Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0E005207.348ON2091889951e-138
TPHA0F029507.348ON2161837811e-106
NCAS0A141407.348ON2241827811e-106
Kpol_530.337.348ON1951857761e-105
TDEL0C020007.348ON2131887731e-105
NDAI0A019107.348ON2141817591e-102
KAFR0B008607.348ON2281887481e-101
Kwal_56.246357.348ON2261837411e-100
SAKL0F11330g7.348ON2081837363e-99
KLLA0D12386g7.348ON2111837224e-97
KNAG0C037707.348ON2231837234e-97
ACL150W7.348ON2191837173e-96
YDL166C (FAP7)7.348ON1971827093e-95
Ecym_47257.348ON2341837105e-95
Smik_4.727.348ON1971827051e-94
KLTH0H01298g7.348ON2141857034e-94
Suva_4.807.348ON2061827008e-94
Skud_4.917.348ON1941826911e-92
ZYRO0F11660g7.348ON1981856868e-92
CAGL0I03366g7.348ON2121886626e-88
TDEL0E007803.69ON33689860.011
TBLA0B084503.69ON33386860.011
Skud_14.473.69ON34089860.012
NCAS0A098903.69ON33689860.013
Suva_14.493.69ON34089860.013
YNL290W (RFC3)3.69ON34089860.014
Ecym_35343.69ON33286860.014
Smik_14.413.69ON34089850.017
KLLA0E13201g3.69ON32986850.017
KAFR0A082903.69ON33249850.018
NDAI0A060603.69ON33889850.019
SAKL0C12144g3.69ON32986840.021
KNAG0K023003.69ON33449830.027
Smik_15.623.103ON32349830.029
ZYRO0C02090g3.69ON33889820.039
AEL196W3.69ON33349810.058
TPHA0P012003.69ON33589800.061
YOL094C (RFC4)3.103ON32349790.091
KLTH0A01540g3.69ON32886780.11
ZYRO0G02002g1.517ON35225780.11
Skud_15.593.103ON32349780.11
Kpol_1066.383.69ON33633780.12
CAGL0M03575g3.69ON33189780.12
Suva_15.713.103ON32349780.13
Kwal_23.52473.69ON32933780.13
KNAG0G018808.236ON225130770.14
KLTH0C09900g3.103ON32249760.23
CAGL0F00451g1.517ON35225760.25
Kwal_56.226333.103ON32249750.26
NCAS0A123001.517ON35025750.27
KAFR0E003001.517ON35025750.27
NDAI0A039401.517ON35425750.27
TDEL0D052103.103ON32249750.28
KAFR0C013803.103ON32149750.30
KLLA0B13992g1.517ON35225750.30
KLTH0C02442g1.517ON35625750.31
TBLA0B019501.517ON35032750.32
TPHA0O002401.517ON35225750.33
Kpol_1018.1771.517ON35025750.33
YJR068W (RFC2)1.517ON35325750.34
KNAG0G002601.517ON35025750.34
Kwal_27.99421.517ON35625740.36
AFR422W1.517ON34825740.36
Suva_12.1581.517ON35325740.36
Smik_10.3581.517ON35325740.36
TDEL0F004401.517ON35425740.36
Kwal_27.121138.558ON506110750.37
Skud_10.2921.517ON35325740.38
SAKL0D12870g1.517ON35025740.40
Ecym_31501.517ON35025740.40
Kpol_1053.343.103ON32149730.58
TPHA0A007103.103ON32549720.72
KLLA0C03718g3.103ON32049720.74
CAGL0I07645g3.103ON32249720.77
ZYRO0B06248g3.103ON32149720.80
KLTH0E12936g8.558ON54479720.91
SAKL0C09812g3.103ON31949710.97
CAGL0K04983g2.26ON55989710.97
KNAG0K007403.103ON31949701.1
NDAI0G051503.103ON32149701.2
TBLA0E035203.103ON32425701.2
ADR111W3.103ON32149701.3
Ecym_70518.558ON54376701.4
Ecym_64662.26ON58434701.5
NCAS0C020208.558ON56277701.6
Ecym_27923.103ON31949691.8
TDEL0B028708.558ON57346691.8
KNAG0F009302.26ON58941691.8
YML065W (ORC1)4.327ON91452692.4
NDAI0E027308.558ON54422673.1
Zrou_YGOB_A13310g8.558ON55822673.3
CAGL0L09867g2.667ON260141663.3
ZYRO0A13310gsingletonOFF51522673.3
TDEL0B015808.478ON18118653.7
Smik_2.3268.558ON56446673.7
AEL258W8.558ON52678673.8
KLTH0D00418gsingletonON56142673.8
KAFR0A078802.26ON56154665.3
NDAI0C001402.667ON212142646.2
SAKL0F02046g3.515ON1659115657.4
KAFR0H028008.610ON28449638.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0E00520
         (209 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0E00520 Chr5 (95049..95678) [630 bp, 209 aa] {ON} Anc_7.348 ...   387   e-138
TPHA0F02950 Chr6 (649875..650525) [651 bp, 216 aa] {ON} Anc_7.34...   305   e-106
NCAS0A14140 Chr1 (2779202..2779876) [675 bp, 224 aa] {ON} Anc_7....   305   e-106
Kpol_530.33 s530 complement(81184..81771) [588 bp, 195 aa] {ON} ...   303   e-105
TDEL0C02000 Chr3 complement(347930..348571) [642 bp, 213 aa] {ON...   302   e-105
NDAI0A01910 Chr1 complement(428746..429390) [645 bp, 214 aa] {ON...   296   e-102
KAFR0B00860 Chr2 (161692..162378) [687 bp, 228 aa] {ON} Anc_7.34...   292   e-101
Kwal_56.24635 s56 (1083026..1083706) [681 bp, 226 aa] {ON} YDL16...   290   e-100
SAKL0F11330g Chr6 (882784..883410) [627 bp, 208 aa] {ON} similar...   288   3e-99
KLLA0D12386g Chr4 complement(1054141..1054776) [636 bp, 211 aa] ...   282   4e-97
KNAG0C03770 Chr3 (742558..743229) [672 bp, 223 aa] {ON} Anc_7.34...   283   4e-97
ACL150W Chr3 (87745..88404) [660 bp, 219 aa] {ON} Syntenic homol...   280   3e-96
YDL166C Chr4 complement(163449..164042) [594 bp, 197 aa] {ON}  F...   277   3e-95
Ecym_4725 Chr4 complement(1419236..1419940) [705 bp, 234 aa] {ON...   278   5e-95
Smik_4.72 Chr4 complement(140216..140809) [594 bp, 197 aa] {ON} ...   276   1e-94
KLTH0H01298g Chr8 complement(124206..124850) [645 bp, 214 aa] {O...   275   4e-94
Suva_4.80 Chr4 complement(150992..151612) [621 bp, 206 aa] {ON} ...   274   8e-94
Skud_4.91 Chr4 complement(159116..159700) [585 bp, 194 aa] {ON} ...   270   1e-92
ZYRO0F11660g Chr6 (955635..956231) [597 bp, 198 aa] {ON} similar...   268   8e-92
CAGL0I03366g Chr9 complement(287811..288449) [639 bp, 212 aa] {O...   259   6e-88
TDEL0E00780 Chr5 (162061..163071) [1011 bp, 336 aa] {ON} Anc_3.6...    38   0.011
TBLA0B08450 Chr2 complement(2024891..2025892) [1002 bp, 333 aa] ...    38   0.011
Skud_14.47 Chr14 (79783..80805) [1023 bp, 340 aa] {ON} YNL290W (...    38   0.012
NCAS0A09890 Chr1 complement(1978423..1979433) [1011 bp, 336 aa] ...    38   0.013
Suva_14.49 Chr14 (82953..83975) [1023 bp, 340 aa] {ON} YNL290W (...    38   0.013
YNL290W Chr14 (86218..87240) [1023 bp, 340 aa] {ON}  RFC3Subunit...    38   0.014
Ecym_3534 Chr3 (1013065..1014063) [999 bp, 332 aa] {ON} similar ...    38   0.014
Smik_14.41 Chr14 (70565..71587) [1023 bp, 340 aa] {ON} YNL290W (...    37   0.017
KLLA0E13201g Chr5 (1168489..1169478) [990 bp, 329 aa] {ON} highl...    37   0.017
KAFR0A08290 Chr1 complement(1662119..1663117) [999 bp, 332 aa] {...    37   0.018
NDAI0A06060 Chr1 complement(1374529..1375545) [1017 bp, 338 aa] ...    37   0.019
SAKL0C12144g Chr3 complement(1088849..1089838) [990 bp, 329 aa] ...    37   0.021
KNAG0K02300 Chr11 complement(459360..460364) [1005 bp, 334 aa] {...    37   0.027
Smik_15.62 Chr15 complement(104681..105652) [972 bp, 323 aa] {ON...    37   0.029
ZYRO0C02090g Chr3 complement(165011..166027) [1017 bp, 338 aa] {...    36   0.039
AEL196W Chr5 (264744..265745) [1002 bp, 333 aa] {ON} Syntenic ho...    36   0.058
TPHA0P01200 Chr16 complement(242758..243765) [1008 bp, 335 aa] {...    35   0.061
YOL094C Chr15 complement(141584..142555) [972 bp, 323 aa] {ON}  ...    35   0.091
KLTH0A01540g Chr1 (137284..138270) [987 bp, 328 aa] {ON} highly ...    35   0.11 
ZYRO0G02002g Chr7 (154079..155137) [1059 bp, 352 aa] {ON} highly...    35   0.11 
Skud_15.59 Chr15 complement(100958..101929) [972 bp, 323 aa] {ON...    35   0.11 
Kpol_1066.38 s1066 complement(64176..65186) [1011 bp, 336 aa] {O...    35   0.12 
CAGL0M03575g Chr13 complement(403738..404733) [996 bp, 331 aa] {...    35   0.12 
Suva_15.71 Chr15 complement(114865..115836) [972 bp, 323 aa] {ON...    35   0.13 
Kwal_23.5247 s23 complement(1073605..1074594) [990 bp, 329 aa] {...    35   0.13 
KNAG0G01880 Chr7 (420542..421219) [678 bp, 225 aa] {ON} Anc_8.23...    34   0.14 
KLTH0C09900g Chr3 complement(818369..819337) [969 bp, 322 aa] {O...    34   0.23 
CAGL0F00451g Chr6 complement(43750..44808) [1059 bp, 352 aa] {ON...    34   0.25 
Kwal_56.22633 s56 (212413..213381) [969 bp, 322 aa] {ON} YOL094C...    33   0.26 
NCAS0A12300 Chr1 (2438482..2439534) [1053 bp, 350 aa] {ON} Anc_1...    33   0.27 
KAFR0E00300 Chr5 complement(62003..63055) [1053 bp, 350 aa] {ON}...    33   0.27 
NDAI0A03940 Chr1 complement(885415..886479) [1065 bp, 354 aa] {O...    33   0.27 
TDEL0D05210 Chr4 (945843..946811) [969 bp, 322 aa] {ON} Anc_3.10...    33   0.28 
KAFR0C01380 Chr3 (284264..285229) [966 bp, 321 aa] {ON} Anc_3.10...    33   0.30 
KLLA0B13992g Chr2 (1230397..1231455) [1059 bp, 352 aa] {ON} simi...    33   0.30 
KLTH0C02442g Chr3 complement(215254..216324) [1071 bp, 356 aa] {...    33   0.31 
TBLA0B01950 Chr2 complement(449277..450329) [1053 bp, 350 aa] {O...    33   0.32 
TPHA0O00240 Chr15 complement(32729..33787) [1059 bp, 352 aa] {ON...    33   0.33 
Kpol_1018.177 s1018 (449193..450245) [1053 bp, 350 aa] {ON} (449...    33   0.33 
YJR068W Chr10 (567643..568704) [1062 bp, 353 aa] {ON}  RFC2Subun...    33   0.34 
KNAG0G00260 Chr7 complement(34240..35292) [1053 bp, 350 aa] {ON}...    33   0.34 
Kwal_27.9942 s27 complement(130159..131229) [1071 bp, 356 aa] {O...    33   0.36 
AFR422W Chr6 (1196892..1197938) [1047 bp, 348 aa] {ON} Syntenic ...    33   0.36 
Suva_12.158 Chr12 (245824..246885) [1062 bp, 353 aa] {ON} YJR068...    33   0.36 
Smik_10.358 Chr10 (556494..557555) [1062 bp, 353 aa] {ON} YJR068...    33   0.36 
TDEL0F00440 Chr6 complement(70924..71988) [1065 bp, 354 aa] {ON}...    33   0.36 
Kwal_27.12113 s27 complement(1090541..1092061) [1521 bp, 506 aa]...    33   0.37 
Skud_10.292 Chr10 (525090..526151) [1062 bp, 353 aa] {ON} YJR068...    33   0.38 
SAKL0D12870g Chr4 (1076258..1077310) [1053 bp, 350 aa] {ON} high...    33   0.40 
Ecym_3150 Chr3 complement(278432..279484) [1053 bp, 350 aa] {ON}...    33   0.40 
Kpol_1053.34 s1053 complement(54419..55063,55065..55385) [966 bp...    33   0.58 
TPHA0A00710 Chr1 complement(129039..130016) [978 bp, 325 aa] {ON...    32   0.72 
KLLA0C03718g Chr3 complement(339645..340607) [963 bp, 320 aa] {O...    32   0.74 
CAGL0I07645g Chr9 complement(736131..737099) [969 bp, 322 aa] {O...    32   0.77 
ZYRO0B06248g Chr2 (502255..503220) [966 bp, 321 aa] {ON} highly ...    32   0.80 
KLTH0E12936g Chr5 complement(1145066..1146700) [1635 bp, 544 aa]...    32   0.91 
SAKL0C09812g Chr3 complement(887754..888713) [960 bp, 319 aa] {O...    32   0.97 
CAGL0K04983g Chr11 complement(483181..484860) [1680 bp, 559 aa] ...    32   0.97 
KNAG0K00740 Chr11 complement(134107..135066) [960 bp, 319 aa] {O...    32   1.1  
NDAI0G05150 Chr7 (1249652..1250617) [966 bp, 321 aa] {ON} Anc_3....    32   1.2  
TBLA0E03520 Chr5 (873305..874279) [975 bp, 324 aa] {ON} Anc_3.10...    32   1.2  
ADR111W Chr4 (902185..903150) [966 bp, 321 aa] {ON} Syntenic hom...    32   1.3  
Ecym_7051 Chr7 complement(103898..104056,104172..105644) [1632 b...    32   1.4  
Ecym_6466 Chr6 complement(901576..903330) [1755 bp, 584 aa] {ON}...    32   1.5  
NCAS0C02020 Chr3 (375594..377126,377196..377351) [1689 bp, 562 a...    32   1.6  
Ecym_2792 Chr2 complement(1538111..1539070) [960 bp, 319 aa] {ON...    31   1.8  
TDEL0B02870 Chr2 (512594..514168,514238..514384) [1722 bp, 573 a...    31   1.8  
KNAG0F00930 Chr6 (170493..172262) [1770 bp, 589 aa] {ON} Anc_2.2...    31   1.8  
YML065W Chr13 (142210..144954) [2745 bp, 914 aa] {ON}  ORC1Large...    31   2.4  
NDAI0E02730 Chr5 (573056..574554,574636..574771) [1635 bp, 544 a...    30   3.1  
Zrou_YGOB_A13310g Chr1 complement(1049931..1050068,1050140..1051...    30   3.3  
CAGL0L09867g Chr12 (1056341..1057123) [783 bp, 260 aa] {ON} some...    30   3.3  
ZYRO0A13310g Chr1 complement(1050131..1051678) [1548 bp, 515 aa]...    30   3.3  
TDEL0B01580 Chr2 (279511..280056) [546 bp, 181 aa] {ON} Anc_8.47...    30   3.7  
Smik_2.326 Chr2 (586919..588469,588545..588688) [1695 bp, 564 aa...    30   3.7  
AEL258W Chr5 (152451..153911,153967..154086) [1581 bp, 526 aa] {...    30   3.8  
KLTH0D00418g Chr4 complement(37778..39463) [1686 bp, 561 aa] {ON...    30   3.8  
KAFR0A07880 Chr1 complement(1577607..1579292) [1686 bp, 561 aa] ...    30   5.3  
NDAI0C00140 Chr3 complement(19018..19656) [639 bp, 212 aa] {ON} ...    29   6.2  
SAKL0F02046g Chr6 complement(172863..177842) [4980 bp, 1659 aa] ...    30   7.4  
KAFR0H02800 Chr8 (534664..535518) [855 bp, 284 aa] {ON} Anc_8.61...    29   8.1  

