Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0E005107.347ON28728710451e-144
TDEL0C020107.347ON1911667354e-98
Suva_4.817.347ON1911667293e-97
CAGL0I03388g7.347ON1911667284e-97
Smik_4.737.347ON1911667285e-97
Skud_4.927.347ON1911667276e-97
Kpol_530.347.347ON1911667277e-97
ZYRO0F11638g7.347ON1911667233e-96
NDAI0A019207.347ON1931687223e-96
YDL165W (CDC36)7.347ON1911667224e-96
KAFR0B008507.347ON1921667121e-94
TPHA0F029407.347ON1911666991e-92
KNAG0C037607.347ON1911666955e-92
NCAS0A141307.347ON1911666886e-91
KLTH0H01320g7.347ON1901666364e-83
Kwal_56.246347.347ON1901666322e-82
SAKL0F11308g7.347ON1911666252e-81
KLLA0D12408g7.347ON1841655722e-73
Ecym_47267.347ON1911725522e-70
ACL151C7.347ON2081715378e-68
KLTH0F11880g3.370ON563841131e-05
ZYRO0C16588g3.370ON608821131e-05
KAFR0H008603.370ON578821094e-05
SAKL0B08052g3.370ON576841085e-05
Smik_16.3163.370ON560821086e-05
Kwal_23.39623.370ON553841068e-05
YPR072W (NOT5)3.370ON560821069e-05
Skud_16.3613.370ON560821042e-04
Suva_16.4013.370ON565821042e-04
Kpol_1006.73.370ON540811023e-04
CAGL0D01342g3.370ON548831023e-04
TBLA0H014903.370ON552811005e-04
NDAI0A050803.370ON57582960.002
TPHA0A035003.370ON54882950.002
TDEL0C051203.370ON56269950.002
ADL364C3.370ON50487950.002
Ecym_34563.370ON50886940.003
KNAG0A072903.370ON50786940.003
KLLA0B09196g3.370ON59072920.005
Kpol_1070.257.214ON686103790.24
KLTH0A03652g7.214ON77238780.25
NCAS0A112103.370ON58241750.59
ZYRO0D16302g7.214ON829115712.1
NCAS0A133507.214ON80066667.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0E00510
         (287 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0E00510 Chr5 complement(93705..94568) [864 bp, 287 aa] {ON} ...   407   e-144
TDEL0C02010 Chr3 (348737..349312) [576 bp, 191 aa] {ON} Anc_7.34...   287   4e-98
Suva_4.81 Chr4 (151849..152424) [576 bp, 191 aa] {ON} YDL165W (R...   285   3e-97
CAGL0I03388g Chr9 (288784..289359) [576 bp, 191 aa] {ON} highly ...   285   4e-97
Smik_4.73 Chr4 (141054..141629) [576 bp, 191 aa] {ON} YDL165W (R...   285   5e-97
Skud_4.92 Chr4 (159953..160528) [576 bp, 191 aa] {ON} YDL165W (R...   284   6e-97
Kpol_530.34 s530 (82095..82670) [576 bp, 191 aa] {ON} (82095..82...   284   7e-97
ZYRO0F11638g Chr6 complement(954908..955483) [576 bp, 191 aa] {O...   283   3e-96
NDAI0A01920 Chr1 (429808..430389) [582 bp, 193 aa] {ON} Anc_7.34...   282   3e-96
YDL165W Chr4 (164290..164865) [576 bp, 191 aa] {ON}  CDC36Compon...   282   4e-96
KAFR0B00850 Chr2 complement(160852..161430) [579 bp, 192 aa] {ON...   278   1e-94
TPHA0F02940 Chr6 complement(648881..649456) [576 bp, 191 aa] {ON...   273   1e-92
KNAG0C03760 Chr3 complement(741798..742373) [576 bp, 191 aa] {ON...   272   5e-92
NCAS0A14130 Chr1 complement(2778386..2778961) [576 bp, 191 aa] {...   269   6e-91
KLTH0H01320g Chr8 (125017..125589) [573 bp, 190 aa] {ON} highly ...   249   4e-83
Kwal_56.24634 s56 complement(1082319..1082891) [573 bp, 190 aa] ...   248   2e-82
SAKL0F11308g Chr6 complement(882040..882615) [576 bp, 191 aa] {O...   245   2e-81
KLLA0D12408g Chr4 (1055117..1055671) [555 bp, 184 aa] {ON} simil...   224   2e-73
Ecym_4726 Chr4 (1420080..1420655) [576 bp, 191 aa] {ON} similar ...   217   2e-70
ACL151C Chr3 complement(87037..87663) [627 bp, 208 aa] {ON} Synt...   211   8e-68
KLTH0F11880g Chr6 complement(1000583..1002274) [1692 bp, 563 aa]...    48   1e-05
ZYRO0C16588g Chr3 (1293001..1294827) [1827 bp, 608 aa] {ON} high...    48   1e-05
KAFR0H00860 Chr8 complement(158881..160617) [1737 bp, 578 aa] {O...    47   4e-05
SAKL0B08052g Chr2 (688482..690212) [1731 bp, 576 aa] {ON} highly...    46   5e-05
Smik_16.316 Chr16 (567157..568839) [1683 bp, 560 aa] {ON} YPR072...    46   6e-05
Kwal_23.3962 s23 complement(502287..503948) [1662 bp, 553 aa] {O...    45   8e-05
YPR072W Chr16 (690107..691789) [1683 bp, 560 aa] {ON}  NOT5Subun...    45   9e-05
Skud_16.361 Chr16 (655247..656929) [1683 bp, 560 aa] {ON} YPR072...    45   2e-04
Suva_16.401 Chr16 (697328..699025) [1698 bp, 565 aa] {ON} YPR072...    45   2e-04
Kpol_1006.7 s1006 (30700..32322) [1623 bp, 540 aa] {ON} (30700.....    44   3e-04
CAGL0D01342g Chr4 complement(149562..151208) [1647 bp, 548 aa] {...    44   3e-04
TBLA0H01490 Chr8 complement(331583..333241) [1659 bp, 552 aa] {O...    43   5e-04
NDAI0A05080 Chr1 complement(1154530..1156257) [1728 bp, 575 aa] ...    42   0.002
TPHA0A03500 Chr1 complement(769721..771367) [1647 bp, 548 aa] {O...    41   0.002
TDEL0C05120 Chr3 (917832..919520) [1689 bp, 562 aa] {ON} Anc_3.3...    41   0.002
ADL364C Chr4 complement(66072..67586) [1515 bp, 504 aa] {ON} Syn...    41   0.002
Ecym_3456 Chr3 complement(853907..855433) [1527 bp, 508 aa] {ON}...    41   0.003
KNAG0A07290 Chr1 (1139630..1141153) [1524 bp, 507 aa] {ON} Anc_3...    41   0.003
KLLA0B09196g Chr2 complement(803259..805031) [1773 bp, 590 aa] {...    40   0.005
Kpol_1070.25 s1070 complement(58286..59491,59501..59509,59592..6...    35   0.24 
KLTH0A03652g Chr1 (314336..316654) [2319 bp, 772 aa] {ON} some s...    35   0.25 
NCAS0A11210 Chr1 (2223815..2225563) [1749 bp, 582 aa] {ON} Anc_3...    33   0.59 
ZYRO0D16302g Chr4 (1357223..1359712) [2490 bp, 829 aa] {ON} simi...    32   2.1  
NCAS0A13350 Chr1 (2627917..2630319) [2403 bp, 800 aa] {ON} Anc_7...    30   7.5  

