKFKSSNFYCQSILFILTVKT-GPFPEHSPILFDIAKNVHNW 298
                 +KP+ I N  L+E F     Y   I FI  VK+      HSP+L DI+  V  W
Sbjct: 214 ------LKPISIHNSELVEMFSDRYLYFGCIAFINKVKSSASLRWHSPMLDDIS-GVKTW 266

Query: 299 KKVRSGLLKMYMVEVLNKFPVVQHFWF 325
            KV  G++KMY  EVL+K P++QHF+F
Sbjct: 267 SKVAEGMIKMYEAEVLSKLPIMQHFYF 293

>KNAG0J01690 Chr10 complement(308576..309667) [1092 bp, 363 aa] {ON}
           Anc_8.674 YPL152W
          Length = 363

 Score =  140 bits (353), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 97/317 (30%), Positives = 158/317 (49%), Gaps = 29/317 (9%)

Query: 16  SAPTKQIFDSQGTQYFNRSIAFHRIQYFISKYTQLIQEENIPPTDY--TSSNDTISGVSK 73
           + P K++   +    +  S     + +FI +    ++       D   ++S + + G+ +
Sbjct: 4   AMPCKRLLMKRDLDLWESSETRAHLVHFIEQLADAVRGRENEQYDLPISASVEALMGLLQ 63

Query: 74  IINDLIKLVEETPPLPGPRRYGNLSCRQWHKRVDDNINELFEKYLTISNTKFNKDQLFLE 133
            +  +I+            R+G +  R ++    D +       +T +  +  ++Q+  +
Sbjct: 64  QVRGVIERHPVAKKDAPASRFGKVEFRDFY----DELRAESASLITGAFPQLTQNQV-RQ 118

Query: 134 LIYYFNASLGSPTRLDYGTGHELSFLAFIGALDMLNLLTDISGTD----ILFIFNEYYRL 189
           L  Y   S G   R+DYG+GHEL+F+ F+  L    +  D+ GTD    +L  F EY ++
Sbjct: 119 LQTYLEESWGDKRRIDYGSGHELNFMCFLYGLTAYKVF-DLGGTDRANLVLKPFIEYLKI 177

Query: 190 IRKLILNYTLEPAGSHGVWGLDDHFHLIYIFGSSQWCPENADMTEPSISEPKFKAPIKPV 249
           +R L   Y LEPAGSHGVWGLDD+  L ++FG+ Q            +S  K    +KP+
Sbjct: 178 MRVLETEYWLEPAGSHGVWGLDDYHFLPFLFGAFQ------------LSTHKH---LKPL 222

Query: 250 DILNKNLIEKFKSSNFYCQSILFILTVKT-GPFPEHSPILFDIAKNVHNWKKVRSGLLKM 308
            I N+ ++E F     Y   I FI +VKT      HSP+L DI+  V  W KV  G++KM
Sbjct: 223 SIHNEEVVELFADKYLYFGCIHFINSVKTTATLRWHSPMLDDIS-GVKKWSKVAEGMVKM 281

Query: 309 YMVEVLNKFPVVQHFWF 325
           Y  EVL+K P++QHF+F
Sbjct: 282 YQAEVLSKLPIMQHFYF 298

>Smik_6.349 Chr6 complement(558150..559226) [1077 bp, 358 aa] {ON}
           YPL152W (REAL)
          Length = 358

 Score =  137 bits (344), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 90/243 (37%), Positives = 130/243 (53%), Gaps = 27/243 (11%)

Query: 93  RYGNLSCRQWHKRVDDNINELFEKYLTISNTKFNKDQLFLELIYYFNASLGSPTRLDYGT 152
           R+G +  R ++    D +++   K+L         +QL  +L  Y + S G+  R+DYG+
Sbjct: 79  RFGKIEFRDFY----DEVSQSSRKFLRSEFPSLTDEQL-EQLSIYLDESWGNKRRIDYGS 133