>TBLA0E00520 Chr5 (95049..95678) [630 bp, 209 aa] {ON} Anc_7.348
           YDL166C
          Length = 209

 Score =  387 bits (995), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 188/188 (100%), Positives = 188/188 (100%)

Query: 1   MKSRRYLPNLLISGTPGTGKSSTCELLKRELEDYKYINISDFAKEFNCYDGFDKGRKSHI 60
           MKSRRYLPNLLISGTPGTGKSSTCELLKRELEDYKYINISDFAKEFNCYDGFDKGRKSHI
Sbjct: 1   MKSRRYLPNLLISGTPGTGKSSTCELLKRELEDYKYINISDFAKEFNCYDGFDKGRKSHI 60

Query: 61  VDEDKLLDELEPILREGHNIVDWHVNDVFPERLIDLVVILRADNSVLYDRLQNRKYHDAK 120
           VDEDKLLDELEPILREGHNIVDWHVNDVFPERLIDLVVILRADNSVLYDRLQNRKYHDAK
Sbjct: 61  VDEDKLLDELEPILREGHNIVDWHVNDVFPERLIDLVVILRADNSVLYDRLQNRKYHDAK 120

Query: 121 VQENLDAEIMGVVLQDAIDSYAQEIVIELQSNNTEEMTSNVDRIVSWVELWKKQHADGVT 180
           VQENLDAEIMGVVLQDAIDSYAQEIVIELQSNNTEEMTSNVDRIVSWVELWKKQHADGVT
Sbjct: 121 VQENLDAEIMGVVLQDAIDSYAQEIVIELQSNNTEEMTSNVDRIVSWVELWKKQHADGVT 180

Query: 181 NELGEIKK 188
           NELGEIKK
Sbjct: 181 NELGEIKK 188

>TPHA0F02950 Chr6 (649875..650525) [651 bp, 216 aa] {ON} Anc_7.348
           YDL166C
          Length = 216

 Score =  305 bits (781), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 144/183 (78%), Positives = 163/183 (89%)

Query: 3   SRRYLPNLLISGTPGTGKSSTCELLKRELEDYKYINISDFAKEFNCYDGFDKGRKSHIVD 62
           SRRY PNLLI+GTPG GKS+TCELL+R L DY Y NISDFAKE NCYDGFD+GRKSHIVD
Sbjct: 2   SRRYQPNLLITGTPGCGKSTTCELLQRRLSDYTYYNISDFAKEHNCYDGFDEGRKSHIVD 61

Query: 63  EDKLLDELEPILREGHNIVDWHVNDVFPERLIDLVVILRADNSVLYDRLQNRKYHDAKVQ 122
           EDKLLDELEP+LR+G  IVDWHVNDVFPERLIDLVV+LR DNSVLYDRL++R YHD+K+ 
Sbjct: 62  EDKLLDELEPLLRKGKCIVDWHVNDVFPERLIDLVVVLRCDNSVLYDRLKSRGYHDSKID 121

Query: 123 ENLDAEIMGVVLQDAIDSYAQEIVIELQSNNTEEMTSNVDRIVSWVELWKKQHADGVTNE 182
           EN+DAEIMGVVLQDA +SYAQEIV+ELQS+ TE+M  NVD+IV WVELW KQH +GVTNE
Sbjct: 122 ENMDAEIMGVVLQDAQESYAQEIVVELQSDTTEQMDENVDKIVDWVELWIKQHKNGVTNE 181

Query: 183 LGE 185
           L +
Sbjct: 182 LSK 184

>NCAS0A14140 Chr1 (2779202..2779876) [675 bp, 224 aa] {ON} Anc_7.348
           YDL166C
          Length = 224

 Score =  305 bits (781), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 140/182 (76%), Positives = 164/182 (90%)

Query: 2   KSRRYLPNLLISGTPGTGKSSTCELLKRELEDYKYINISDFAKEFNCYDGFDKGRKSHIV 61
           KSRRY PNLLI+GTPG GKS+TCELL+R L +YKY NISDFAKE +CYDG+DKGRKSHIV
Sbjct: 3   KSRRYQPNLLITGTPGCGKSTTCELLQRRLPEYKYYNISDFAKEHDCYDGYDKGRKSHIV 62

Query: 62  DEDKLLDELEPILREGHNIVDWHVNDVFPERLIDLVVILRADNSVLYDRLQNRKYHDAKV 121
           DEDKLLDELEP+LR+G +I+DWHVNDVFPERLIDLV +LR DNSVLYDRL  RKYHD K+
Sbjct: 63  DEDKLLDELEPLLRQGKSIIDWHVNDVFPERLIDLVAVLRCDNSVLYDRLHGRKYHDTKI 122

Query: 122 QENLDAEIMGVVLQDAIDSYAQEIVIELQSNNTEEMTSNVDRIVSWVELWKKQHADGVTN 181
           +EN+DAEIMGVVLQDA++SYA+EIV+ELQS+ TE+M +NVDRIV W ++W +QH DGVTN
Sbjct: 123 EENMDAEIMGVVLQDALESYAKEIVVELQSDTTEQMDANVDRIVDWQKMWLEQHEDGVTN 182

Query: 182 EL 183
           EL
Sbjct: 183 EL 184

>Kpol_530.33 s530 complement(81184..81771) [588 bp, 195 aa] {ON}
           complement(81184..81771) [588 nt, 196 aa]
          Length = 195

 Score =  303 bits (776), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 144/185 (77%), Positives = 164/185 (88%)

Query: 1   MKSRRYLPNLLISGTPGTGKSSTCELLKRELEDYKYINISDFAKEFNCYDGFDKGRKSHI 60
           M SRR  PNLLI+GTPG GKS++CELL+R L DYKY NISDFAKE +CY+G+D+ RKSHI
Sbjct: 1   MLSRRLKPNLLITGTPGCGKSTSCELLQRRLSDYKYYNISDFAKEHDCYEGYDEDRKSHI 60

Query: 61  VDEDKLLDELEPILREGHNIVDWHVNDVFPERLIDLVVILRADNSVLYDRLQNRKYHDAK 120
           VDEDKLLDELEP+LREG +IVDWHVNDVFPERLIDLVV+LR DNS+LYDRL  RKYHD+K
Sbjct: 61  VDEDKLLDELEPLLREGGSIVDWHVNDVFPERLIDLVVVLRCDNSILYDRLHARKYHDSK 120

Query: 121 VQENLDAEIMGVVLQDAIDSYAQEIVIELQSNNTEEMTSNVDRIVSWVELWKKQHADGVT 180
           +QENLDAEIMGVVLQDA +SYA+EIV+ELQS+ TE+M +NVDRIV WVELW KQH  GVT
Sbjct: 121 IQENLDAEIMGVVLQDAQESYAEEIVVELQSDTTEQMEANVDRIVDWVELWLKQHKKGVT 180

Query: 181 NELGE 185
           NEL E
Sbjct: 181 NELEE 185

>TDEL0C02000 Chr3 complement(347930..348571) [642 bp, 213 aa] {ON}
           Anc_7.348 YDL166C
          Length = 213

 Score =  302 bits (773), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 143/188 (76%), Positives = 166/188 (88%)

Query: 1   MKSRRYLPNLLISGTPGTGKSSTCELLKRELEDYKYINISDFAKEFNCYDGFDKGRKSHI 60
           M+ RR+ PNLLI+GTPG GKS+TCELL+R L DYKY NISDFAKE +C+DG+D+ RKS+I
Sbjct: 1   MEPRRFKPNLLITGTPGCGKSTTCELLQRRLPDYKYYNISDFAKEHDCHDGYDEARKSYI 60

Query: 61  VDEDKLLDELEPILREGHNIVDWHVNDVFPERLIDLVVILRADNSVLYDRLQNRKYHDAK 120
           VDEDKLLDELEP+LREG  IVDWHVNDVFPERLIDLVV+LR DN++LYDRL++R YHDAK
Sbjct: 61  VDEDKLLDELEPLLREGAAIVDWHVNDVFPERLIDLVVVLRCDNTILYDRLKSRDYHDAK 120

Query: 121 VQENLDAEIMGVVLQDAIDSYAQEIVIELQSNNTEEMTSNVDRIVSWVELWKKQHADGVT 180
           +QENLDAEIMGVVLQDA DSY QEIV+ELQS++TE+M +NVDRIVSW +LW KQH DG T
Sbjct: 121 IQENLDAEIMGVVLQDATDSYEQEIVVELQSDSTEQMEANVDRIVSWEKLWLKQHKDGQT 180

Query: 181 NELGEIKK 188
           NEL E  K
Sbjct: 181 NELLERTK 188

>NDAI0A01910 Chr1 complement(428746..429390) [645 bp, 214 aa] {ON}
           Anc_7.348 YDL166C
          Length = 214

 Score =  296 bits (759), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 136/181 (75%), Positives = 163/181 (90%)

Query: 3   SRRYLPNLLISGTPGTGKSSTCELLKRELEDYKYINISDFAKEFNCYDGFDKGRKSHIVD 62
           SRRY PNLLI+GTPG+GKS+TCELL+R L +Y Y NISDFAKE +CY+G+DKGRKSHIVD
Sbjct: 6   SRRYEPNLLITGTPGSGKSTTCELLQRRLPEYAYYNISDFAKENDCYEGYDKGRKSHIVD 65

Query: 63  EDKLLDELEPILREGHNIVDWHVNDVFPERLIDLVVILRADNSVLYDRLQNRKYHDAKVQ 122
           EDKLLDELEP+LR+G +IVDWHVND+FPERLIDLVV+LR DNS+LYDRL  R YHD+K+Q
Sbjct: 66  EDKLLDELEPLLRKGKSIVDWHVNDIFPERLIDLVVVLRCDNSILYDRLNKRGYHDSKIQ 125

Query: 123 ENLDAEIMGVVLQDAIDSYAQEIVIELQSNNTEEMTSNVDRIVSWVELWKKQHADGVTNE 182
           ENLDAEIMGVVLQDA++SY QEIV+ELQS++TE+M +NV+RIV W ++W  QH +GVTNE
Sbjct: 126 ENLDAEIMGVVLQDAVESYQQEIVVELQSDDTEQMEANVERIVEWHKMWMDQHKNGVTNE 185

Query: 183 L 183
           L
Sbjct: 186 L 186

>KAFR0B00860 Chr2 (161692..162378) [687 bp, 228 aa] {ON} Anc_7.348
           YDL166C
          Length = 228

 Score =  292 bits (748), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 135/188 (71%), Positives = 163/188 (86%), Gaps = 1/188 (0%)

Query: 2   KSRRYLPNLLISGTPGTGKSSTCELLKRELEDYKYINISDFAKEFNCYDGFDKGRKSHIV 61
           +SRRY PNLL++GTPG GKS+TCELL R L DY Y NIS+FA++  CYDG+D+ RKSHIV
Sbjct: 7   ESRRYSPNLLVTGTPGCGKSTTCELLMRRLPDYTYFNISEFAEKHKCYDGYDESRKSHIV 66