>TBLA0E00510 Chr5 complement(93705..94568) [864 bp, 287 aa] {ON}
           Anc_7.347 YDL165W
          Length = 287

 Score =  407 bits (1045), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 207/287 (72%), Positives = 207/287 (72%)

Query: 1   MDRFGLKALVPLIRLDELQGXXXXXXXXXXXXXXXXXXXXIEKDTENSGENNVEDQGKGD 60
           MDRFGLKALVPLIRLDELQG                    IEKDTENSGENNVEDQGKGD
Sbjct: 1   MDRFGLKALVPLIRLDELQGTNNTNNNDTTEKIKTNTDENIEKDTENSGENNVEDQGKGD 60

Query: 61  KDETKKDSDGQDAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 120
           KDETKKDSDGQDA                                               
Sbjct: 61  KDETKKDSDGQDASKDKQEEPESKEEDNSKKETTTSKDSSSTKKDDKLDTSITTTISSTI 120

Query: 121 XHSLTIGADLSSMLHSLGLPRDNKRHRILDTFQSPWAETSRSEVQPRXXXXXXXXXXXXV 180
            HSLTIGADLSSMLHSLGLPRDNKRHRILDTFQSPWAETSRSEVQPR            V
Sbjct: 121 DHSLTIGADLSSMLHSLGLPRDNKRHRILDTFQSPWAETSRSEVQPRFFIPSSFSNISNV 180

Query: 181 LQCNTTPPTFNNIELDQQRVALFQDETLFYLFYKHPGTVIQELTYLELRKRNWRFHKILK 240
           LQCNTTPPTFNNIELDQQRVALFQDETLFYLFYKHPGTVIQELTYLELRKRNWRFHKILK
Sbjct: 181 LQCNTTPPTFNNIELDQQRVALFQDETLFYLFYKHPGTVIQELTYLELRKRNWRFHKILK 240

Query: 241 TWLTKDPMMEPIVAADGFSERGSYVFFDPQRWEKCQREFILFYNAIM 287
           TWLTKDPMMEPIVAADGFSERGSYVFFDPQRWEKCQREFILFYNAIM
Sbjct: 241 TWLTKDPMMEPIVAADGFSERGSYVFFDPQRWEKCQREFILFYNAIM 287

>TDEL0C02010 Chr3 (348737..349312) [576 bp, 191 aa] {ON} Anc_7.347
           YDL165W
          Length = 191

 Score =  287 bits (735), Expect = 4e-98,   Method: Compositional matrix adjust.
 Identities = 131/166 (78%), Positives = 146/166 (87%)

Query: 122 HSLTIGADLSSMLHSLGLPRDNKRHRILDTFQSPWAETSRSEVQPRXXXXXXXXXXXXVL 181
           HS+T+GADLSSMLHSLG+PRD+KRHR+LDTFQSPWAETSRSEV+P+            VL
Sbjct: 26  HSITLGADLSSMLHSLGIPRDSKRHRVLDTFQSPWAETSRSEVEPKFFIPDSFTNIPQVL 85

Query: 182 QCNTTPPTFNNIELDQQRVALFQDETLFYLFYKHPGTVIQELTYLELRKRNWRFHKILKT 241
           Q  TTPP FN+++ DQQRVALFQDETLFYLFYKHPGTVIQELTYLELRKRNWR+HK LK 
Sbjct: 86  QSQTTPPCFNSVQHDQQRVALFQDETLFYLFYKHPGTVIQELTYLELRKRNWRYHKTLKA 145

Query: 242 WLTKDPMMEPIVAADGFSERGSYVFFDPQRWEKCQREFILFYNAIM 287
           WLTKDP MEP+V++DG SERGSYVFFDPQRWEKCQREF+LFYNAIM
Sbjct: 146 WLTKDPKMEPVVSSDGLSERGSYVFFDPQRWEKCQREFLLFYNAIM 191

>Suva_4.81 Chr4 (151849..152424) [576 bp, 191 aa] {ON} YDL165W
           (REAL)
          Length = 191

 Score =  285 bits (729), Expect = 3e-97,   Method: Compositional matrix adjust.
 Identities = 131/166 (78%), Positives = 146/166 (87%)

Query: 122 HSLTIGADLSSMLHSLGLPRDNKRHRILDTFQSPWAETSRSEVQPRXXXXXXXXXXXXVL 181
           HS+T+GADLSSML+SLG+PRD++ HR+LDTFQSPWAETSRSEV+PR            VL
Sbjct: 26  HSMTLGADLSSMLYSLGIPRDSQDHRVLDTFQSPWAETSRSEVEPRFFTPESFTNIPSVL 85

Query: 182 QCNTTPPTFNNIELDQQRVALFQDETLFYLFYKHPGTVIQELTYLELRKRNWRFHKILKT 241
           Q N TPP FN+I+ DQQRVALFQDETLF+LFYKHPGTVIQELTYLELRKRNWR+HK LK 
Sbjct: 86  QSNVTPPCFNSIQNDQQRVALFQDETLFFLFYKHPGTVIQELTYLELRKRNWRYHKTLKA 145

Query: 242 WLTKDPMMEPIVAADGFSERGSYVFFDPQRWEKCQREFILFYNAIM 287
           WLTKDPMMEPIV+ADG SERGSYVFFDPQRWEKCQR+F+LFYNAIM
Sbjct: 146 WLTKDPMMEPIVSADGLSERGSYVFFDPQRWEKCQRDFLLFYNAIM 191

>CAGL0I03388g Chr9 (288784..289359) [576 bp, 191 aa] {ON} highly
           similar to uniprot|P06100 Saccharomyces cerevisiae
           YDL165w CDC36 transcription factor
          Length = 191

 Score =  285 bits (728), Expect = 4e-97,   Method: Compositional matrix adjust.
 Identities = 131/166 (78%), Positives = 145/166 (87%)

Query: 122 HSLTIGADLSSMLHSLGLPRDNKRHRILDTFQSPWAETSRSEVQPRXXXXXXXXXXXXVL 181
           HS+TIG DLSSMLHSLG+PRD+K HR+LDTFQSPWAETSRSEV+P+            VL
Sbjct: 26  HSMTIGTDLSSMLHSLGIPRDSKHHRVLDTFQSPWAETSRSEVEPKYYIPESFKNIPDVL 85

Query: 182 QCNTTPPTFNNIELDQQRVALFQDETLFYLFYKHPGTVIQELTYLELRKRNWRFHKILKT 241
           Q  TTPPTF++++ DQQRVALFQDETLFYLFYKHPGTVIQELTYLELRKRNWR+HK LK 
Sbjct: 86  QSKTTPPTFDDVQTDQQRVALFQDETLFYLFYKHPGTVIQELTYLELRKRNWRYHKGLKA 145