Query: 153 GHELSFLAFIGAL---DMLNLLTDISGTDILFIFNEYYRLIRKLILNYTLEPAGSHGVWG 209
           GHEL+F+  +  L    + NL  D S   IL +F EY +++R L   Y LEPAGSHGVWG
Sbjct: 134 GHELNFMCLLYGLYKYGVFNLSND-STNLILKVFIEYLKIMRILETRYWLEPAGSHGVWG 192

Query: 210 LDDHFHLIYIFGSSQWCPENADMTEPSISEPKFKAPIKPVDILNKNLIEKFKSSNFYCQS 269
           LDD+  L ++FG+ Q                     +KP+ I N  L+E F +   Y   
Sbjct: 193 LDDYHFLPFLFGAFQLTSHKH---------------LKPISIHNNELVEMFANRYLYFGC 237

Query: 270 ILFILTVKT-GPFPEHSPILFDIAKNVHNWKKVRSGLLKMYMVEVLNKFPVVQHFWFGTG 328
           I FI  VK+      HSP+L DI+  V  W KV  G++KMY  EVL+K P++QHF+F + 
Sbjct: 238 IDFINKVKSSASLRWHSPMLDDIS-GVKTWSKVAEGMIKMYEAEVLSKLPIMQHFYF-SD 295

Query: 329 FYP 331
           F P
Sbjct: 296 FLP 298

>YPL152W Chr16 (265028..266104) [1077 bp, 358 aa] {ON}
           RRD2Activator of the phosphotyrosyl phosphatase activity
           of PP2A,peptidyl-prolyl cis/trans-isomerase; regulates
           G1 phase progression, the osmoresponse, microtubule
           dynamics; subunit of the Tap42p-Pph21p-Rrd2p complex
          Length = 358

 Score =  136 bits (343), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 88/267 (32%), Positives = 138/267 (51%), Gaps = 28/267 (10%)

Query: 65  NDTISGVSKIINDLIKLVEETPPLPGP--RRYGNLSCRQWHKRVDDNINELFEKYLTISN 122
           +++I+ +  +++ +  + ++ P +      R+G +  R ++  V  N  ++       S 
Sbjct: 49  SESINSMMNLLSQIKDITQKHPVIKDADSSRFGKVEFRDFYDEVSRNSRKILR-----SE 103

Query: 123 TKFNKDQLFLELIYYFNASLGSPTRLDYGTGHELSFLAFIGAL---DMLNLLTDISGTDI 179
                D+   +L  Y + S G+  R+DYG+GHEL+F+  +  L    + NL  D S   +
Sbjct: 104 FPSLTDEQLEQLSIYLDESWGNKRRIDYGSGHELNFMCLLYGLYSYGIFNLSND-STNLV 162

Query: 180 LFIFNEYYRLIRKLILNYTLEPAGSHGVWGLDDHFHLIYIFGSSQWCPENADMTEPSISE 239
           L +F EY +++R L   Y LEPAGSHGVWGLDD+  L ++FG+ Q               
Sbjct: 163 LKVFIEYLKIMRILETKYWLEPAGSHGVWGLDDYHFLPFLFGAFQLTTHKH--------- 213

Query: 240 PKFKAPIKPVDILNKNLIEKFKSSNFYCQSILFILTVKT-GPFPEHSPILFDIAKNVHNW 298
                 +KP+ I N  L+E F     Y   I FI  VK+      HSP+L DI+  V  W
Sbjct: 214 ------LKPISIHNNELVEMFAHRYLYFGCIAFINKVKSSASLRWHSPMLDDIS-GVKTW 266

Query: 299 KKVRSGLLKMYMVEVLNKFPVVQHFWF 325
            KV  G++KMY  EVL+K P++QHF+F
Sbjct: 267 SKVAEGMIKMYKAEVLSKLPIMQHFYF 293