Query: 62  DEDKLLDELEPILREGHNIVDWHVNDVFPERLIDLVVILRADNSVLYDRLQNRKYHDAKV 121
           D+DKLLDELEP+LR G +I+DWHVNDVFPERLIDLVV+LR DNS+L+DRL  R YH++K+
Sbjct: 67  DDDKLLDELEPLLRRGKSIIDWHVNDVFPERLIDLVVVLRCDNSILFDRLHGRGYHESKI 126

Query: 122 QENLDAEIMGVVLQDAIDSYAQEIVIELQSNNTEEMTSNVDRIVSWVELWKKQHADGVTN 181
           QENLDAEIMGVVLQDA+DSY QEIV+ELQSN+TEEM +NV+RIV+W E+W  QH +GVTN
Sbjct: 127 QENLDAEIMGVVLQDALDSYEQEIVVELQSNSTEEMDANVERIVAWQEMWLTQHKNGVTN 186

Query: 182 EL-GEIKK 188
           E  GE+ K
Sbjct: 187 EYQGELPK 194

>Kwal_56.24635 s56 (1083026..1083706) [681 bp, 226 aa] {ON} YDL166C
           (FAP7) - Nuclear protein involved in oxidative stress
           response [contig 161] FULL
          Length = 226

 Score =  290 bits (741), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 133/183 (72%), Positives = 156/183 (85%)

Query: 1   MKSRRYLPNLLISGTPGTGKSSTCELLKRELEDYKYINISDFAKEFNCYDGFDKGRKSHI 60
           M S R  PN+L++GTPG GK+STCELL+R LE  KY NISDFAKE+ CYDG+D+ RKSHI
Sbjct: 1   MASTRTSPNILVTGTPGCGKTSTCELLQRRLEGSKYYNISDFAKEYKCYDGYDEARKSHI 60

Query: 61  VDEDKLLDELEPILREGHNIVDWHVNDVFPERLIDLVVILRADNSVLYDRLQNRKYHDAK 120
           VDEDKLLDELEP+LR G  IVDWHVNDVFPERLIDLVV+LR DNS L+DRL  R YH+AK
Sbjct: 61  VDEDKLLDELEPLLRAGGAIVDWHVNDVFPERLIDLVVVLRTDNSALFDRLSKRGYHEAK 120

Query: 121 VQENLDAEIMGVVLQDAIDSYAQEIVIELQSNNTEEMTSNVDRIVSWVELWKKQHADGVT 180
           +QEN+DAEIMGVV+ DA DSYAQEIV+ELQS+ TE+M  NVDRIV+W + W++QH +GVT
Sbjct: 121 IQENIDAEIMGVVMHDARDSYAQEIVVELQSDTTEQMDENVDRIVTWRDAWREQHPEGVT 180

Query: 181 NEL 183
           NEL
Sbjct: 181 NEL 183

>SAKL0F11330g Chr6 (882784..883410) [627 bp, 208 aa] {ON} similar to
           uniprot|Q12055 Saccharomyces cerevisiae YDL166C FAP7
           Essential nuclear protein involved in the oxidative
           stress response
          Length = 208

 Score =  288 bits (736), Expect = 3e-99,   Method: Compositional matrix adjust.
 Identities = 132/183 (72%), Positives = 157/183 (85%)

Query: 1   MKSRRYLPNLLISGTPGTGKSSTCELLKRELEDYKYINISDFAKEFNCYDGFDKGRKSHI 60
           M+++R  PN+L++GTPG GKS+TCELL R L DY Y NISDFA+E  CYDG+D+ RKSHI
Sbjct: 1   METKRSRPNILVTGTPGCGKSTTCELLVRRLSDYTYYNISDFAREHKCYDGYDEVRKSHI 60

Query: 61  VDEDKLLDELEPILREGHNIVDWHVNDVFPERLIDLVVILRADNSVLYDRLQNRKYHDAK 120
           VDEDKLLDELEP+LR+G +IVDWHVNDVFPERLIDLVV+LR DNS+LYDRL  R YHD+K
Sbjct: 61  VDEDKLLDELEPLLRKGKSIVDWHVNDVFPERLIDLVVVLRCDNSILYDRLHKRGYHDSK 120

Query: 121 VQENLDAEIMGVVLQDAIDSYAQEIVIELQSNNTEEMTSNVDRIVSWVELWKKQHADGVT 180
           ++ENLDAEIMGVV+QDA +SYAQEIV+ELQS+  E M +NVDRIV W E+W  QH +GVT
Sbjct: 121 IEENLDAEIMGVVMQDAAESYAQEIVVELQSDTVEHMDANVDRIVEWQEMWLNQHPNGVT 180

Query: 181 NEL 183
           NEL
Sbjct: 181 NEL 183

>KLLA0D12386g Chr4 complement(1054141..1054776) [636 bp, 211 aa]
           {ON} similar to uniprot|Q12055 Saccharomyces cerevisiae
           YDL166C FAP7 Essential nuclear protein involved in the
           oxidative stress response
          Length = 211

 Score =  282 bits (722), Expect = 4e-97,   Method: Compositional matrix adjust.
 Identities = 130/183 (71%), Positives = 156/183 (85%)

Query: 1   MKSRRYLPNLLISGTPGTGKSSTCELLKRELEDYKYINISDFAKEFNCYDGFDKGRKSHI 60
           M+  R+ PN+++SGTPG GKS+TCELL R L +Y Y NISDFAKE +CYDG+D  RKS+I
Sbjct: 1   MEPVRFKPNIIVSGTPGCGKSTTCELLSRRLPEYTYYNISDFAKEHDCYDGYDDARKSNI 60

Query: 61  VDEDKLLDELEPILREGHNIVDWHVNDVFPERLIDLVVILRADNSVLYDRLQNRKYHDAK 120
           VD+DKLLDELEP+LR+G  I+DWHVNDVFPERL+DLVV+LR DN +LYDRL  R YH+AK
Sbjct: 61  VDDDKLLDELEPLLRKGGCIIDWHVNDVFPERLVDLVVVLRCDNGILYDRLNKRGYHNAK 120

Query: 121 VQENLDAEIMGVVLQDAIDSYAQEIVIELQSNNTEEMTSNVDRIVSWVELWKKQHADGVT 180
           ++EN+DAEIMGVVLQDA DSYAQEIV+ELQS+ TEEM  NVDRI++W E+W KQH  GVT
Sbjct: 121 IEENMDAEIMGVVLQDAHDSYAQEIVVELQSDTTEEMDKNVDRIIAWQEIWLKQHKKGVT 180

Query: 181 NEL 183
           NEL
Sbjct: 181 NEL 183

>KNAG0C03770 Chr3 (742558..743229) [672 bp, 223 aa] {ON} Anc_7.348
           YDL166C
          Length = 223

 Score =  283 bits (723), Expect = 4e-97,   Method: Compositional matrix adjust.
 Identities = 127/183 (69%), Positives = 157/183 (85%)

Query: 2   KSRRYLPNLLISGTPGTGKSSTCELLKRELEDYKYINISDFAKEFNCYDGFDKGRKSHIV 61
           +SRR  PN+L++GTPGTGKS+TCELL R L DY Y NISDFA +  CYDG+D+ RKSHIV
Sbjct: 3   ESRRLNPNILVTGTPGTGKSTTCELLLRNLPDYTYYNISDFAAKNKCYDGYDEARKSHIV 62

Query: 62  DEDKLLDELEPILREGHNIVDWHVNDVFPERLIDLVVILRADNSVLYDRLQNRKYHDAKV 121
           DEDKLLDELEP+L  G NI+DWHVNDVFPERLIDLV +LR D+SVL+DRL  R+YH +K+
Sbjct: 63  DEDKLLDELEPLLHSGGNIIDWHVNDVFPERLIDLVAVLRCDSSVLFDRLNKREYHSSKI 122

Query: 122 QENLDAEIMGVVLQDAIDSYAQEIVIELQSNNTEEMTSNVDRIVSWVELWKKQHADGVTN 181
            EN+DAEIMGVVLQDA+DSY ++IV+ELQS++TE+M +NVDR+V+W  +WK+QH +GVTN
Sbjct: 123 DENMDAEIMGVVLQDALDSYEEQIVVELQSDDTEQMAANVDRVVTWTTMWKEQHPEGVTN 182

Query: 182 ELG 184
           EL 
Sbjct: 183 ELS 185

>ACL150W Chr3 (87745..88404) [660 bp, 219 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YDL166C (FAP7)
          Length = 219

 Score =  280 bits (717), Expect = 3e-96,   Method: Compositional matrix adjust.
 Identities = 126/183 (68%), Positives = 155/183 (84%)

Query: 1   MKSRRYLPNLLISGTPGTGKSSTCELLKRELEDYKYINISDFAKEFNCYDGFDKGRKSHI 60
           M+  R  PN+L+SGTPG GKS+TCELL+R L DY+Y NISDFA+E NCYDG+D+ RKSHI
Sbjct: 1   MQQTRCRPNILVSGTPGCGKSTTCELLQRHLPDYQYFNISDFAREHNCYDGYDEARKSHI 60

Query: 61  VDEDKLLDELEPILREGHNIVDWHVNDVFPERLIDLVVILRADNSVLYDRLQNRKYHDAK 120
           VDED+LLDELEP+LR G  IVDWHVND+FPERLIDLVV+LR DN++L+DRLQ R YH +K
Sbjct: 61  VDEDRLLDELEPLLRRGGAIVDWHVNDIFPERLIDLVVVLRCDNAILHDRLQKRGYHSSK 120

Query: 121 VQENLDAEIMGVVLQDAIDSYAQEIVIELQSNNTEEMTSNVDRIVSWVELWKKQHADGVT 180
           ++EN+DAEIMGVVLQDA+DSY +EIV+ELQS++TE+M  NVDRI +W   W  +H DGV+
Sbjct: 121 IEENIDAEIMGVVLQDALDSYVREIVVELQSDDTEQMQQNVDRIAAWEANWVSEHPDGVS 180

Query: 181 NEL 183
           N L
Sbjct: 181 NAL 183

>YDL166C Chr4 complement(163449..164042) [594 bp, 197 aa] {ON}
           FAP7Essential NTPase required for small ribosome subunit
           synthesis, mediates processing of the 20S pre-rRNA at
           site D in the cytoplasm but associates only transiently
           with 43S preribosomes via Rps14p, may be the
           endonuclease for site D
          Length = 197

 Score =  277 bits (709), Expect = 3e-95,   Method: Compositional matrix adjust.
 Identities = 127/182 (69%), Positives = 158/182 (86%)

Query: 1   MKSRRYLPNLLISGTPGTGKSSTCELLKRELEDYKYINISDFAKEFNCYDGFDKGRKSHI 60
           M++RRY PN++++GTPG GKSSTCE LK +L+DYKY NISDFAK+ +C++G+D+GRKSHI
Sbjct: 1   MEARRYGPNIIVTGTPGCGKSSTCEFLKNKLKDYKYYNISDFAKDNDCFEGYDEGRKSHI 60

Query: 61  VDEDKLLDELEPILREGHNIVDWHVNDVFPERLIDLVVILRADNSVLYDRLQNRKYHDAK 120
           VDEDKLLD LEP+LR+G++IVDWHVNDVFPERLIDLVV+LR DNS LY RL  R YHD+K
Sbjct: 61  VDEDKLLDMLEPLLRQGNSIVDWHVNDVFPERLIDLVVVLRCDNSNLYSRLHARGYHDSK 120

Query: 121 VQENLDAEIMGVVLQDAIDSYAQEIVIELQSNNTEEMTSNVDRIVSWVELWKKQHADGVT 180
           ++ENLDAEIMGVV QDA++SY   IV+ELQS+  E+M SNV RIV+W ++W +QH DGVT
Sbjct: 121 IEENLDAEIMGVVKQDAVESYEPHIVVELQSDTKEDMVSNVSRIVAWEKMWLEQHPDGVT 180

Query: 181 NE 182
           NE
Sbjct: 181 NE 182

>Ecym_4725 Chr4 complement(1419236..1419940) [705 bp, 234 aa] {ON}
           similar to Ashbya gossypii ACL150W
          Length = 234

 Score =  278 bits (710), Expect = 5e-95,   Method: Compositional matrix adjust.
 Identities = 127/183 (69%), Positives = 152/183 (83%)

Query: 1   MKSRRYLPNLLISGTPGTGKSSTCELLKRELEDYKYINISDFAKEFNCYDGFDKGRKSHI 60
           M S R  PN++++GTPG GK++TCELL+R L+D +Y NISDFAKE +CY+G+D+GRKSHI
Sbjct: 15  MDSTRLRPNIIVTGTPGCGKTTTCELLQRRLDDCRYYNISDFAKEHDCYEGYDEGRKSHI 74

Query: 61  VDEDKLLDELEPILREGHNIVDWHVNDVFPERLIDLVVILRADNSVLYDRLQNRKYHDAK 120
           VDEDKLLDELEP+LR+G  I+DWHVNDVFPERLIDLVV+LR DNS LYDRL  R YHDAK
Sbjct: 75  VDEDKLLDELEPLLRKGGAIIDWHVNDVFPERLIDLVVVLRCDNSTLYDRLHKRGYHDAK 134

Query: 121 VQENLDAEIMGVVLQDAIDSYAQEIVIELQSNNTEEMTSNVDRIVSWVELWKKQHADGVT 180
           ++EN+DAEIMGVVLQDA+DSY  +IV+ELQSN   +M  NV RIV+W   W  QH  GVT
Sbjct: 135 IEENIDAEIMGVVLQDAMDSYVHDIVVELQSNTANQMEENVGRIVAWESSWVSQHPTGVT 194