Query: 242 WLTKDPMMEPIVAADGFSERGSYVFFDPQRWEKCQREFILFYNAIM 287
           WLTKDPMMEP+VAADG SERGSYVFFDPQRWEKCQR+F LFY+AIM
Sbjct: 146 WLTKDPMMEPVVAADGLSERGSYVFFDPQRWEKCQRDFPLFYSAIM 191

>Smik_4.73 Chr4 (141054..141629) [576 bp, 191 aa] {ON} YDL165W
           (REAL)
          Length = 191

 Score =  285 bits (728), Expect = 5e-97,   Method: Compositional matrix adjust.
 Identities = 131/166 (78%), Positives = 146/166 (87%)

Query: 122 HSLTIGADLSSMLHSLGLPRDNKRHRILDTFQSPWAETSRSEVQPRXXXXXXXXXXXXVL 181
           HS+T+GADLSSML+SLG+PRD++ HR+LDTFQSPWAETSRSEV+PR            VL
Sbjct: 26  HSMTLGADLSSMLYSLGIPRDSQDHRVLDTFQSPWAETSRSEVEPRFFTPESFTNIPGVL 85

Query: 182 QCNTTPPTFNNIELDQQRVALFQDETLFYLFYKHPGTVIQELTYLELRKRNWRFHKILKT 241
           Q N TPP FN+I+ DQQRVALFQDETLF+LFYKHPGTVIQELTYLELRKRNWR+HK LK 
Sbjct: 86  QSNVTPPCFNSIQNDQQRVALFQDETLFFLFYKHPGTVIQELTYLELRKRNWRYHKTLKA 145

Query: 242 WLTKDPMMEPIVAADGFSERGSYVFFDPQRWEKCQREFILFYNAIM 287
           WLTKDPMMEPIV+ADG SERGSYVFFDPQRWEKCQR+F+LFYNAIM
Sbjct: 146 WLTKDPMMEPIVSADGLSERGSYVFFDPQRWEKCQRDFLLFYNAIM 191

>Skud_4.92 Chr4 (159953..160528) [576 bp, 191 aa] {ON} YDL165W
           (REAL)
          Length = 191

 Score =  284 bits (727), Expect = 6e-97,   Method: Compositional matrix adjust.
 Identities = 131/166 (78%), Positives = 146/166 (87%)

Query: 122 HSLTIGADLSSMLHSLGLPRDNKRHRILDTFQSPWAETSRSEVQPRXXXXXXXXXXXXVL 181
           HS+T+GADLSSML+SLG+PRD++ HR+LDTFQSPWAETSRSEV+PR            VL
Sbjct: 26  HSMTLGADLSSMLYSLGIPRDSQDHRVLDTFQSPWAETSRSEVEPRFFTPESFTNIPGVL 85

Query: 182 QCNTTPPTFNNIELDQQRVALFQDETLFYLFYKHPGTVIQELTYLELRKRNWRFHKILKT 241
           Q N TPP FN+I+ DQQRVALFQDETLF+LFYKHPGTVIQELTYLELRKRNWR+HK LK 
Sbjct: 86  QSNVTPPCFNSIQNDQQRVALFQDETLFFLFYKHPGTVIQELTYLELRKRNWRYHKTLKA 145

Query: 242 WLTKDPMMEPIVAADGFSERGSYVFFDPQRWEKCQREFILFYNAIM 287
           WLTKDPMMEPIV+ADG SERGSYVFFDPQRWEKCQR+F+LFYNAIM
Sbjct: 146 WLTKDPMMEPIVSADGLSERGSYVFFDPQRWEKCQRDFLLFYNAIM 191

>Kpol_530.34 s530 (82095..82670) [576 bp, 191 aa] {ON}
           (82095..82670) [576 nt, 192 aa]
          Length = 191

 Score =  284 bits (727), Expect = 7e-97,   Method: Compositional matrix adjust.
 Identities = 130/166 (78%), Positives = 143/166 (86%)

Query: 122 HSLTIGADLSSMLHSLGLPRDNKRHRILDTFQSPWAETSRSEVQPRXXXXXXXXXXXXVL 181
           H++TIG DLSSMLHSLG+PRDN+R+RILDTFQSPWAETSRSEV+PR            VL
Sbjct: 26  HAMTIGTDLSSMLHSLGIPRDNQRYRILDTFQSPWAETSRSEVEPRFFTPESFKNIPNVL 85

Query: 182 QCNTTPPTFNNIELDQQRVALFQDETLFYLFYKHPGTVIQELTYLELRKRNWRFHKILKT 241
           Q   TPP FN+IE DQQRV LFQDETLFYLFYKHPGTVIQELTYLELRKRNWR+HK LK 
Sbjct: 86  QSKVTPPVFNSIENDQQRVTLFQDETLFYLFYKHPGTVIQELTYLELRKRNWRYHKTLKA 145

Query: 242 WLTKDPMMEPIVAADGFSERGSYVFFDPQRWEKCQREFILFYNAIM 287
           WLTKDPM+EP+V+ DG SERGSY+FFDPQRWEKCQREF+LFYNAIM
Sbjct: 146 WLTKDPMVEPLVSGDGLSERGSYIFFDPQRWEKCQREFVLFYNAIM 191

>ZYRO0F11638g Chr6 complement(954908..955483) [576 bp, 191 aa] {ON}
           highly similar to uniprot|P06100 Saccharomyces
           cerevisiae YDL165W CDC36 Component of the CCR4-NOT
           complex which has multiple roles in regulating mRNA
           levels including regulation of transcription and
           destabilizing mRNAs by deadenylation basal transcription
           factor
          Length = 191

 Score =  283 bits (723), Expect = 3e-96,   Method: Compositional matrix adjust.
 Identities = 128/166 (77%), Positives = 145/166 (87%)

Query: 122 HSLTIGADLSSMLHSLGLPRDNKRHRILDTFQSPWAETSRSEVQPRXXXXXXXXXXXXVL 181
           HS+T+GADLSSMLHSLG+PRD+KRH++LDTFQSPWAETSRSEV+PR            VL
Sbjct: 26  HSMTLGADLSSMLHSLGIPRDSKRHKVLDTFQSPWAETSRSEVEPRFFIPESFVNIPNVL 85

Query: 182 QCNTTPPTFNNIELDQQRVALFQDETLFYLFYKHPGTVIQELTYLELRKRNWRFHKILKT 241
              +TPP FN+++ DQQRVALFQDETLFYLFYKHPGTVIQELTYLELRKRNWR+HK LK 
Sbjct: 86  HSQSTPPCFNSVQQDQQRVALFQDETLFYLFYKHPGTVIQELTYLELRKRNWRYHKTLKA 145

Query: 242 WLTKDPMMEPIVAADGFSERGSYVFFDPQRWEKCQREFILFYNAIM 287
           WLTKDP MEP+V++DG SERGSYVFFDPQRWEKCQR+F+LFYNAIM
Sbjct: 146 WLTKDPKMEPVVSSDGLSERGSYVFFDPQRWEKCQRDFLLFYNAIM 191

>NDAI0A01920 Chr1 (429808..430389) [582 bp, 193 aa] {ON} Anc_7.347
           YDL165W
          Length = 193