>Kpol_1058.14 s1058 (45433..48258) [2826 bp, 941 aa] {ON}
           (45433..48258) [2826 nt, 942 aa]
          Length = 941

 Score = 33.9 bits (76), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 35/130 (26%), Positives = 55/130 (42%), Gaps = 10/130 (7%)

Query: 101 QWHKRVDDNINELFEKYLTISNTKFNKDQLFLELIYYFNASLGSPTRLDYGTGHELSFLA 160
           QWH+ +  +I  +  +   I      +D    EL+ YF +S  + T       H + +  
Sbjct: 16  QWHRGIPLSIKSILNRERIIG---VEEDDC-KELLQYFGSSDVAKTVTSTERIHVIRYFY 71

Query: 161 FIGALD-MLNLLTDISGTDILFIFNEYYRLIRKLILNYTLEPAGSHGVWGLDDHFHLIYI 219
             GA D ++N+     G  +L+  ++  RL   + LN       SHG   L   + LI  
Sbjct: 72  ERGAYDSVVNI-----GQKMLYKLDQSGRLRDDVTLNELKSFINSHGNRRLSGKYDLIVE 126

Query: 220 FGSSQWCPEN 229
              SQWCP N
Sbjct: 127 DVISQWCPTN 136

>ZYRO0B03058g Chr2 (249023..249373) [351 bp, 116 aa] {ON} similar to
           uniprot|P40060 Saccharomyces cerevisiae YER092W IES5
           Protein that associates with the INO80 chromatin
           remodeling complex under low-salt conditions
          Length = 116

 Score = 32.0 bits (71), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 36/74 (48%), Gaps = 4/74 (5%)

Query: 43  FISKYTQLIQEENIPPTDYTSSNDTISGVSKIINDLIKLVEETPPLPGPRRYGNLSCRQW 102
            +S+  +L+++E     +YT+    IS +  +++ L     ETP L   R    +   QW
Sbjct: 15  VLSRNDELVKQETTLKKEYTTLLRKISSICSVLDQLEGETAETPGLISNRSLKRVPGFQW 74

Query: 103 HKRVDDNINELFEK 116
           H   +D IN L EK
Sbjct: 75  H---NDQIN-LLEK 84

>Kpol_1003.7 s1003 complement(12681..20162) [7482 bp, 2493 aa] {ON}
           complement(12681..20162) [7482 nt, 2494 aa]
          Length = 2493

 Score = 33.1 bits (74), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 33/71 (46%), Gaps = 7/71 (9%)

Query: 325 FGTGFYPWINSSTLMKLPTYELAPDDNNTTYTINKPTDLSKSGSKKTLENMLNTDKEKID 384
           F TG       S L+ +  Y      NNTT  + +  +L  SG KK  EN + TD E I+
Sbjct: 554 FATGL------SRLVWVYLYRCPETLNNTTRRLQQLLELYVSGQKKK-ENWITTDLELIN 606

Query: 385 PNSCVTTTINH 395
           P   V  TI H
Sbjct: 607 PLCDVLVTIGH 617

>KLTH0H14256g Chr8 complement(1238169..1241963) [3795 bp, 1264 aa]
           {ON} weakly similar to uniprot|P47104 Saccharomyces
           cerevisiae YJR033C RAV1 Subunit of the RAVE complex
           (Rav1p Rav2p Skp1p) which promotes assembly of the
           V-ATPase holoenzyme required for transport between the
           early and late endosome/PVC and for localization of TGN
           membrane proteins potential Cdc28p substrate
          Length = 1264

 Score = 32.3 bits (72), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 41/161 (25%), Positives = 65/161 (40%), Gaps = 12/161 (7%)

Query: 157 SFLAFIGALDMLNLLTDISGTDILFI-------FNEYYRLIRKLILNYTLEPAGSHGVWG 209
           SFL +  + D  +L+ DI  T   F        F ++  L  +L  +YT +      V  
Sbjct: 628 SFLEYEESFD--DLIRDIDWTSTKFSQSIFSVGFKDHSLLFTQLRYDYTSKNPSYCPVEK 685