Query: 181 NEL 183
           NEL
Sbjct: 195 NEL 197

>Smik_4.72 Chr4 complement(140216..140809) [594 bp, 197 aa] {ON}
           YDL166C (REAL)
          Length = 197

 Score =  276 bits (705), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 125/182 (68%), Positives = 158/182 (86%)

Query: 1   MKSRRYLPNLLISGTPGTGKSSTCELLKRELEDYKYINISDFAKEFNCYDGFDKGRKSHI 60
           M+SRRY PN++++GTPG GKSS CELLK +L+DYKY NISDFAK+ +C++G+D+GRKSHI
Sbjct: 1   MESRRYGPNIIVTGTPGCGKSSMCELLKNKLKDYKYYNISDFAKDHDCFEGYDEGRKSHI 60

Query: 61  VDEDKLLDELEPILREGHNIVDWHVNDVFPERLIDLVVILRADNSVLYDRLQNRKYHDAK 120
           VDEDKLLD LEP+LR+G++IVDWHVND+FPERLIDLVV+LR DNS LY RL  R YHD+K
Sbjct: 61  VDEDKLLDVLEPLLRQGNSIVDWHVNDIFPERLIDLVVVLRCDNSYLYSRLHARGYHDSK 120

Query: 121 VQENLDAEIMGVVLQDAIDSYAQEIVIELQSNNTEEMTSNVDRIVSWVELWKKQHADGVT 180
           ++ENLDAEIMGVV QDA++SY   IV+ELQS+  E+M SNV RI++W ++W +QH +GVT
Sbjct: 121 IEENLDAEIMGVVKQDAVESYEPHIVVELQSDTKEDMESNVSRIITWEKMWLEQHPEGVT 180

Query: 181 NE 182
           NE
Sbjct: 181 NE 182

>KLTH0H01298g Chr8 complement(124206..124850) [645 bp, 214 aa] {ON}
           similar to uniprot|Q12055 Saccharomyces cerevisiae
           YDL166C FAP7 Essential nuclear protein involved in the
           oxidative stress response
          Length = 214

 Score =  275 bits (703), Expect = 4e-94,   Method: Compositional matrix adjust.
 Identities = 125/185 (67%), Positives = 156/185 (84%)

Query: 1   MKSRRYLPNLLISGTPGTGKSSTCELLKRELEDYKYINISDFAKEFNCYDGFDKGRKSHI 60
           M S R+ PN+L++GTPG GK+STCELL+R L+D  Y NISDFA++  CYDG+D+ RKSHI
Sbjct: 1   MLSTRFAPNILVTGTPGCGKTSTCELLQRRLKDANYYNISDFAQQHECYDGYDEARKSHI 60

Query: 61  VDEDKLLDELEPILREGHNIVDWHVNDVFPERLIDLVVILRADNSVLYDRLQNRKYHDAK 120
           VDED+LLDELEP++R+G  IVDWHVND+FPERLIDLVV+LR DN+VLYDRL++R YH+AK
Sbjct: 61  VDEDRLLDELEPLMRKGGAIVDWHVNDIFPERLIDLVVVLRTDNTVLYDRLKSRGYHEAK 120

Query: 121 VQENLDAEIMGVVLQDAIDSYAQEIVIELQSNNTEEMTSNVDRIVSWVELWKKQHADGVT 180
           +QEN+DAEIMGVV+QDA DSY +EIV+ELQS+  ++M  NVDRI SW   W +Q+  GVT
Sbjct: 121 IQENIDAEIMGVVIQDAQDSYEKEIVVELQSDTADQMDENVDRIASWSAAWLEQNPKGVT 180

Query: 181 NELGE 185
           NEL E
Sbjct: 181 NELVE 185

>Suva_4.80 Chr4 complement(150992..151612) [621 bp, 206 aa] {ON}
           YDL166C (REAL)
          Length = 206

 Score =  274 bits (700), Expect = 8e-94,   Method: Compositional matrix adjust.
 Identities = 124/182 (68%), Positives = 158/182 (86%)

Query: 1   MKSRRYLPNLLISGTPGTGKSSTCELLKRELEDYKYINISDFAKEFNCYDGFDKGRKSHI 60
           M+SRRY PN++++GTPG GKSSTCELLK EL+ YKY NISDFAK+ +C++G+D+GRKSHI
Sbjct: 1   MESRRYGPNIIVTGTPGCGKSSTCELLKDELKGYKYYNISDFAKDNDCFEGYDEGRKSHI 60

Query: 61  VDEDKLLDELEPILREGHNIVDWHVNDVFPERLIDLVVILRADNSVLYDRLQNRKYHDAK 120
           VDEDKLLD LEP++R+G++I+DWHVNDVFPERLIDLVV+LR DNS LY RL  R YHD+K
Sbjct: 61  VDEDKLLDTLEPLMRQGNSIIDWHVNDVFPERLIDLVVVLRCDNSKLYSRLHARGYHDSK 120

Query: 121 VQENLDAEIMGVVLQDAIDSYAQEIVIELQSNNTEEMTSNVDRIVSWVELWKKQHADGVT 180
           ++ENLDAEIMGVV QDA+DSY   IV+ELQS+  +++ SNV RI++W ++W +QH +GVT
Sbjct: 121 IEENLDAEIMGVVKQDAVDSYEPHIVVELQSDTKQDIVSNVARIIAWEKMWLEQHPEGVT 180

Query: 181 NE 182
           NE
Sbjct: 181 NE 182

>Skud_4.91 Chr4 complement(159116..159700) [585 bp, 194 aa] {ON}
           YDL166C (REAL)
          Length = 194

 Score =  270 bits (691), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 124/182 (68%), Positives = 156/182 (85%)

Query: 1   MKSRRYLPNLLISGTPGTGKSSTCELLKRELEDYKYINISDFAKEFNCYDGFDKGRKSHI 60
           M+ RR+ PN++++GTPG GKSSTCELLK EL+ YKY NISDFAK+ +C++ +D+ RKSHI
Sbjct: 1   MELRRFGPNIIVTGTPGCGKSSTCELLKDELKGYKYYNISDFAKDNDCFEAYDEARKSHI 60

Query: 61  VDEDKLLDELEPILREGHNIVDWHVNDVFPERLIDLVVILRADNSVLYDRLQNRKYHDAK 120
           VDEDKLLD+LEP+LR+G++I+DWHVNDVFPERLIDLVV+LR DNS LY RL  R YHD+K
Sbjct: 61  VDEDKLLDKLEPLLRQGNSIIDWHVNDVFPERLIDLVVVLRCDNSNLYSRLHARGYHDSK 120

Query: 121 VQENLDAEIMGVVLQDAIDSYAQEIVIELQSNNTEEMTSNVDRIVSWVELWKKQHADGVT 180
           ++ENLDAEIMGVV QDA+DSY   IV+ELQ +  E+M SNV RIV+W ++W +QH+DGVT
Sbjct: 121 IEENLDAEIMGVVKQDAVDSYEPHIVVELQGDTKEDMVSNVARIVAWEKMWLEQHSDGVT 180

Query: 181 NE 182
           NE
Sbjct: 181 NE 182

>ZYRO0F11660g Chr6 (955635..956231) [597 bp, 198 aa] {ON} similar to
           uniprot|Q12055 Saccharomyces cerevisiae YDL166C FAP7
           Essential nuclear protein involved in the oxidative
           stress response
          Length = 198

 Score =  268 bits (686), Expect = 8e-92,   Method: Compositional matrix adjust.
 Identities = 131/185 (70%), Positives = 163/185 (88%)

Query: 1   MKSRRYLPNLLISGTPGTGKSSTCELLKRELEDYKYINISDFAKEFNCYDGFDKGRKSHI 60
           M+SRRY PN+LI+GTPG+GKS+T ELL+R L D++Y NISDFA+E +C+DG+D+GRKSHI
Sbjct: 1   MESRRYHPNVLITGTPGSGKSTTSELLQRRLSDFQYYNISDFAQENDCFDGYDEGRKSHI 60

Query: 61  VDEDKLLDELEPILREGHNIVDWHVNDVFPERLIDLVVILRADNSVLYDRLQNRKYHDAK 120
           VDEDKLLD LEP+LR+G NI+DWHVNDVFPERLIDLVV+LR +NS+L+ RL+ R YH  K
Sbjct: 61  VDEDKLLDLLEPLLRKGGNIIDWHVNDVFPERLIDLVVVLRCENSILFKRLKKRGYHQTK 120

Query: 121 VQENLDAEIMGVVLQDAIDSYAQEIVIELQSNNTEEMTSNVDRIVSWVELWKKQHADGVT 180
           + EN+DAEIMGVV+QDA+DSY +EIV+EL S++TE+M +NVDRIVSWVELW+ QH  GVT
Sbjct: 121 IDENIDAEIMGVVMQDALDSYEKEIVVELTSDSTEQMENNVDRIVSWVELWQDQHHSGVT 180

Query: 181 NELGE 185
           NEL E
Sbjct: 181 NELHE 185

>CAGL0I03366g Chr9 complement(287811..288449) [639 bp, 212 aa] {ON}
           highly similar to uniprot|Q12055 Saccharomyces
           cerevisiae YDL166c
          Length = 212

 Score =  259 bits (662), Expect = 6e-88,   Method: Compositional matrix adjust.
 Identities = 130/188 (69%), Positives = 163/188 (86%)

Query: 1   MKSRRYLPNLLISGTPGTGKSSTCELLKRELEDYKYINISDFAKEFNCYDGFDKGRKSHI 60
           M SRR+ PN++++GTPG GKS+TCELL+R L+ YKY NIS+FA+E  CYDG+D+GRKSHI
Sbjct: 1   MGSRRFHPNIIVTGTPGCGKSTTCELLQRRLDGYKYYNISEFAEEHKCYDGYDEGRKSHI 60

Query: 61  VDEDKLLDELEPILREGHNIVDWHVNDVFPERLIDLVVILRADNSVLYDRLQNRKYHDAK 120
           VDEDKLLDELEP+L EG +I+DWHVNDVFPERLIDLVV+LR++N  LYDRL+ R YHD+K
Sbjct: 61  VDEDKLLDELEPLLLEGKSIIDWHVNDVFPERLIDLVVVLRSENGKLYDRLKARGYHDSK 120

Query: 121 VQENLDAEIMGVVLQDAIDSYAQEIVIELQSNNTEEMTSNVDRIVSWVELWKKQHADGVT 180
           ++ENLDAEIMGVVLQDA +SY  EIV+ELQSN TE+M +NVDRI +WV+ W ++H DGV+
Sbjct: 121 IEENLDAEIMGVVLQDAQESYEPEIVVELQSNTTEDMENNVDRINTWVDNWVEEHKDGVS 180

Query: 181 NELGEIKK 188
           +EL + KK
Sbjct: 181 SELKDGKK 188

>TDEL0E00780 Chr5 (162061..163071) [1011 bp, 336 aa] {ON} Anc_3.69
           YNL290W
          Length = 336

 Score = 37.7 bits (86), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 31/89 (34%), Positives = 38/89 (42%), Gaps = 23/89 (25%)

Query: 7   LPNLLISGTPGTGKSSTCELLKRELEDYKYIN-------------------ISDFAKEFN 47
           LP+LL  G PGTGK+ST   L RE+    Y N                   I DFA    
Sbjct: 44  LPHLLFYGPPGTGKTSTVVALAREIYGKNYSNMVLELNASDDRGIDVVRNQIKDFASTRQ 103

Query: 48  CYDGFDKGRKSHIVDE-DKLLDELEPILR 75
               F KG K  I+DE D + +  +  LR
Sbjct: 104 I---FSKGFKLIILDEADAMTNAAQNALR 129

>TBLA0B08450 Chr2 complement(2024891..2025892) [1002 bp, 333 aa]
           {ON} Anc_3.69 YNL290W
          Length = 333

 Score = 37.7 bits (86), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 30/86 (34%), Positives = 40/86 (46%), Gaps = 17/86 (19%)

Query: 7   LPNLLISGTPGTGKSSTCELLKRELEDYKYIN---------------ISDFAKEF-NCYD 50
           LP+LL  G PGTGK+ST   L RE+    Y N               + +  KEF +   
Sbjct: 44  LPHLLFYGPPGTGKTSTIVALAREIYGNNYSNMVLELNASDDRGIDVVRNQIKEFASTRQ 103

Query: 51  GFDKGRKSHIVDE-DKLLDELEPILR 75
            F KG K  I+DE D + +  +  LR
Sbjct: 104 IFSKGFKLIILDEADAMTNAAQNALR 129

>Skud_14.47 Chr14 (79783..80805) [1023 bp, 340 aa] {ON} YNL290W
           (REAL)
          Length = 340

 Score = 37.7 bits (86), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 31/89 (34%), Positives = 38/89 (42%), Gaps = 23/89 (25%)

Query: 7   LPNLLISGTPGTGKSSTCELLKRELEDYKYIN-------------------ISDFAKEFN 47
           LP+LL  G PGTGK+ST   L RE+    Y N                   I DFA    
Sbjct: 46  LPHLLFYGPPGTGKTSTIVALAREIYGRNYSNMVLELNASDDRGIDVVRNQIKDFASTRQ 105

Query: 48  CYDGFDKGRKSHIVDE-DKLLDELEPILR 75
               F KG K  I+DE D + +  +  LR
Sbjct: 106 I---FSKGFKLIILDEADAMTNAAQNALR 131

>NCAS0A09890 Chr1 complement(1978423..1979433) [1011 bp, 336 aa]
           {ON} Anc_3.69
          Length = 336

 Score = 37.7 bits (86), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 31/89 (34%), Positives = 38/89 (42%), Gaps = 23/89 (25%)