 Score =  282 bits (722), Expect = 3e-96,   Method: Compositional matrix adjust.
 Identities = 131/168 (77%), Positives = 147/168 (87%), Gaps = 2/168 (1%)

Query: 122 HSLTIGADLSSMLHSLGLPRDNKRHRILDTFQSPWAETSRSEVQPRXXXXXXXXXXXXVL 181
           HS+T+GADL+SMLHSLG+PRD+KRHR+LDTFQSPWAETSRSEV+P             VL
Sbjct: 26  HSMTLGADLTSMLHSLGIPRDSKRHRVLDTFQSPWAETSRSEVEPTFFIPDSFTHIPDVL 85

Query: 182 QCNT--TPPTFNNIELDQQRVALFQDETLFYLFYKHPGTVIQELTYLELRKRNWRFHKIL 239
           Q NT  TPP+F++++ DQQRVALFQDETLFYLFYKHPGTVIQELTYLELRKRNWR+HK L
Sbjct: 86  QSNTKDTPPSFDSVQKDQQRVALFQDETLFYLFYKHPGTVIQELTYLELRKRNWRYHKTL 145

Query: 240 KTWLTKDPMMEPIVAADGFSERGSYVFFDPQRWEKCQREFILFYNAIM 287
           K WLTKDPMMEP+V+ DG SERGSYVFFDPQRWEKCQREF+LFYNAIM
Sbjct: 146 KAWLTKDPMMEPVVSNDGLSERGSYVFFDPQRWEKCQREFLLFYNAIM 193

>YDL165W Chr4 (164290..164865) [576 bp, 191 aa] {ON}  CDC36Component
           of the CCR4-NOT complex, which has multiple roles in
           regulating mRNA levels including regulation of
           transcription and destabilizing mRNAs by deadenylation;
           basal transcription factor
          Length = 191

 Score =  282 bits (722), Expect = 4e-96,   Method: Compositional matrix adjust.
 Identities = 130/166 (78%), Positives = 145/166 (87%)

Query: 122 HSLTIGADLSSMLHSLGLPRDNKRHRILDTFQSPWAETSRSEVQPRXXXXXXXXXXXXVL 181
           HS+T+GADLSSML+SLG+PRD++ HR+LDTFQSPWAETSRSEV+PR            VL
Sbjct: 26  HSMTLGADLSSMLYSLGIPRDSQDHRVLDTFQSPWAETSRSEVEPRFFTPESFTNIPGVL 85

Query: 182 QCNTTPPTFNNIELDQQRVALFQDETLFYLFYKHPGTVIQELTYLELRKRNWRFHKILKT 241
           Q   TPP FN+I+ DQQRVALFQDETLF+LFYKHPGTVIQELTYLELRKRNWR+HK LK 
Sbjct: 86  QSTVTPPCFNSIQNDQQRVALFQDETLFFLFYKHPGTVIQELTYLELRKRNWRYHKTLKA 145

Query: 242 WLTKDPMMEPIVAADGFSERGSYVFFDPQRWEKCQREFILFYNAIM 287
           WLTKDPMMEPIV+ADG SERGSYVFFDPQRWEKCQR+F+LFYNAIM
Sbjct: 146 WLTKDPMMEPIVSADGLSERGSYVFFDPQRWEKCQRDFLLFYNAIM 191

 Score = 29.6 bits (65), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 11/17 (64%), Positives = 17/17 (100%)

Query: 1  MDRFGLKALVPLIRLDE 17
          M++FGLKALVPL++L++
Sbjct: 1  MEKFGLKALVPLLKLED 17

>KAFR0B00850 Chr2 complement(160852..161430) [579 bp, 192 aa] {ON}
           Anc_7.347 YDL165W
          Length = 192

 Score =  278 bits (712), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 127/166 (76%), Positives = 143/166 (86%)

Query: 122 HSLTIGADLSSMLHSLGLPRDNKRHRILDTFQSPWAETSRSEVQPRXXXXXXXXXXXXVL 181
           HS+T+GADLSSML+SLG+PRD + HR+LDTFQSPWAETSRSEV+P+            VL
Sbjct: 27  HSMTLGADLSSMLYSLGIPRDKQHHRVLDTFQSPWAETSRSEVEPKFSIPDSFNNISNVL 86

Query: 182 QCNTTPPTFNNIELDQQRVALFQDETLFYLFYKHPGTVIQELTYLELRKRNWRFHKILKT 241
           Q N TPP F++I+ DQQRVALFQDETLFYLFYKHP TVIQELTYLELRKRNWR+HK LK 
Sbjct: 87  QSNVTPPCFDSIQNDQQRVALFQDETLFYLFYKHPATVIQELTYLELRKRNWRYHKTLKA 146

Query: 242 WLTKDPMMEPIVAADGFSERGSYVFFDPQRWEKCQREFILFYNAIM 287
           WLTKDPMMEPIV+ DG SE+GSYVFFDPQRWEKCQR+F+LFYNAIM
Sbjct: 147 WLTKDPMMEPIVSQDGLSEKGSYVFFDPQRWEKCQRDFLLFYNAIM 192

 Score = 30.8 bits (68), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 12/16 (75%), Positives = 15/16 (93%)

Query: 1  MDRFGLKALVPLIRLD 16
          MD+FGLKAL+PLI+ D
Sbjct: 1  MDKFGLKALIPLIKQD 16

>TPHA0F02940 Chr6 complement(648881..649456) [576 bp, 191 aa] {ON}
           Anc_7.347 YDL165W
          Length = 191

 Score =  273 bits (699), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 124/166 (74%), Positives = 143/166 (86%)

Query: 122 HSLTIGADLSSMLHSLGLPRDNKRHRILDTFQSPWAETSRSEVQPRXXXXXXXXXXXXVL 181
           H++TIGADL+S+ HSLG+P +NKR+R+LDTFQSPWAETSRSEV+PR            VL
Sbjct: 26  HAMTIGADLTSIQHSLGIPNNNKRYRVLDTFQSPWAETSRSEVEPRYFTPKSFTNIPKVL 85

Query: 182 QCNTTPPTFNNIELDQQRVALFQDETLFYLFYKHPGTVIQELTYLELRKRNWRFHKILKT 241
           Q   TP  FN++E DQQR++LFQDETLFYLFYKHPGTVIQELTYLELRKRNWR+HKILK 
Sbjct: 86  QSIDTPSVFNSVETDQQRISLFQDETLFYLFYKHPGTVIQELTYLELRKRNWRYHKILKA 145

Query: 242 WLTKDPMMEPIVAADGFSERGSYVFFDPQRWEKCQREFILFYNAIM 287
           WLTKDP++EPIV ADG SERGSY+FFDPQRWEKCQR+F+LFYNAIM
Sbjct: 146 WLTKDPIVEPIVTADGQSERGSYIFFDPQRWEKCQRDFVLFYNAIM 191

>KNAG0C03760 Chr3 complement(741798..742373) [576 bp, 191 aa] {ON}
           Anc_7.347 YDL165W
          Length = 191