Query: 210 LDDHFHLIYIFGSSQWCPENADMTEPSISEPKFKAPIKPVDILNKNLIEKFKSSNFYCQS 269
           +D   H  +  G S W     D T  + S  +     K +DI +K   +   S       
Sbjct: 686 IDLSQHTTHPVGDSIWM---TDGTFVAASGNQLFIKDKYLDIHDKFTNQSIGSRRILSND 742

Query: 270 ILFILTVKTGPFPEHSPILFDIAKNVHNWKKVRSGLLKMYM 310
           I+ + TV  GP P + P +   A      K VR  LL++++
Sbjct: 743 IMHLSTVLNGPLPVYHPQMLIQALYAGKLKLVREILLRLFL 783

>YHL035C Chr8 complement(27978..32756) [4779 bp, 1592 aa] {ON}
            VMR1Vacuolar membrane protein involved in multiple drug
            resistance and metal sensitivity; ATP-binding cassette
            (ABC) family member involved in drug transport; potential
            Cdc28p substrate; induced under respiratory conditions
          Length = 1592

 Score = 32.3 bits (72), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 42/86 (48%), Gaps = 8/86 (9%)

Query: 241  KFKAPIKPVDILNKNLIEKFKSSNF---YCQSILFILTVKTGPFPEHSPILFDIAKNVHN 297
            +F   I+ VD   + LI   + + F    C SI+F++TV T  F   + I+F +   V  
Sbjct: 1101 RFSKDIEGVD---QELIPYLEVTIFCLIQCASIIFLITVITPRFLTVAVIVFVLYFFVGK 1157

Query: 298  WKKVRSGLLKMYMVEVLNKFPVVQHF 323
            W    S  LK   ++ + K P+ QHF
Sbjct: 1158 WYLTASRELK--RLDSITKSPIFQHF 1181

>TPHA0N01210 Chr14 (260932..264756) [3825 bp, 1274 aa] {ON} Anc_6.180
            YGL092W
          Length = 1274

 Score = 31.2 bits (69), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 42/188 (22%), Positives = 76/188 (40%), Gaps = 31/188 (16%)

Query: 89   PGPRRYGNLSCRQWHK---RVDDNINELFEKYLTISNTKFNKDQLFLELI--YYFNASLG 143
            P  R+Y  L   +W      VD NI  +   Y  +SNT F  ++L  E+   + F A LG
Sbjct: 907  PQVRKYAKLQLEKWESMGNNVDVNITRI---YRLLSNTLFEDERLMDEIKGEFSFLAQLG 963

Query: 144  SPTRLDYGTGHELSFLAFIGALDMLNLLTDISGTDILFIFNEYYRLIRKLILNYTLEPAG 203
                L YG   E S    + ++      T+    DIL +F+    ++  L      E + 
Sbjct: 964  --LLLYYGQIDEYSLEELVSSILSKTGSTNDIINDILKVFSSQQNVVEIL-----KESSL 1016

Query: 204  SHGVWGLDDHFHLIYIFGSSQWCPENADMTEPSISEPKFKAPIKPVDILNKNLIEKFKSS 263
            S     +++ ++ + I   S+    N +++E                 +  ++IE  + S
Sbjct: 1017 SSEFSNIENLWYFVEILTQSESFTVNEELSEK----------------VTLDMIETMRCS 1060

Query: 264  NFYCQSIL 271
            N   +S++
Sbjct: 1061 NMVVESLI 1068

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.134    0.402 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 56,644,824
Number of extensions: 2728766
Number of successful extensions: 10488
Number of sequences better than 10.0: 160
Number of HSP's gapped: 10838
Number of HSP's successfully gapped: 178
Length of query: 488
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 374
Effective length of database: 40,409,475
Effective search space: 15113143650
Effective search space used: 15113143650
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)