Query: 7   LPNLLISGTPGTGKSSTCELLKRELEDYKYIN-------------------ISDFAKEFN 47
           LP+LL  G PGTGK+ST   L RE+    Y N                   I DFA    
Sbjct: 46  LPHLLFYGPPGTGKTSTIVALAREIYGRNYSNMVLELNASDDRGIDVVRNQIKDFASTRQ 105

Query: 48  CYDGFDKGRKSHIVDE-DKLLDELEPILR 75
               F KG K  I+DE D + +  +  LR
Sbjct: 106 I---FSKGFKLIILDEADAMTNAAQNALR 131

>Suva_14.49 Chr14 (82953..83975) [1023 bp, 340 aa] {ON} YNL290W
           (REAL)
          Length = 340

 Score = 37.7 bits (86), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 31/89 (34%), Positives = 38/89 (42%), Gaps = 23/89 (25%)

Query: 7   LPNLLISGTPGTGKSSTCELLKRELEDYKYIN-------------------ISDFAKEFN 47
           LP+LL  G PGTGK+ST   L RE+    Y N                   I DFA    
Sbjct: 46  LPHLLFYGPPGTGKTSTIVALAREIYGKNYSNMVLELNASDDRGIDVVRNQIKDFASTRQ 105

Query: 48  CYDGFDKGRKSHIVDE-DKLLDELEPILR 75
               F KG K  I+DE D + +  +  LR
Sbjct: 106 I---FSKGFKLIILDEADAMTNAAQNALR 131

>YNL290W Chr14 (86218..87240) [1023 bp, 340 aa] {ON}  RFC3Subunit of
           heteropentameric Replication factor C (RF-C), which is a
           DNA binding protein and ATPase that acts as a clamp
           loader of the proliferating cell nuclear antigen (PCNA)
           processivity factor for DNA polymerases delta and
           epsilon
          Length = 340

 Score = 37.7 bits (86), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 31/89 (34%), Positives = 38/89 (42%), Gaps = 23/89 (25%)

Query: 7   LPNLLISGTPGTGKSSTCELLKRELEDYKYIN-------------------ISDFAKEFN 47
           LP+LL  G PGTGK+ST   L RE+    Y N                   I DFA    
Sbjct: 46  LPHLLFYGPPGTGKTSTIVALAREIYGKNYSNMVLELNASDDRGIDVVRNQIKDFASTRQ 105

Query: 48  CYDGFDKGRKSHIVDE-DKLLDELEPILR 75
               F KG K  I+DE D + +  +  LR
Sbjct: 106 I---FSKGFKLIILDEADAMTNAAQNALR 131

>Ecym_3534 Chr3 (1013065..1014063) [999 bp, 332 aa] {ON} similar to
           Ashbya gossypii AEL196W
          Length = 332

 Score = 37.7 bits (86), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 40/86 (46%), Gaps = 17/86 (19%)

Query: 7   LPNLLISGTPGTGKSSTCELLKRELEDYKY------INISD---------FAKEF-NCYD 50
           LP+LL  G PGTGK+ST   L RE+    Y      +N SD           KEF +   
Sbjct: 44  LPHLLFYGPPGTGKTSTISALAREIYGKNYRKMVLELNASDDRGIDVVRNQIKEFASTRQ 103

Query: 51  GFDKGRKSHIVDE-DKLLDELEPILR 75
            F KG K  I+DE D +    +  LR
Sbjct: 104 IFSKGFKLIILDEADAMTSAAQNALR 129

>Smik_14.41 Chr14 (70565..71587) [1023 bp, 340 aa] {ON} YNL290W
           (REAL)
          Length = 340

 Score = 37.4 bits (85), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 31/89 (34%), Positives = 38/89 (42%), Gaps = 23/89 (25%)

Query: 7   LPNLLISGTPGTGKSSTCELLKRELEDYKYIN-------------------ISDFAKEFN 47
           LP+LL  G PGTGK+ST   L RE+    Y N                   I DFA    
Sbjct: 46  LPHLLFYGPPGTGKTSTIVALAREIYGKNYSNMVLELNASDDRGIDVVRNQIKDFASTRQ 105

Query: 48  CYDGFDKGRKSHIVDE-DKLLDELEPILR 75
               F KG K  I+DE D + +  +  LR
Sbjct: 106 I---FSKGFKLIILDEADAMTNAAQNALR 131

>KLLA0E13201g Chr5 (1168489..1169478) [990 bp, 329 aa] {ON} highly
           similar to uniprot|P38629 YNL290W Saccharomyces
           cerevisiae RFC3 Subunit of heteropentameric Replication
           factor C (RF-C)
          Length = 329

 Score = 37.4 bits (85), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 30/86 (34%), Positives = 40/86 (46%), Gaps = 17/86 (19%)

Query: 7   LPNLLISGTPGTGKSSTCELLKRELEDYKYIN---------------ISDFAKEF-NCYD 50
           LP+LL  G PGTGK+ST   L RE+    Y N               + +  KEF +   
Sbjct: 41  LPHLLFYGPPGTGKTSTIVALAREIYGSNYRNMVLELNASDDRGIDVVRNQIKEFASTRQ 100

Query: 51  GFDKGRKSHIVDE-DKLLDELEPILR 75
            F KG K  I+DE D + +  +  LR
Sbjct: 101 IFSKGFKLIILDEADAMTNAAQNALR 126

>KAFR0A08290 Chr1 complement(1662119..1663117) [999 bp, 332 aa]
          {ON} Anc_3.69 YNL290W
          Length = 332

 Score = 37.4 bits (85), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 22/49 (44%), Positives = 27/49 (55%), Gaps = 5/49 (10%)

Query: 7  LPNLLISGTPGTGKSSTCELLKRELEDYKYINISDFAKEFNCYDGFDKG 55
          LP+LL  G PGTGK+ST   L RE+    Y   S+   E N  D  D+G
Sbjct: 43 LPHLLFYGPPGTGKTSTIIALAREIYGKNY---SNMVLELNASD--DRG 86

>NDAI0A06060 Chr1 complement(1374529..1375545) [1017 bp, 338 aa]
           {ON} Anc_3.69
          Length = 338

 Score = 37.4 bits (85), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 31/89 (34%), Positives = 38/89 (42%), Gaps = 23/89 (25%)

Query: 7   LPNLLISGTPGTGKSSTCELLKRELEDYKYIN-------------------ISDFAKEFN 47
           LP+LL  G PGTGK+ST   L RE+    Y N                   I DFA    
Sbjct: 47  LPHLLFYGPPGTGKTSTIVALAREIFGKNYSNMVLELNASDDRGIEVVRNQIKDFASTRQ 106

Query: 48  CYDGFDKGRKSHIVDE-DKLLDELEPILR 75
               F KG K  I+DE D + +  +  LR
Sbjct: 107 I---FSKGFKLIILDEADAMTNAAQNALR 132

>SAKL0C12144g Chr3 complement(1088849..1089838) [990 bp, 329 aa]
           {ON} highly similar to uniprot|P38629 Saccharomyces
           cerevisiae YNL290W RFC3 Subunit of heteropentameric
           Replication factor C (RF-C) which is a DNA binding
           protein and ATPase that acts as a clamp loader of the
           proliferating cell nuclear antigen (PCNA) processivity
           factor for DNA polymerases delta and epsilon
          Length = 329

 Score = 37.0 bits (84), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 30/86 (34%), Positives = 40/86 (46%), Gaps = 17/86 (19%)

Query: 7   LPNLLISGTPGTGKSSTCELLKRELEDYKYIN---------------ISDFAKEF-NCYD 50
           LP+LL  G PGTGK+ST   L RE+    Y N               + +  KEF +   
Sbjct: 41  LPHLLFYGPPGTGKTSTIVALAREIYGKNYKNMVLELNASDDRGIDVVRNQIKEFASTRQ 100

Query: 51  GFDKGRKSHIVDE-DKLLDELEPILR 75
            F KG K  I+DE D + +  +  LR
Sbjct: 101 IFSKGFKLIILDEADAMTNAAQNALR 126

>KNAG0K02300 Chr11 complement(459360..460364) [1005 bp, 334 aa]
          {ON} Anc_3.69 YNL290W
          Length = 334

 Score = 36.6 bits (83), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 22/49 (44%), Positives = 26/49 (53%), Gaps = 5/49 (10%)

Query: 7  LPNLLISGTPGTGKSSTCELLKRELEDYKYINISDFAKEFNCYDGFDKG 55
          LP+LL  G PGTGK+ST   L RE+    Y   S    E N  D  D+G
Sbjct: 39 LPHLLFYGPPGTGKTSTIVALAREIYGKNY---SHMVLELNASD--DRG 82

>Smik_15.62 Chr15 complement(104681..105652) [972 bp, 323 aa] {ON}
          YOL094C (REAL)
          Length = 323

 Score = 36.6 bits (83), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 28/49 (57%), Gaps = 5/49 (10%)

Query: 7  LPNLLISGTPGTGKSSTCELLKRELEDYKYINISDFAKEFNCYDGFDKG 55
          +P+++ISG PG GK+++   L  EL  + Y   +D   E N  D  D+G
Sbjct: 42 MPHMIISGMPGIGKTTSVHCLAHELLGHSY---ADGVLELNASD--DRG 85

>ZYRO0C02090g Chr3 complement(165011..166027) [1017 bp, 338 aa] {ON}
           highly similar to uniprot|P38629 Saccharomyces
           cerevisiae YNL290W RFC3 Subunit of heteropentameric
           Replication factor C (RF-C) which is a DNA binding
           protein and ATPase that acts as a clamp loader of the
           proliferating cell nuclear antigen (PCNA) processivity
           factor for DNA polymerases delta and epsilon
          Length = 338

 Score = 36.2 bits (82), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 30/89 (33%), Positives = 38/89 (42%), Gaps = 23/89 (25%)

Query: 7   LPNLLISGTPGTGKSSTCELLKRELEDYKYIN-------------------ISDFAKEFN 47
           LP+LL  G PGTGK+S+   L RE+    Y N                   I DFA    
Sbjct: 45  LPHLLFYGPPGTGKTSSIIALAREIYGKNYSNMVLELNASDDRGIDVVRNQIKDFASTRQ 104

Query: 48  CYDGFDKGRKSHIVDE-DKLLDELEPILR 75
               F KG K  I+DE D + +  +  LR
Sbjct: 105 I---FSKGFKLIILDEADAMTNAAQNALR 130

>AEL196W Chr5 (264744..265745) [1002 bp, 333 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YNL290W (RFC3)
          Length = 333

 Score = 35.8 bits (81), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 27/49 (55%), Gaps = 5/49 (10%)

Query: 7  LPNLLISGTPGTGKSSTCELLKRELEDYKYINISDFAKEFNCYDGFDKG 55
          LP+LL  G PGTGK+ST   L +E+    Y N+     E N  D  D+G
Sbjct: 44 LPHLLFYGPPGTGKTSTICALAKEIYGKNYRNM---VLELNASD--DRG 87

>TPHA0P01200 Chr16 complement(242758..243765) [1008 bp, 335 aa] {ON}
           Anc_3.69 YNL290W
          Length = 335

 Score = 35.4 bits (80), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 30/89 (33%), Positives = 38/89 (42%), Gaps = 23/89 (25%)

Query: 7   LPNLLISGTPGTGKSSTCELLKRELEDYKYIN-------------------ISDFAKEFN 47
           LP+LL  G PGTGK+ST   L +E+    Y N                   I DFA    
Sbjct: 44  LPHLLFYGPPGTGKTSTIIALAKEIYGKNYSNMVLELNASDDRGIDVVRNQIKDFASTRQ 103

Query: 48  CYDGFDKGRKSHIVDE-DKLLDELEPILR 75
               F KG K  I+DE D + +  +  LR
Sbjct: 104 I---FSKGFKLIILDEADAMTNAAQNALR 129

>YOL094C Chr15 complement(141584..142555) [972 bp, 323 aa] {ON}
          RFC4Subunit of heteropentameric Replication factor C
          (RF-C), which is a DNA binding protein and ATPase that
          acts as a clamp loader of the proliferating cell
          nuclear antigen (PCNA) processivity factor for DNA
          polymerases delta and epsilon
          Length = 323

 Score = 35.0 bits (79), Expect = 0.091,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 27/49 (55%), Gaps = 5/49 (10%)

Query: 7  LPNLLISGTPGTGKSSTCELLKRELEDYKYINISDFAKEFNCYDGFDKG 55
          +P+++ISG PG GK+++   L  EL    Y   +D   E N  D  D+G
Sbjct: 42 MPHMIISGMPGIGKTTSVHCLAHELLGRSY---ADGVLELNASD--DRG 85

>KLTH0A01540g Chr1 (137284..138270) [987 bp, 328 aa] {ON} highly
           similar to uniprot|P38629 Saccharomyces cerevisiae
           YNL290W RFC3 Subunit of heteropentameric Replication
           factor C (RF-C) which is a DNA binding protein and
           ATPase that acts as a clamp loader of the proliferating
           cell nuclear antigen (PCNA) processivity factor for DNA
           polymerases delta and epsilon
          Length = 328

 Score = 34.7 bits (78), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 29/86 (33%), Positives = 39/86 (45%), Gaps = 17/86 (19%)

Query: 7   LPNLLISGTPGTGKSSTCELLKRELEDYKYIN---------------ISDFAKEF-NCYD 50
           LP+LL  G PGTGK+S    L RE+    Y N               + +  KEF +   
Sbjct: 41  LPHLLFYGPPGTGKTSMIVALSREIYGTNYRNMVLELNASDDRGIDVVRNQIKEFASTRQ 100