 Score =  272 bits (695), Expect = 5e-92,   Method: Compositional matrix adjust.
 Identities = 124/166 (74%), Positives = 140/166 (84%)

Query: 122 HSLTIGADLSSMLHSLGLPRDNKRHRILDTFQSPWAETSRSEVQPRXXXXXXXXXXXXVL 181
           HS+ +GADLSSMLHSLG+PRD+KR  +L TFQSPWAETSRSEV+P             VL
Sbjct: 26  HSMALGADLSSMLHSLGIPRDSKRQAVLATFQSPWAETSRSEVEPTFYIPASFLGIDEVL 85

Query: 182 QCNTTPPTFNNIELDQQRVALFQDETLFYLFYKHPGTVIQELTYLELRKRNWRFHKILKT 241
           Q  +TPP F++++ DQQRVALFQDETLFYLFYKHPGTVIQELTYLELRKRNWR+HK LK 
Sbjct: 86  QSESTPPCFDSVQRDQQRVALFQDETLFYLFYKHPGTVIQELTYLELRKRNWRYHKTLKA 145

Query: 242 WLTKDPMMEPIVAADGFSERGSYVFFDPQRWEKCQREFILFYNAIM 287
           WLTKDP MEP+V+ DG SERGSYVFFDPQRWEKCQR+F+LFYNAIM
Sbjct: 146 WLTKDPTMEPVVSPDGLSERGSYVFFDPQRWEKCQRDFLLFYNAIM 191

 Score = 30.8 bits (68), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 12/14 (85%), Positives = 14/14 (100%)

Query: 1  MDRFGLKALVPLIR 14
          MD+FGLKALVPL+R
Sbjct: 1  MDKFGLKALVPLVR 14

>NCAS0A14130 Chr1 complement(2778386..2778961) [576 bp, 191 aa] {ON}
           Anc_7.347 YDL165W
          Length = 191

 Score =  269 bits (688), Expect = 6e-91,   Method: Compositional matrix adjust.
 Identities = 123/166 (74%), Positives = 140/166 (84%)

Query: 122 HSLTIGADLSSMLHSLGLPRDNKRHRILDTFQSPWAETSRSEVQPRXXXXXXXXXXXXVL 181
           HS+T+GADLSSM+HSLG+PRDN RHR+LDTFQSPWAETSRSEV+P             VL
Sbjct: 26  HSMTLGADLSSMIHSLGIPRDNTRHRVLDTFQSPWAETSRSEVEPTFFIPDSFVGISGVL 85

Query: 182 QCNTTPPTFNNIELDQQRVALFQDETLFYLFYKHPGTVIQELTYLELRKRNWRFHKILKT 241
           Q   TPP F++ + DQQRVALFQDETLFYLFYKHPGTV+QELTYLELR RNWR+H  L+ 
Sbjct: 86  QSPVTPPRFDSAQNDQQRVALFQDETLFYLFYKHPGTVLQELTYLELRNRNWRYHTTLRA 145

Query: 242 WLTKDPMMEPIVAADGFSERGSYVFFDPQRWEKCQREFILFYNAIM 287
           WLTKDP+MEP V+ADG SERGSYVFFDPQRWEKCQ++F+LFYNAIM
Sbjct: 146 WLTKDPLMEPEVSADGLSERGSYVFFDPQRWEKCQKDFLLFYNAIM 191

 Score = 31.6 bits (70), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 13/17 (76%), Positives = 16/17 (94%)

Query: 1  MDRFGLKALVPLIRLDE 17
          MD+FGLKALVPL+R D+
Sbjct: 1  MDKFGLKALVPLLRQDD 17

>KLTH0H01320g Chr8 (125017..125589) [573 bp, 190 aa] {ON} highly
           similar to uniprot|P06100 Saccharomyces cerevisiae
           YDL165W CDC36 Component of the CCR4-NOT complex which
           has multiple roles in regulating mRNA levels including
           regulation of transcription and destabilizing mRNAs by
           deadenylation basal transcription factor
          Length = 190

 Score =  249 bits (636), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 113/166 (68%), Positives = 134/166 (80%), Gaps = 1/166 (0%)

Query: 123 SLTIGADLSSMLHSLGLPRDN-KRHRILDTFQSPWAETSRSEVQPRXXXXXXXXXXXXVL 181
           S+T+G DLS +LHSLG+P +   R+R+LDTFQSPW ETSRSEV+P+            VL
Sbjct: 25  SMTLGIDLSPVLHSLGIPNNQPSRNRVLDTFQSPWVETSRSEVEPKFFVPESFKNIPNVL 84

Query: 182 QCNTTPPTFNNIELDQQRVALFQDETLFYLFYKHPGTVIQELTYLELRKRNWRFHKILKT 241
           Q    PP FN+++ D  +++LFQDETLFYLFYKHPG+V+QELTYLELRKRNWR+HK LK 
Sbjct: 85  QSGERPPAFNSVQQDHAKISLFQDETLFYLFYKHPGSVVQELTYLELRKRNWRYHKTLKV 144

Query: 242 WLTKDPMMEPIVAADGFSERGSYVFFDPQRWEKCQREFILFYNAIM 287
           WLTKDPMMEP+VA  G SERGSYVFFDPQRWEKCQR+F+LFYNAIM
Sbjct: 145 WLTKDPMMEPVVAPGGASERGSYVFFDPQRWEKCQRDFVLFYNAIM 190

>Kwal_56.24634 s56 complement(1082319..1082891) [573 bp, 190 aa]
           {ON} YDL165W (CDC36) - nuclear protein that negatively
           regulates basal transcription [contig 161] FULL
          Length = 190

 Score =  248 bits (632), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 112/166 (67%), Positives = 134/166 (80%), Gaps = 1/166 (0%)

Query: 123 SLTIGADLSSMLHSLGLPRD-NKRHRILDTFQSPWAETSRSEVQPRXXXXXXXXXXXXVL 181
           S+T+G DLS +LHSLG+  + + R+R+LDTFQSPW ETSRSEV+P+            VL
Sbjct: 25  SMTLGIDLSPVLHSLGIASNQSTRYRVLDTFQSPWVETSRSEVEPKFFVPESFKNIPNVL 84

Query: 182 QCNTTPPTFNNIELDQQRVALFQDETLFYLFYKHPGTVIQELTYLELRKRNWRFHKILKT 241
           Q    PP FN+++ D  +++LFQDETLFYLFYKHPG+V+QELTYLELRKRNWR+HK LK 
Sbjct: 85  QAGDKPPAFNSVQQDHAKISLFQDETLFYLFYKHPGSVVQELTYLELRKRNWRYHKTLKV 144

Query: 242 WLTKDPMMEPIVAADGFSERGSYVFFDPQRWEKCQREFILFYNAIM 287
           WLTKDPMMEP+VA  G SERGSYVFFDPQRWEKCQR+F+LFYNAIM
Sbjct: 145 WLTKDPMMEPVVAPGGASERGSYVFFDPQRWEKCQRDFVLFYNAIM 190