Query: 51  GFDKGRKSHIVDE-DKLLDELEPILR 75
            F KG K  I+DE D + +  +  LR
Sbjct: 101 IFSKGFKLIILDEADAMTNAAQNALR 126

>ZYRO0G02002g Chr7 (154079..155137) [1059 bp, 352 aa] {ON} highly
          similar to uniprot|P40348 Saccharomyces cerevisiae
          YJR068W RFC2 Subunit of heteropentameric Replication
          factor C (RF-C) which is a DNA binding protein and
          ATPase that acts as a clamp loader of the proliferating
          cell nuclear antigen (PCNA) processivity factor for DNA
          polymerases delta and epsilon
          Length = 352

 Score = 34.7 bits (78), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 15/25 (60%), Positives = 18/25 (72%)

Query: 7  LPNLLISGTPGTGKSSTCELLKREL 31
          LP++L  G PGTGK+ST   L REL
Sbjct: 56 LPHMLFYGPPGTGKTSTIFALTREL 80

>Skud_15.59 Chr15 complement(100958..101929) [972 bp, 323 aa] {ON}
          YOL094C (REAL)
          Length = 323

 Score = 34.7 bits (78), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 27/49 (55%), Gaps = 5/49 (10%)

Query: 7  LPNLLISGTPGTGKSSTCELLKRELEDYKYINISDFAKEFNCYDGFDKG 55
          +P+++ISG PG GK+++   L  EL    Y   +D   E N  D  D+G
Sbjct: 42 MPHMIISGMPGIGKTTSVHCLAHELLGNSY---ADGVLELNASD--DRG 85

>Kpol_1066.38 s1066 complement(64176..65186) [1011 bp, 336 aa]
          {ON} complement(64176..65186) [1011 nt, 337 aa]
          Length = 336

 Score = 34.7 bits (78), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 21/33 (63%)

Query: 7  LPNLLISGTPGTGKSSTCELLKRELEDYKYINI 39
          LP+LL  G PGTGK+ST   L +E+    Y N+
Sbjct: 45 LPHLLFYGPPGTGKTSTIIALAKEIYGKNYHNM 77

>CAGL0M03575g Chr13 complement(403738..404733) [996 bp, 331 aa] {ON}
           highly similar to uniprot|P38629 Saccharomyces
           cerevisiae YNL290w RFC3
          Length = 331

 Score = 34.7 bits (78), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 29/89 (32%), Positives = 38/89 (42%), Gaps = 23/89 (25%)

Query: 7   LPNLLISGTPGTGKSSTCELLKRELEDYKYIN-------------------ISDFAKEFN 47
           LP+LL  G PGTGK+ST   L +++    Y N                   I DFA    
Sbjct: 42  LPHLLFYGPPGTGKTSTIVALAKDIYGKNYSNMVLELNASDDRGIDVVRNQIKDFASTRQ 101

Query: 48  CYDGFDKGRKSHIVDE-DKLLDELEPILR 75
               F KG K  I+DE D + +  +  LR
Sbjct: 102 I---FSKGFKLIILDEADAMTNAAQNALR 127

>Suva_15.71 Chr15 complement(114865..115836) [972 bp, 323 aa] {ON}
          YOL094C (REAL)
          Length = 323

 Score = 34.7 bits (78), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 26/49 (53%), Gaps = 5/49 (10%)

Query: 7  LPNLLISGTPGTGKSSTCELLKRELEDYKYINISDFAKEFNCYDGFDKG 55
          +P+++ISG PG GK+++   L  EL    Y    D   E N  D  D+G
Sbjct: 42 MPHMIISGMPGIGKTTSVHCLAHELLGSSY---GDGVLELNASD--DRG 85

>Kwal_23.5247 s23 complement(1073605..1074594) [990 bp, 329 aa]
          {ON} YNL290W (RFC3) - Subunit 3 of Replication Factor
          C; homologous to human RFC 36 kDa subunit [contig 8]
          FULL
          Length = 329

 Score = 34.7 bits (78), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 20/33 (60%)

Query: 7  LPNLLISGTPGTGKSSTCELLKRELEDYKYINI 39
          LP+LL  G PGTGK+S    L RE+    Y N+
Sbjct: 41 LPHLLFYGPPGTGKTSMIVALAREIYGSNYRNM 73

>KNAG0G01880 Chr7 (420542..421219) [678 bp, 225 aa] {ON} Anc_8.236
           YER170W
          Length = 225

 Score = 34.3 bits (77), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 35/130 (26%), Positives = 55/130 (42%), Gaps = 25/130 (19%)

Query: 10  LLISGTPGTGKSSTCELLKRELEDYKYINISDFAKEFNCYDGFDKGRKSHIVDE------ 63
           LL+ G PG GK +  + L +   + K I+  D  ++ N  +G   G+ +    E      
Sbjct: 10  LLLLGAPGAGKGTQTKRLIKRFPEIKAISSGDLLRK-NIQEGTPLGQTASKYIERGELVP 68

Query: 64  DKLLDELEPILREGHNIVDWHVNDVFPERL----------------IDLVVILRADNSVL 107
           DKL+ +L  I  +   I    + D FP  +                ++LVV L    SVL
Sbjct: 69  DKLITDL--ITTKVATIKGPWILDGFPRNISQAESLSSCLTPLGKDLNLVVELGVPESVL 126

Query: 108 YDRLQNRKYH 117
            +R+Q R  H
Sbjct: 127 LNRIQERYVH 136

>KLTH0C09900g Chr3 complement(818369..819337) [969 bp, 322 aa]
          {ON} highly similar to uniprot|P40339 Saccharomyces
          cerevisiae YOL094C RFC4 Subunit of heteropentameric
          Replication factor C (RF-C) which is a DNA binding
          protein and ATPase that acts as a clamp loader of the
          proliferating cell nuclear antigen (PCNA) processivity
          factor for DNA polymerases delta and epsilon
          Length = 322

 Score = 33.9 bits (76), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 26/49 (53%), Gaps = 5/49 (10%)

Query: 7  LPNLLISGTPGTGKSSTCELLKRELEDYKYINISDFAKEFNCYDGFDKG 55
          +P+L+ISG PG GK+++   L  EL    Y   S    E N  D  D+G
Sbjct: 43 MPHLIISGLPGIGKTTSVSCLAHELLGNAY---SQAVLELNASD--DRG 86

>CAGL0F00451g Chr6 complement(43750..44808) [1059 bp, 352 aa] {ON}
          highly similar to uniprot|P40348 Saccharomyces
          cerevisiae YJR068w RFC2
          Length = 352

 Score = 33.9 bits (76), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 18/25 (72%)

Query: 7  LPNLLISGTPGTGKSSTCELLKREL 31
          LP++L  G PGTGK+ST   L +EL
Sbjct: 58 LPHMLFYGPPGTGKTSTILALTKEL 82

>Kwal_56.22633 s56 (212413..213381) [969 bp, 322 aa] {ON} YOL094C
          (RFC4) - Subunit 4 of Replication Factor C; homologous
          to human RFC 40 kDa subunit [contig 184] FULL
          Length = 322

 Score = 33.5 bits (75), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 26/49 (53%), Gaps = 5/49 (10%)

Query: 7  LPNLLISGTPGTGKSSTCELLKRELEDYKYINISDFAKEFNCYDGFDKG 55
          +P+L+ISG PG GK+++   L  EL    Y   S    E N  D  D+G
Sbjct: 43 MPHLIISGLPGIGKTTSISCLAHELLGNAY---SQAVLELNASD--DRG 86

>NCAS0A12300 Chr1 (2438482..2439534) [1053 bp, 350 aa] {ON}
          Anc_1.517
          Length = 350

 Score = 33.5 bits (75), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 18/25 (72%)

Query: 7  LPNLLISGTPGTGKSSTCELLKREL 31
          LP++L  G PGTGK+ST   L +EL
Sbjct: 56 LPHMLFYGPPGTGKTSTILALAKEL 80

>KAFR0E00300 Chr5 complement(62003..63055) [1053 bp, 350 aa] {ON}
          Anc_1.517 YJR068W
          Length = 350

 Score = 33.5 bits (75), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 18/25 (72%)

Query: 7  LPNLLISGTPGTGKSSTCELLKREL 31
          LP++L  G PGTGK+ST   L +EL
Sbjct: 56 LPHMLFYGPPGTGKTSTILALTKEL 80

>NDAI0A03940 Chr1 complement(885415..886479) [1065 bp, 354 aa]
          {ON} Anc_1.517 YJR068W
          Length = 354

 Score = 33.5 bits (75), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 18/25 (72%)

Query: 7  LPNLLISGTPGTGKSSTCELLKREL 31
          LP++L  G PGTGK+ST   L +EL
Sbjct: 60 LPHMLFYGPPGTGKTSTILALAKEL 84

>TDEL0D05210 Chr4 (945843..946811) [969 bp, 322 aa] {ON} Anc_3.103
          YOL094C
          Length = 322

 Score = 33.5 bits (75), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 26/49 (53%), Gaps = 5/49 (10%)

Query: 7  LPNLLISGTPGTGKSSTCELLKRELEDYKYINISDFAKEFNCYDGFDKG 55
          +P+++ISG PG GK+++   L  EL    Y   S    E N  D  D+G
Sbjct: 44 MPHMIISGLPGIGKTTSVHCLAHELLGKSY---SQAVLELNASD--DRG 87

>KAFR0C01380 Chr3 (284264..285229) [966 bp, 321 aa] {ON} Anc_3.103
          YOL094C
          Length = 321

 Score = 33.5 bits (75), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 26/49 (53%), Gaps = 5/49 (10%)

Query: 7  LPNLLISGTPGTGKSSTCELLKRELEDYKYINISDFAKEFNCYDGFDKG 55
          +P+++ISG PG GK+++   L  EL    Y   S    E N  D  D+G
Sbjct: 43 MPHMIISGLPGIGKTTSVHCLAHELLGSHY---SQAVLELNASD--DRG 86

>KLLA0B13992g Chr2 (1230397..1231455) [1059 bp, 352 aa] {ON}
          similar to uniprot|P40348 Saccharomyces cerevisiae
          YJR068W RFC2 Subunit of heteropentameric Replication
          factor C (RF-C) which is a DNA binding protein and
          ATPase that acts as a clamp loader of the proliferating
          cell nuclear antigen (PCNA) processivity factor for DNA
          polymerases delta and epsilon
          Length = 352

 Score = 33.5 bits (75), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 18/25 (72%)

Query: 7  LPNLLISGTPGTGKSSTCELLKREL 31
          LP++L  G PGTGK+ST   L +EL
Sbjct: 55 LPHMLFYGPPGTGKTSTILALTKEL 79

>KLTH0C02442g Chr3 complement(215254..216324) [1071 bp, 356 aa]
          {ON} highly similar to uniprot|P40348 Saccharomyces
          cerevisiae YJR068W RFC2 Subunit of heteropentameric
          Replication factor C (RF-C) which is a DNA binding
          protein and ATPase that acts as a clamp loader of the
          proliferating cell nuclear antigen (PCNA) processivity
          factor for DNA polymerases delta and epsilon
          Length = 356

 Score = 33.5 bits (75), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 18/25 (72%)

Query: 7  LPNLLISGTPGTGKSSTCELLKREL 31
          LP++L  G PGTGK+ST   L +EL
Sbjct: 57 LPHMLFYGPPGTGKTSTILALTKEL 81

>TBLA0B01950 Chr2 complement(449277..450329) [1053 bp, 350 aa]
          {ON} Anc_1.517 YJR068W
          Length = 350

 Score = 33.5 bits (75), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 15/32 (46%), Positives = 20/32 (62%)

Query: 7  LPNLLISGTPGTGKSSTCELLKRELEDYKYIN 38
          LP++L  G PGTGK+ST   + +EL     IN
Sbjct: 52 LPHMLFYGPPGTGKTSTILAMTKELYGPNLIN 83

>TPHA0O00240 Chr15 complement(32729..33787) [1059 bp, 352 aa] {ON}
          Anc_1.517 YJR068W
          Length = 352

 Score = 33.5 bits (75), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 18/25 (72%)

Query: 7  LPNLLISGTPGTGKSSTCELLKREL 31
          LP++L  G PGTGK+ST   L +EL
Sbjct: 57 LPHMLFYGPPGTGKTSTILALTKEL 81

>Kpol_1018.177 s1018 (449193..450245) [1053 bp, 350 aa] {ON}
          (449193..450245) [1053 nt, 351 aa]
          Length = 350

 Score = 33.5 bits (75), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 18/25 (72%)

Query: 7  LPNLLISGTPGTGKSSTCELLKREL 31
          LP++L  G PGTGK+ST   L +EL
Sbjct: 55 LPHMLFYGPPGTGKTSTILALTKEL 79

>YJR068W Chr10 (567643..568704) [1062 bp, 353 aa] {ON}
          RFC2Subunit of heteropentameric Replication factor C
          (RF-C), which is a DNA binding protein and ATPase that
          acts as a clamp loader of the proliferating cell
          nuclear antigen (PCNA) processivity factor for DNA
          polymerases delta and epsilon
          Length = 353

 Score = 33.5 bits (75), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 18/25 (72%)

Query: 7  LPNLLISGTPGTGKSSTCELLKREL 31
          LP++L  G PGTGK+ST   L +EL
Sbjct: 58 LPHMLFYGPPGTGKTSTILALTKEL 82

>KNAG0G00260 Chr7 complement(34240..35292) [1053 bp, 350 aa] {ON}
          Anc_1.517 YJR068W
          Length = 350

 Score = 33.5 bits (75), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 18/25 (72%)

Query: 7  LPNLLISGTPGTGKSSTCELLKREL 31
          LP++L  G PGTGK+ST   L +EL
Sbjct: 56 LPHMLFYGPPGTGKTSTILALTKEL 80

>Kwal_27.9942 s27 complement(130159..131229) [1071 bp, 356 aa]
          {ON} YJR068W (RFC2) - Subunit 2 of Replication Factor
          C; homologous to human RFC 37 kDa subunit [contig 43]
          FULL
          Length = 356

 Score = 33.1 bits (74), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 18/25 (72%)

Query: 7  LPNLLISGTPGTGKSSTCELLKREL 31
          LP++L  G PGTGK+ST   L +EL
Sbjct: 57 LPHMLFYGPPGTGKTSTILALTKEL 81

>AFR422W Chr6 (1196892..1197938) [1047 bp, 348 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YJR068W (RFC2)
          Length = 348

 Score = 33.1 bits (74), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 18/25 (72%)

Query: 7  LPNLLISGTPGTGKSSTCELLKREL 31
          LP++L  G PGTGK+ST   L +EL
Sbjct: 54 LPHMLFYGPPGTGKTSTILALTKEL 78

>Suva_12.158 Chr12 (245824..246885) [1062 bp, 353 aa] {ON} YJR068W
          (REAL)
          Length = 353

 Score = 33.1 bits (74), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 18/25 (72%)

Query: 7  LPNLLISGTPGTGKSSTCELLKREL 31
          LP++L  G PGTGK+ST   L +EL
Sbjct: 58 LPHMLFYGPPGTGKTSTILALTKEL 82

>Smik_10.358 Chr10 (556494..557555) [1062 bp, 353 aa] {ON} YJR068W
          (REAL)
          Length = 353

 Score = 33.1 bits (74), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 18/25 (72%)

Query: 7  LPNLLISGTPGTGKSSTCELLKREL 31
          LP++L  G PGTGK+ST   L +EL
Sbjct: 58 LPHMLFYGPPGTGKTSTILALTKEL 82

>TDEL0F00440 Chr6 complement(70924..71988) [1065 bp, 354 aa] {ON}
          Anc_1.517 YJR068W
          Length = 354

 Score = 33.1 bits (74), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 18/25 (72%)

Query: 7  LPNLLISGTPGTGKSSTCELLKREL 31
          LP++L  G PGTGK+ST   L +EL
Sbjct: 56 LPHMLFYGPPGTGKTSTILALTKEL 80

>Kwal_27.12113 s27 complement(1090541..1092061) [1521 bp, 506 aa]
           {ON} YBR186W (PCH2) - Putative ATPase [contig 23] FULL
          Length = 506

 Score = 33.5 bits (75), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 29/110 (26%), Positives = 49/110 (44%), Gaps = 15/110 (13%)

Query: 10  LLISGTPGTGKSSTCELLKREL------EDYKYINISDFAK---EFNCYDGFDKGRKSHI 60
           LL+ G PGTGK++ C+ L ++L         K  + +D+     E +C   F +      
Sbjct: 288 LLVHGPPGTGKTTICKALCQKLAIRHDKRSSKLFHAADYEAIMIELSCSRIFSRWFGESA 347

Query: 61  VDEDKLLDELEPILREGHNIVDWHVNDVFPERLIDLVVILRADNSVLYDR 110
            + +K+  ++E IL    N       D F   L+D V  L +  S L ++
Sbjct: 348 KNLEKIFQDVELILTSASN------KDKFVCLLMDEVETLASCRSSLMNK 391

>Skud_10.292 Chr10 (525090..526151) [1062 bp, 353 aa] {ON} YJR068W
          (REAL)
          Length = 353

 Score = 33.1 bits (74), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 18/25 (72%)

Query: 7  LPNLLISGTPGTGKSSTCELLKREL 31
          LP++L  G PGTGK+ST   L +EL
Sbjct: 58 LPHMLFYGPPGTGKTSTILALTKEL 82

>SAKL0D12870g Chr4 (1076258..1077310) [1053 bp, 350 aa] {ON}
          highly similar to uniprot|P40348 Saccharomyces
          cerevisiae YJR068W RFC2 Subunit of heteropentameric
          Replication factor C (RF-C) which is a DNA binding
          protein and ATPase that acts as a clamp loader of the
          proliferating cell nuclear antigen (PCNA) processivity
          factor for DNA polymerases delta and epsilon
          Length = 350

 Score = 33.1 bits (74), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 18/25 (72%)

Query: 7  LPNLLISGTPGTGKSSTCELLKREL 31
          LP++L  G PGTGK+ST   L +EL
Sbjct: 56 LPHMLFYGPPGTGKTSTILALTKEL 80

>Ecym_3150 Chr3 complement(278432..279484) [1053 bp, 350 aa] {ON}
          similar to Ashbya gossypii AFR422W
          Length = 350

 Score = 33.1 bits (74), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 18/25 (72%)

Query: 7  LPNLLISGTPGTGKSSTCELLKREL 31
          LP++L  G PGTGK+ST   L +EL
Sbjct: 56 LPHMLFYGPPGTGKTSTILALTKEL 80

>Kpol_1053.34 s1053 complement(54419..55063,55065..55385) [966 bp,
          321 aa] {ON} complement(54419..55063,55065..55385) [966
          nt, 322 aa]
          Length = 321

 Score = 32.7 bits (73), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 26/49 (53%), Gaps = 5/49 (10%)

Query: 7  LPNLLISGTPGTGKSSTCELLKRELEDYKYINISDFAKEFNCYDGFDKG 55
          +P+++ISG PG GK+++   L  EL    Y   S    E N  D  D+G
Sbjct: 43 MPHMIISGMPGIGKTTSIHCLAHELLGDSY---SQAVLELNASD--DRG 86

>TPHA0A00710 Chr1 complement(129039..130016) [978 bp, 325 aa] {ON}
          Anc_3.103 YOL094C
          Length = 325

 Score = 32.3 bits (72), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 26/49 (53%), Gaps = 5/49 (10%)

Query: 7  LPNLLISGTPGTGKSSTCELLKRELEDYKYINISDFAKEFNCYDGFDKG 55
          +P+++ISG PG GK+++   L  EL    Y   S    E N  D  D+G
Sbjct: 43 MPHMIISGLPGIGKTTSIHCLAHELLGDSY---SQAVLELNASD--DRG 86

>KLLA0C03718g Chr3 complement(339645..340607) [963 bp, 320 aa]
          {ON} highly similar to uniprot|P40339 Saccharomyces
          cerevisiae YOL094C RFC4 Subunit of heteropentameric
          Replication factor C (RF-C) which is a DNA binding
          protein and ATPase that acts as a clamp loader of the
          proliferating cell nuclear antigen (PCNA) processivity
          factor for DNA polymerases delta and epsilon
          Length = 320

 Score = 32.3 bits (72), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 26/49 (53%), Gaps = 5/49 (10%)

Query: 7  LPNLLISGTPGTGKSSTCELLKRELEDYKYINISDFAKEFNCYDGFDKG 55
          +P+++ISG PG GK+++   L  EL    Y   S    E N  D  D+G
Sbjct: 42 MPHMIISGLPGIGKTTSIHCLAHELLGDAY---SQAVLELNASD--DRG 85

>CAGL0I07645g Chr9 complement(736131..737099) [969 bp, 322 aa]
          {ON} highly similar to uniprot|P40339 Saccharomyces
          cerevisiae YOL094c RFC4 DNA replication factor C
          Length = 322

 Score = 32.3 bits (72), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 26/49 (53%), Gaps = 5/49 (10%)

Query: 7  LPNLLISGTPGTGKSSTCELLKRELEDYKYINISDFAKEFNCYDGFDKG 55
          +P+++ISG PG GK+++   L  E+    Y   S    E N  D  D+G
Sbjct: 43 MPHMIISGLPGIGKTTSIHCLAHEMLGESY---SQAVLELNASD--DRG 86

>ZYRO0B06248g Chr2 (502255..503220) [966 bp, 321 aa] {ON} highly
          similar to uniprot|P40339 Saccharomyces cerevisiae
          YOL094C RFC4 Subunit of heteropentameric Replication
          factor C (RF-C) which is a DNA binding protein and
          ATPase that acts as a clamp loader of the proliferating
          cell nuclear antigen (PCNA) processivity factor for DNA
          polymerases delta and epsilon
          Length = 321

 Score = 32.3 bits (72), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 26/49 (53%), Gaps = 5/49 (10%)

Query: 7  LPNLLISGTPGTGKSSTCELLKRELEDYKYINISDFAKEFNCYDGFDKG 55
          +P+L+ISG PG GK+++   L  EL    Y   S    E N  D  D+G
Sbjct: 43 MPHLIISGLPGIGKTTSIHCLAHELLGDSY---SQGVLELNASD--DRG 86

>KLTH0E12936g Chr5 complement(1145066..1146700) [1635 bp, 544 aa]
           {ON} similar to uniprot|P38126 Saccharomyces cerevisiae
           YBR186W PCH2 Nucleolar component of the pachytene
           checkpoint which prevents chromosome segregation when
           recombination and chromosome synapsis are defective also
           represses meiotic interhomolog recombination in the rDNA
          Length = 544

 Score = 32.3 bits (72), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 21/79 (26%), Positives = 35/79 (44%), Gaps = 9/79 (11%)

Query: 10  LLISGTPGTGKSSTCELLKRELED---------YKYINISDFAKEFNCYDGFDKGRKSHI 60
           LLI G PGTGK++ C  L ++L           +K ++      E +C   F +      
Sbjct: 297 LLIHGPPGTGKTTVCRALCQKLAIRCNNDPENLFKEVDYQAVVVELSCSRIFSRWFGESA 356

Query: 61  VDEDKLLDELEPILREGHN 79
            + +K+  +LE +L    N
Sbjct: 357 KNLEKIFQDLERLLMSSLN 375

>SAKL0C09812g Chr3 complement(887754..888713) [960 bp, 319 aa]
          {ON} highly similar to uniprot|P40339 Saccharomyces
          cerevisiae YOL094C RFC4 Subunit of heteropentameric
          Replication factor C (RF-C) which is a DNA binding
          protein and ATPase that acts as a clamp loader of the
          proliferating cell nuclear antigen (PCNA) processivity
          factor for DNA polymerases delta and epsilon
          Length = 319

 Score = 32.0 bits (71), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 26/49 (53%), Gaps = 5/49 (10%)

Query: 7  LPNLLISGTPGTGKSSTCELLKRELEDYKYINISDFAKEFNCYDGFDKG 55
          +P+++ISG PG GK+++   L  EL    Y   S    E N  D  D+G
Sbjct: 42 MPHMIISGLPGIGKTTSIHCLAHELLGDSY---SHAVLELNASD--DRG 85

>CAGL0K04983g Chr11 complement(483181..484860) [1680 bp, 559 aa]
           {ON} highly similar to uniprot|P40151 Saccharomyces
           cerevisiae YNL218w
          Length = 559

 Score = 32.0 bits (71), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 21/89 (23%), Positives = 45/89 (50%), Gaps = 8/89 (8%)

Query: 7   LPNLLISGTPGTGKSSTCELLKR--ELEDYKYINISDFAKEFNCYDG---FDKGRKSHIV 61
           +P++++ G PG GK++   LL +   L   +Y  +   A + N  +    F+KGRK + +
Sbjct: 153 VPSMILWGPPGVGKTTLARLLTKTASLHGSRYTMVETSATKANAQELRSIFEKGRKEYQL 212

Query: 62  DEDK---LLDELEPILREGHNIVDWHVND 87
            + +    +DE+    +   +++  HV +
Sbjct: 213 TKRRVVLFIDEIHRFNKAQQDLLLPHVEN 241

>KNAG0K00740 Chr11 complement(134107..135066) [960 bp, 319 aa]
          {ON} Anc_3.103 YOL094C
          Length = 319

 Score = 31.6 bits (70), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 28/49 (57%), Gaps = 4/49 (8%)

Query: 7  LPNLLISGTPGTGKSSTCELLKRELEDYKYINISDFAKEFNCYDGFDKG 55
          +P+++ISG PG GK+++ + L  E+   K +  +    E N  D  D+G
Sbjct: 40 MPHMIISGLPGIGKTTSIQCLANEMLGEKLLGSAVL--ELNASD--DRG 84

>NDAI0G05150 Chr7 (1249652..1250617) [966 bp, 321 aa] {ON}
          Anc_3.103
          Length = 321

 Score = 31.6 bits (70), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 26/49 (53%), Gaps = 5/49 (10%)

Query: 7  LPNLLISGTPGTGKSSTCELLKRELEDYKYINISDFAKEFNCYDGFDKG 55
          +P+++ISG PG GK+++   L  EL    Y   S    E N  D  D+G
Sbjct: 43 MPHMIISGLPGIGKTTSIHCLAHELLGDAY---SRAVLELNASD--DRG 86

>TBLA0E03520 Chr5 (873305..874279) [975 bp, 324 aa] {ON} Anc_3.103
          YOL094C
          Length = 324

 Score = 31.6 bits (70), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 11/25 (44%), Positives = 18/25 (72%)

Query: 7  LPNLLISGTPGTGKSSTCELLKREL 31
          +P+++ISG PG GK+++   L  EL
Sbjct: 45 MPHMIISGMPGIGKTTSIHCLAHEL 69

>ADR111W Chr4 (902185..903150) [966 bp, 321 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YOL094C (RFC4)
          Length = 321

 Score = 31.6 bits (70), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 26/49 (53%), Gaps = 5/49 (10%)

Query: 7  LPNLLISGTPGTGKSSTCELLKRELEDYKYINISDFAKEFNCYDGFDKG 55
          +P+++ISG PG GK+++   L  EL    Y   S    E N  D  D+G
Sbjct: 43 MPHMIISGLPGIGKTTSIHCLAHELLGDAY---SQAVLELNASD--DRG 86

>Ecym_7051 Chr7 complement(103898..104056,104172..105644) [1632 bp,
           543 aa] {ON} similar to Ashbya gossypii AEL258W
          Length = 543

 Score = 31.6 bits (70), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 21/76 (27%), Positives = 36/76 (47%), Gaps = 8/76 (10%)