>SAKL0F11308g Chr6 complement(882040..882615) [576 bp, 191 aa] {ON}
           highly similar to uniprot|P06100 Saccharomyces
           cerevisiae YDL165W CDC36 Component of the CCR4-NOT
           complex which has multiple roles in regulating mRNA
           levels including regulation of transcription and
           destabilizing mRNAs by deadenylation basal transcription
           factor
          Length = 191

 Score =  245 bits (625), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 112/166 (67%), Positives = 137/166 (82%), Gaps = 2/166 (1%)

Query: 123 SLTIGADLSSMLHSLGLPRDNK-RHRILDTFQSPWAETSRSEVQPRXXXXXXXXXXXXVL 181
           ++T+G DLSSMLHSLG+  + + + R+LDTF SPW ETSRSEV+P+            VL
Sbjct: 27  AMTMGMDLSSMLHSLGIDSNQEYKTRVLDTFPSPWVETSRSEVEPKFFTPESFVNIPNVL 86

Query: 182 QCNTTPPTFNNIELDQQRVALFQDETLFYLFYKHPGTVIQELTYLELRKRNWRFHKILKT 241
           Q + +PP+FN+++ D  ++ALFQDETLFYLFYKHPGTV+QE+TYLELRKRNWR+HK LK 
Sbjct: 87  Q-SPSPPSFNSVQQDHPKIALFQDETLFYLFYKHPGTVVQEITYLELRKRNWRYHKTLKV 145

Query: 242 WLTKDPMMEPIVAADGFSERGSYVFFDPQRWEKCQREFILFYNAIM 287
           WLTKDPMMEP+V+ DG SERGSYVFFDPQRWEKCQR+F+LFYNAIM
Sbjct: 146 WLTKDPMMEPVVSQDGLSERGSYVFFDPQRWEKCQRDFVLFYNAIM 191

>KLLA0D12408g Chr4 (1055117..1055671) [555 bp, 184 aa] {ON} similar
           to uniprot|P06100 Saccharomyces cerevisiae YDL165W CDC36
           Component of the CCR4-NOT complex which has multiple
           roles in regulating mRNA levels including regulation of
           transcription and destabilizing mRNAs by deadenylation
           basal transcription factor
          Length = 184

 Score =  224 bits (572), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 106/165 (64%), Positives = 125/165 (75%), Gaps = 2/165 (1%)

Query: 123 SLTIGADLSSMLHSLGLPRDNKRHRILDTFQSPWAETSRSEVQPRXXXXXXXXXXXXVLQ 182
           ++T+G DL+S+L+SL + +D K H  LD F+SPW ETSRSEVQP             +L 
Sbjct: 22  NMTLGIDLNSLLNSLDITKDTKSHHCLDAFESPWVETSRSEVQPTFFIPESFKNIKGML- 80

Query: 183 CNTTPPTFNNIELDQQRVALFQDETLFYLFYKHPGTVIQELTYLELRKRNWRFHKILKTW 242
             T    F ++  DQ R++L QDETLFYLFYKHPG+VIQELTYLELRKRNWR+HK LK W
Sbjct: 81  -GTDQVEFTSVNRDQPRISLLQDETLFYLFYKHPGSVIQELTYLELRKRNWRYHKTLKVW 139

Query: 243 LTKDPMMEPIVAADGFSERGSYVFFDPQRWEKCQREFILFYNAIM 287
           LTKDPMMEP+VA D  SERGSYVFFDPQRWEKCQR+F+L YNAIM
Sbjct: 140 LTKDPMMEPVVAQDSMSERGSYVFFDPQRWEKCQRDFVLHYNAIM 184

>Ecym_4726 Chr4 (1420080..1420655) [576 bp, 191 aa] {ON} similar to
           Ashbya gossypii ACL151C
          Length = 191

 Score =  217 bits (552), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 110/172 (63%), Positives = 125/172 (72%), Gaps = 9/172 (5%)

Query: 123 SLTIGADLSSMLHSLGLP-RD------NKRHRILDTFQSPWAETSRSEVQPRXXXXXXXX 175
           S+T+G DL S+LHSL L  RD      N  H  LDTF SPW ETSRSEV+P+        
Sbjct: 22  SMTLGTDLPSILHSLQLTTRDSYNSGLNNGHHTLDTFPSPWVETSRSEVEPKFFIPESFK 81

Query: 176 XXXXVLQCNTTPPTFNNIELDQQRVALFQDETLFYLFYKHPGTVIQELTYLELRKRNWRF 235
               VL   +T   F ++  D  R++L QDETLFYLFYKHPGTV+QELTYLELRKRNWR+
Sbjct: 82  NIVGVLGQPST--YFTSVARDHPRISLLQDETLFYLFYKHPGTVLQELTYLELRKRNWRY 139

Query: 236 HKILKTWLTKDPMMEPIVAADGFSERGSYVFFDPQRWEKCQREFILFYNAIM 287
           HK LK WLTKDP+MEPIV+ D  SERGSYVFFDPQRWEKCQR+FIL YNAIM
Sbjct: 140 HKTLKVWLTKDPLMEPIVSQDSTSERGSYVFFDPQRWEKCQRDFILNYNAIM 191

>ACL151C Chr3 complement(87037..87663) [627 bp, 208 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL165W
           (CDC36)
          Length = 208

 Score =  211 bits (537), Expect = 8e-68,   Method: Compositional matrix adjust.
 Identities = 104/171 (60%), Positives = 123/171 (71%), Gaps = 9/171 (5%)

Query: 124 LTIGADLSSMLHSLGLPRDN-------KRHRILDTFQSPWAETSRSEVQPRXXXXXXXXX 176
           +T+G D+SS+LHSL +   +         H  LDTF SPW ETSRSEV+P+         
Sbjct: 40  MTLGVDVSSLLHSLQVSSKDGYNTALSNGHHALDTFPSPWVETSRSEVEPKFFIPESFCN 99

Query: 177 XXXVLQCNTTPPTFNNIELDQQRVALFQDETLFYLFYKHPGTVIQELTYLELRKRNWRFH 236
              VL   +T   F ++  D  R++L QDETLFYLFYKHPGTV+QELTYLELRKRNWR+H
Sbjct: 100 IGGVLGQAST--DFTSVARDHPRISLLQDETLFYLFYKHPGTVLQELTYLELRKRNWRYH 157

Query: 237 KILKTWLTKDPMMEPIVAADGFSERGSYVFFDPQRWEKCQREFILFYNAIM 287
           K LK WLTKDP+MEPIV+ D  SERGSYVFFDPQRWEKCQR+FIL Y+AIM
Sbjct: 158 KTLKVWLTKDPLMEPIVSQDSTSERGSYVFFDPQRWEKCQRDFILNYSAIM 208

>KLTH0F11880g Chr6 complement(1000583..1002274) [1692 bp, 563 aa]
           {ON} highly similar to uniprot|Q12514 Saccharomyces
           cerevisiae YPR072W NOT5 Subunit of global
           transcriptional regulator
          Length = 563

 Score = 48.1 bits (113), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 29/84 (34%), Positives = 48/84 (57%), Gaps = 5/84 (5%)

Query: 200 VALFQDETLFYLFYKHPGTVIQELTYLELRKRNWRFHKILKTWLTKDPMMEPIVAADGFS 259
           ++ F  +TLF++FY + GT  Q L+  EL  R W+F+K+ + W  K+  +E +      S
Sbjct: 473 MSKFDLDTLFFIFYHYQGTYEQFLSARELSIRGWQFNKVNRCWFYKE--VEKLPPGMEQS 530

Query: 260 ERGSYVFFDPQR-W--EKCQREFI 280
           E  S+ +FD Q+ W   +C  EF+
Sbjct: 531 EEISWRYFDYQKSWLARRCGAEFV 554

>ZYRO0C16588g Chr3 (1293001..1294827) [1827 bp, 608 aa] {ON} highly
           similar to uniprot|Q12514 Saccharomyces cerevisiae
           YPR072W NOT5 Subunit of global transcriptional regulator
          Length = 608

 Score = 48.1 bits (113), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 31/82 (37%), Positives = 46/82 (56%), Gaps = 6/82 (7%)

Query: 203 FQDETLFYLFYKHPGTVIQELTYLELRK-RNWRFHKILKTWLTKDPMMEPIVAADGFSER 261
           F  +TLF++FY + GT  Q L   EL K R W+F+K+ + W  K+  +E +      SE 
Sbjct: 519 FDLDTLFFIFYHYQGTYEQFLAARELAKNRKWKFNKVDRCWYYKE--VEKLPPGMAQSEE 576

Query: 262 GSYVFFDPQR-W--EKCQREFI 280
            S+ +FD QR W   +C  +FI
Sbjct: 577 ESWRYFDYQRSWLARRCNSDFI 598

>KAFR0H00860 Chr8 complement(158881..160617) [1737 bp, 578 aa] {ON}
           Anc_3.370 YPR072W
          Length = 578

 Score = 46.6 bits (109), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 48/82 (58%), Gaps = 6/82 (7%)

Query: 203 FQDETLFYLFYKHPGTVIQELTYLELRK-RNWRFHKILKTWLTKDPMMEPIVAADGFSER 261
           F  +TLF++FY + GT  Q L+  EL K RNW+F+K+ + W  K+  +E +      SE 
Sbjct: 490 FDLDTLFFIFYHYQGTYEQFLSSRELNKNRNWQFNKVDRCWYYKE--IEKLPPGMNKSEE 547

Query: 262 GSYVFFDPQR-W--EKCQREFI 280
            S+ +FD ++ W   +C  +F+
Sbjct: 548 ESWRYFDYKKSWLARRCSPDFV 569

>SAKL0B08052g Chr2 (688482..690212) [1731 bp, 576 aa] {ON} highly
           similar to uniprot|Q12514 Saccharomyces cerevisiae
           YPR072W NOT5 Subunit of global transcriptional regulator
          Length = 576

 Score = 46.2 bits (108), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 29/84 (34%), Positives = 48/84 (57%), Gaps = 6/84 (7%)

Query: 203 FQDETLFYLFYKHPGTVIQELTYLEL-RKRNWRFHKILKTWLTKDPMMEP--IVAADGFS 259
           F  +TLF++FY + GT  Q L   EL + RNW+F+K+   W  K+    P  +V+++   
Sbjct: 484 FDLDTLFFIFYHYQGTYEQFLAARELSQNRNWQFNKLNHCWFYKEVEKLPPGVVSSENKQ 543

Query: 260 ERGSYVFFDPQR-W--EKCQREFI 280
           E  S+ +FD Q+ W   +C  +F+
Sbjct: 544 EEISWRYFDYQKSWLARRCGSDFV 567

>Smik_16.316 Chr16 (567157..568839) [1683 bp, 560 aa] {ON} YPR072W
           (REAL)
          Length = 560

 Score = 46.2 bits (108), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 47/82 (57%), Gaps = 6/82 (7%)

Query: 203 FQDETLFYLFYKHPGTVIQELTYLELRK-RNWRFHKILKTWLTKDPMMEPIVAADGFSER 261
           F  +TLF++FY + G+  Q L   EL K RNW F+K+ + W  K+  +E +    G SE 
Sbjct: 472 FDLDTLFFIFYHYQGSYEQFLAARELYKNRNWLFNKVDRCWYYKE--IEKLPPGMGKSEE 529

Query: 262 GSYVFFDPQR-W--EKCQREFI 280
            S+ +FD ++ W   +C  +F+
Sbjct: 530 ESWRYFDYKKSWLARRCGNDFV 551

>Kwal_23.3962 s23 complement(502287..503948) [1662 bp, 553 aa] {ON}
           YPR072W (NOT5) - member of the NOT complex, a global
           negative regulator of transcription [contig 255] FULL
          Length = 553

 Score = 45.4 bits (106), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 47/84 (55%), Gaps = 5/84 (5%)

Query: 200 VALFQDETLFYLFYKHPGTVIQELTYLELRKRNWRFHKILKTWLTKDPMMEPIVAADGFS 259
           ++ F  +TLF++FY + GT  Q L   EL  R W+F+K+ + W  K+  +E +      S
Sbjct: 463 MSKFDLDTLFFIFYHYQGTHEQFLAARELTMRGWQFNKVNRCWFYKE--VEKLPPGMEQS 520

Query: 260 ERGSYVFFDPQR-W--EKCQREFI 280
           E  S+ +FD Q+ W   +C  +F+
Sbjct: 521 EEISWRYFDYQKSWLARRCGTDFV 544

>YPR072W Chr16 (690107..691789) [1683 bp, 560 aa] {ON}  NOT5Subunit
           of the CCR4-NOT complex, which is a global
           transcriptional regulator with roles in transcription
           initiation and elongation and in mRNA degradation
          Length = 560

 Score = 45.4 bits (106), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 47/82 (57%), Gaps = 6/82 (7%)

Query: 203 FQDETLFYLFYKHPGTVIQELTYLEL-RKRNWRFHKILKTWLTKDPMMEPIVAADGFSER 261
           F  +TLF++FY + G+  Q L   EL + RNW F+K+ + W  K+  +E +    G SE 
Sbjct: 472 FDLDTLFFIFYHYQGSYEQFLAARELFKNRNWLFNKVDRCWYYKE--IEKLPPGMGKSEE 529

Query: 262 GSYVFFDPQR-W--EKCQREFI 280
            S+ +FD ++ W   +C  +F+
Sbjct: 530 ESWRYFDYKKSWLARRCGNDFV 551

>Skud_16.361 Chr16 (655247..656929) [1683 bp, 560 aa] {ON} YPR072W
           (REAL)
          Length = 560

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 47/82 (57%), Gaps = 6/82 (7%)

Query: 203 FQDETLFYLFYKHPGTVIQELTYLELRK-RNWRFHKILKTWLTKDPMMEPIVAADGFSER 261
           F  +TLF++FY + G+  Q L   EL K RNW F+++ + W  K+  +E +    G SE 
Sbjct: 472 FDLDTLFFIFYHYQGSYEQFLAARELYKNRNWLFNRVDRCWYYKE--IEKLPPGMGKSEE 529

Query: 262 GSYVFFDPQR-W--EKCQREFI 280
            S+ +FD ++ W   +C  +F+
Sbjct: 530 ESWRYFDYKKSWLARRCGNDFV 551

>Suva_16.401 Chr16 (697328..699025) [1698 bp, 565 aa] {ON} YPR072W
           (REAL)
          Length = 565