Query: 10  LLISGTPGTGKSSTCELLKRELEDYKYINISDFAK--------EFNCYDGFDKGRKSHIV 61
           LLI G PGTGK++ C+ L ++L   +   +S   K        E +C   F +       
Sbjct: 287 LLIHGPPGTGKTTICKALCQKLAIRQNSGLSLEGKCVPPVILIELSCSKVFSRWFGESSK 346

Query: 62  DEDKLLDELEPILREG 77
           + D L  +L+ +L++ 
Sbjct: 347 NVDTLFKDLQELLKQN 362

>Ecym_6466 Chr6 complement(901576..903330) [1755 bp, 584 aa] {ON}
           similar to Ashbya gossypii ABL183W
          Length = 584

 Score = 31.6 bits (70), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 24/34 (70%), Gaps = 1/34 (2%)

Query: 3   SRRYLPNLLISGTPGTGKSSTCELLKREL-EDYK 35
           S+  LP++++ G PG GK+S  +LL + + ED+K
Sbjct: 145 SQGSLPSMILWGPPGVGKTSLAKLLTKTINEDFK 178

>NCAS0C02020 Chr3 (375594..377126,377196..377351) [1689 bp, 562 aa]
           {ON} Anc_8.558 YBR186W
          Length = 562

 Score = 31.6 bits (70), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 37/77 (48%), Gaps = 13/77 (16%)

Query: 10  LLISGTPGTGKSSTCELL--KRELEDYKYINISD-------FAKEFNCYDGFDK--GRKS 58
           LL+ G PGTGK+S C  L  K  + +  + NI +          E  C + F +  G  S
Sbjct: 304 LLVYGPPGTGKTSICRALCQKLSIRNDLHTNIGEGELECKCILIELTCSNVFSRWFGESS 363

Query: 59  HIVDEDKLLDELEPILR 75
             V E  L +E+E +L+
Sbjct: 364 KNVSE--LFNEIEQLLK 378

>Ecym_2792 Chr2 complement(1538111..1539070) [960 bp, 319 aa] {ON}
          similar to Ashbya gossypii ADR111W
          Length = 319

 Score = 31.2 bits (69), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 26/49 (53%), Gaps = 5/49 (10%)

Query: 7  LPNLLISGTPGTGKSSTCELLKRELEDYKYINISDFAKEFNCYDGFDKG 55
          +P+++ISG PG GK+++   +  EL    Y   S    E N  D  D+G
Sbjct: 42 MPHMIISGLPGIGKTTSIHCIAHELLGDSY---SQAVLELNASD--DRG 85

>TDEL0B02870 Chr2 (512594..514168,514238..514384) [1722 bp, 573 aa]
           {ON} Anc_8.558 YBR186W
          Length = 573

 Score = 31.2 bits (69), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 26/46 (56%), Gaps = 5/46 (10%)

Query: 10  LLISGTPGTGKSSTCELLKRELEDYKYINISDFAKEFNCYDGFDKG 55
           LL+ G PGTGK++ C+ L  +L   +     +F++E +  D   KG
Sbjct: 318 LLVHGPPGTGKTTICKALCHKLSIRR-----EFSQEVSPIDTTHKG 358

>KNAG0F00930 Chr6 (170493..172262) [1770 bp, 589 aa] {ON} Anc_2.26
           YNL218W
          Length = 589

 Score = 31.2 bits (69), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 25/41 (60%), Gaps = 1/41 (2%)

Query: 7   LPNLLISGTPGTGKSSTCELLKRELEDYKYINISDFAKEFN 47
           +P++++ G PG GK+S   LL + + D KY+ I   A + N
Sbjct: 179 IPSMILWGPPGVGKTSLARLLTKSV-DGKYLMIETSATKSN 218

>YML065W Chr13 (142210..144954) [2745 bp, 914 aa] {ON}  ORC1Largest
           subunit of the origin recognition complex, which directs
           DNA replication by binding to replication origins and is
           also involved in transcriptional silencing; exhibits
           ATPase activity
          Length = 914

 Score = 31.2 bits (69), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 29/52 (55%), Gaps = 11/52 (21%)

Query: 10  LLISGTPGTGKSSTC-----ELL----KRELEDYKYINISDF--AKEFNCYD 50
           + ++GTPG GK+ T      ELL    +RE+ D+ Y+ I+     K  +CY+
Sbjct: 475 IYVAGTPGVGKTLTVREVVKELLSSSAQREIPDFLYVEINGLKMVKPTDCYE 526

>NDAI0E02730 Chr5 (573056..574554,574636..574771) [1635 bp, 544 aa]
           {ON} Anc_8.558 YBR186W
          Length = 544

 Score = 30.4 bits (67), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 12/22 (54%), Positives = 16/22 (72%)

Query: 10  LLISGTPGTGKSSTCELLKREL 31
           LLI G PGTGK++ C  L ++L
Sbjct: 295 LLIHGPPGTGKTTLCRALCQKL 316

>Zrou_YGOB_A13310g Chr1
           complement(1049931..1050068,1050140..1051678) [1677 bp,
           558 aa] {ON} ANNOTATED BY YGOB -
          Length = 558

 Score = 30.4 bits (67), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 11/22 (50%), Positives = 17/22 (77%)

Query: 10  LLISGTPGTGKSSTCELLKREL 31
           LL+ G PGTGK++ C+ L ++L
Sbjct: 307 LLVQGPPGTGKTTICKALCQKL 328

>CAGL0L09867g Chr12 (1056341..1057123) [783 bp, 260 aa] {ON} some
           similarities with uniprot|P15700 Saccharomyces
           cerevisiae YKL024c URA6 uridine-monophosphate kinase
          Length = 260

 Score = 30.0 bits (66), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 29/141 (20%), Positives = 59/141 (41%), Gaps = 27/141 (19%)

Query: 10  LLISGTPGTGKSSTCELLKRELEDYKYINIS--DFAKEFNCYDGFDKG-------RKSHI 60
           + + G PG GK + C  L   + DYK++++S  D  +     +G + G       ++  I
Sbjct: 73  IFVLGGPGAGKGTQCAKL---VNDYKFVHLSAGDLLRAEQNREGSEFGELIKHYIKEGLI 129

Query: 61  VDEDKLLDELEPILREGH--NIVDWHVNDVFPERL------------IDLVVILRADNSV 106
           V ++  L  L+  ++E +  N   + V D FP ++                +       V
Sbjct: 130 VPQEITLSLLQKAIKENYEKNYTKFLV-DGFPRKMDQALSFEKQIVPSKFTLFFECPEQV 188

Query: 107 LYDRLQNRKYHDAKVQENLDA 127
           + +RL  R     +  +N+++
Sbjct: 189 MLERLLERGKTSGRADDNIES 209

>ZYRO0A13310g Chr1 complement(1050131..1051678) [1548 bp, 515 aa]
           {OFF} similar to uniprot|P38126 Saccharomyces cerevisiae
           YBR186W PCH2 Nucleolar component of the pachytene
           checkpoint which prevents chromosome segregation when
           recombination and chromosome synapsis are defective also
           represses meiotic interhomolog recombination in the rDNA
          Length = 515

 Score = 30.4 bits (67), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 11/22 (50%), Positives = 17/22 (77%)

Query: 10  LLISGTPGTGKSSTCELLKREL 31
           LL+ G PGTGK++ C+ L ++L
Sbjct: 307 LLVQGPPGTGKTTICKALCQKL 328

>TDEL0B01580 Chr2 (279511..280056) [546 bp, 181 aa] {ON} Anc_8.478
          YDR248C
          Length = 181

 Score = 29.6 bits (65), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 13/18 (72%), Positives = 15/18 (83%)

Query: 10 LLISGTPGTGKSSTCELL 27
          L+I+GT GTGKSS  ELL
Sbjct: 6  LVIAGTAGTGKSSVAELL 23

>Smik_2.326 Chr2 (586919..588469,588545..588688) [1695 bp, 564 aa]
           {ON} YBR186W (REAL)
          Length = 564

 Score = 30.4 bits (67), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 25/46 (54%), Gaps = 5/46 (10%)

Query: 10  LLISGTPGTGKSSTCELLKRELEDYKYINISDFAKEFNCYDGFDKG 55
           LL+ G PGTGK++ C+ L ++L   +     +F+  F   D   KG
Sbjct: 310 LLVHGPPGTGKTTLCKALCQKLSVRR-----EFSDNFGTIDTSYKG 350

>AEL258W Chr5 (152451..153911,153967..154086) [1581 bp, 526 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR186W
           (PCH2); 1-intron
          Length = 526

 Score = 30.4 bits (67), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 20/78 (25%), Positives = 35/78 (44%), Gaps = 8/78 (10%)

Query: 10  LLISGTPGTGKSSTCELLKRELEDYKYINI--------SDFAKEFNCYDGFDKGRKSHIV 61
           LL+ G PGTGK++ C+ L  +L    +  +        S    E  C   F +       
Sbjct: 283 LLVHGPPGTGKTTICKALCHKLAIRLHSGLLPKNKSVPSVILVELACSKVFSRWFGESSK 342

Query: 62  DEDKLLDELEPILREGHN 79
           + D +  +LE ++++G N
Sbjct: 343 NIDTIFKDLEKLIKDGIN 360

>KLTH0D00418g Chr4 complement(37778..39463) [1686 bp, 561 aa] {ON}
           similar to uniprot|P16467 Saccharomyces cerevisiae
           YLR134W PDC5 Minor isoform of pyruvate decarboxylase
          Length = 561

 Score = 30.4 bits (67), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 22/42 (52%)

Query: 7   LPNLLISGTPGTGKSSTCELLKRELEDYKYINISDFAKEFNC 48
           LP +LISG+P T  SS   LL   +  + Y    + AK+  C
Sbjct: 91  LPVILISGSPNTNDSSDHRLLHHTIGTHNYDYQYEMAKQITC 132

>KAFR0A07880 Chr1 complement(1577607..1579292) [1686 bp, 561 aa]
           {ON} Anc_2.26 YNL218W
          Length = 561

 Score = 30.0 bits (66), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 29/54 (53%), Gaps = 4/54 (7%)

Query: 7   LPNLLISGTPGTGKSSTCELLKRELEDYKYINISDFAKEFNCYDG---FDKGRK 57
           +P++++ G PG GK+S   LL +   + KY  I   A + N  +    FD+ +K
Sbjct: 155 IPSMILWGPPGVGKTSLARLLTKSATN-KYYMIETSATKANTQELRSIFDRAKK 207

>NDAI0C00140 Chr3 complement(19018..19656) [639 bp, 212 aa] {ON}
           Anc_2.667 YKL024C
          Length = 212

 Score = 29.3 bits (64), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 30/142 (21%), Positives = 57/142 (40%), Gaps = 28/142 (19%)

Query: 10  LLISGTPGTGKSSTCELLKRELEDYKYINIS--DFAKEFNCYDGFDKGRK-SHIVDEDKL 66
           + + G PG GK + C  L   +EDY ++++S  D  +     +G + G    H + E  +
Sbjct: 23  IFVLGGPGAGKGTQCAKL---VEDYGFVHLSAGDLLRAEQAREGSEYGTLIKHYIKEGLI 79

Query: 67  LDELEPILREGHNIVDWHVN---------DVFPERL------------IDLVVILRADNS 105
           + + E  L    N +  H N         D FP ++                +      +
Sbjct: 80  VPQ-EITLALLKNAIQEHYNNKGAKNFLIDGFPRKMDQAISFEEQIAPSKFTLFFDCPEN 138

Query: 106 VLYDRLQNRKYHDAKVQENLDA 127
           V+ +RL  R     +V +N+++
Sbjct: 139 VMLERLLERGKTSGRVDDNIES 160

>SAKL0F02046g Chr6 complement(172863..177842) [4980 bp, 1659 aa] {ON}
            highly similar to uniprot|P22137 Saccharomyces cerevisiae
            YGL206C CHC1 vesicle coat protein presumed vesicle coat
            protein
          Length = 1659

 Score = 29.6 bits (65), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 33/115 (28%), Positives = 54/115 (46%), Gaps = 13/115 (11%)

Query: 37   INISDFAKEFNCYDGFDKGRKSHIVDEDKLLDELEPILREGHNIVDWHVNDVFPERLIDL 96
            + +S+    +   + + K   S ++D   LL  L P L     +  +  +D  P     L
Sbjct: 1402 VKVSNLEIYYKAINFYVKEHPSLLID---LLTVLTPRLDIPRTVRIFSKSDNLPLIKPFL 1458

Query: 97   VVILRADNSVLYDRLQNRKYHDAKVQENLDAEIMGVVLQDAIDSYAQEIVIELQS 151
            V +L  +NSV+     N+ YHD  ++E  D +     LQDA+DSY +   +EL S
Sbjct: 1459 VNVLPKNNSVV-----NQAYHDLMIEEE-DYK----ALQDAVDSYDKFDQLELAS 1503

>KAFR0H02800 Chr8 (534664..535518) [855 bp, 284 aa] {ON} Anc_8.610
           YPL117C
          Length = 284

 Score = 28.9 bits (63), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 26/49 (53%)

Query: 19  GKSSTCELLKRELEDYKYINISDFAKEFNCYDGFDKGRKSHIVDEDKLL 67
           GKS T +    E+EDYK++++  F K  N  + FD      I+ E+ L 
Sbjct: 214 GKSITVKPNLNEVEDYKWVDLDTFKKMLNDSENFDFTPWFKIICENYLF 262

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.136    0.393 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 22,278,956
Number of extensions: 1037363
Number of successful extensions: 4579
Number of sequences better than 10.0: 117
Number of HSP's gapped: 4669
Number of HSP's successfully gapped: 117
Length of query: 209
Length of database: 53,481,399
Length adjustment: 105
Effective length of query: 104
Effective length of database: 41,441,469
Effective search space: 4309912776
Effective search space used: 4309912776
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 63 (28.9 bits)