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 47/82 (57%), Gaps = 6/82 (7%)

Query: 203 FQDETLFYLFYKHPGTVIQELTYLELRK-RNWRFHKILKTWLTKDPMMEPIVAADGFSER 261
           F  +TLF++FY + G+  Q L   EL K RNW F+++ + W  K+  +E +    G SE 
Sbjct: 477 FDLDTLFFIFYHYQGSYEQFLAARELYKNRNWLFNRVDRCWYYKE--IEKLPPGMGKSEE 534

Query: 262 GSYVFFDPQR-W--EKCQREFI 280
            S+ +FD ++ W   +C  +F+
Sbjct: 535 ESWRYFDYKKSWLARRCGNDFV 556

>Kpol_1006.7 s1006 (30700..32322) [1623 bp, 540 aa] {ON}
           (30700..32322) [1623 nt, 541 aa]
          Length = 540

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 29/81 (35%), Positives = 42/81 (51%), Gaps = 6/81 (7%)

Query: 203 FQDETLFYLFYKHPGTVIQELTYLELRK-RNWRFHKILKTWLTKDPMMEPIVAADGFSER 261
           F  +TLF++FY + GT  Q L   EL K RNW+F+KI + W  K+    P        E 
Sbjct: 452 FDLDTLFFIFYHYQGTYEQFLVARELAKHRNWKFNKINRNWYYKEVTKSPPGMQQA--EE 509

Query: 262 GSYVFFDPQR-W--EKCQREF 279
            ++ +FD Q  W   +C  +F
Sbjct: 510 ETWRYFDYQNSWLARRCNSDF 530

>CAGL0D01342g Chr4 complement(149562..151208) [1647 bp, 548 aa] {ON}
           similar to uniprot|Q12514 Saccharomyces cerevisiae
           YPR072w NOT5
          Length = 548

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 29/83 (34%), Positives = 46/83 (55%), Gaps = 6/83 (7%)

Query: 202 LFQDETLFYLFYKHPGTVIQELTYLELRK-RNWRFHKILKTWLTKDPMMEPIVAADGFSE 260
           +F  +TLF++FY + GT  Q L   EL K RNW+F+K  + W  K+  +E +      SE
Sbjct: 459 MFDLDTLFFIFYHYQGTYEQFLAARELAKIRNWQFNKKDRCWYYKE--IEKLPPGMTKSE 516

Query: 261 RGSYVFFD-PQRW--EKCQREFI 280
             S+ +FD  + W   +C  +F+
Sbjct: 517 EESWRYFDFKKSWLSRRCGSDFV 539

>TBLA0H01490 Chr8 complement(331583..333241) [1659 bp, 552 aa] {ON}
           Anc_3.370 YPR072W
          Length = 552

 Score = 43.1 bits (100), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 29/81 (35%), Positives = 45/81 (55%), Gaps = 6/81 (7%)

Query: 203 FQDETLFYLFYKHPGTVIQELTYLELRK-RNWRFHKILKTWLTKDPMMEPIVAADGFSER 261
           F  +TLF++FY + GT  Q L+  EL K RNW F+K+ + W  ++  +E +      SE 
Sbjct: 463 FDLDTLFFIFYHYQGTYDQFLSARELAKNRNWEFNKVDRRWYYRE--VEKLPPGLPQSEE 520

Query: 262 GSYVFFDPQR-W--EKCQREF 279
            S+ +FD Q+ W   +C   F
Sbjct: 521 ISWRYFDYQKSWLSRRCNSNF 541

>NDAI0A05080 Chr1 complement(1154530..1156257) [1728 bp, 575 aa]
           {ON} Anc_3.370
          Length = 575

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/82 (32%), Positives = 44/82 (53%), Gaps = 4/82 (4%)

Query: 203 FQDETLFYLFYKHPGTVIQELTYLELRK-RNWRFHKILKTWLTKDPMMEPIVAADGFSER 261
           F  +TLF++FY + GT  Q L   EL K R+W+++K+   W  K+    P  A     E 
Sbjct: 485 FDLDTLFFIFYHYQGTYDQFLASRELSKNRDWKYNKVDYCWYYKEIEKLPPGANYNKDEE 544

Query: 262 GSYVFFDPQR-W--EKCQREFI 280
            S+ +FD ++ W   +C  +F+
Sbjct: 545 ESWRYFDYKKSWLSRRCGNDFV 566

>TPHA0A03500 Chr1 complement(769721..771367) [1647 bp, 548 aa] {ON}
           Anc_3.370 YPR072W
          Length = 548

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 45/82 (54%), Gaps = 8/82 (9%)

Query: 203 FQDETLFYLFYKHPGTVIQELTYLELRK-RNWRFHKILKTWLTKDPMME-PIVAADGFSE 260
           F  +TLF++FY + GT  Q L   EL K RNW+++K+ + W  K+     P +A    +E
Sbjct: 460 FDLDTLFFIFYHYQGTYEQFLVARELSKCRNWKYNKVDRNWYFKEVTKSAPDMAQ---TE 516

Query: 261 RGSYVFFDPQR-W--EKCQREF 279
             ++ +FD Q  W   +C  +F
Sbjct: 517 EETWRYFDYQNSWLARRCNHDF 538

>TDEL0C05120 Chr3 (917832..919520) [1689 bp, 562 aa] {ON} Anc_3.370
           YPR072W
          Length = 562

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/69 (37%), Positives = 39/69 (56%), Gaps = 3/69 (4%)

Query: 203 FQDETLFYLFYKHPGTVIQELTYLELRK-RNWRFHKILKTWLTKDPMMEPIVAADGFSER 261
           F  +TLF++FY + GT  Q L   EL K R W+F+KI + W  K+  +E +      +E 
Sbjct: 473 FDLDTLFFIFYHYQGTYDQFLAARELSKNRKWKFNKIDRCWYYKE--VEKLPPGMLQAEE 530

Query: 262 GSYVFFDPQ 270
            S+ +FD Q
Sbjct: 531 ESWRYFDYQ 539

>ADL364C Chr4 complement(66072..67586) [1515 bp, 504 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR072W
           (NOT5)
          Length = 504

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 45/87 (51%), Gaps = 5/87 (5%)

Query: 198 QRVALFQDETLFYLFYKHPGTVIQELTYLELRKRNWRFHKILKTWLTKDPMMEPIVAADG 257
           Q +  F  +TLF++FY + GT  Q L   EL  R W F+++ + W  K+  +E +     
Sbjct: 412 QIMTKFDLDTLFFIFYHYQGTYDQFLAARELIIRGWIFNRVNRCWFYKE--VEKLPPGMD 469

Query: 258 FSERGSYVFFDPQR-W--EKCQREFIL 281
             E  S+ +FD Q+ W   +C  +F+ 
Sbjct: 470 QKEEVSWRYFDYQKSWLARRCGPDFVF 496

>Ecym_3456 Chr3 complement(853907..855433) [1527 bp, 508 aa] {ON}
           similar to Ashbya gossypii ADL364C
          Length = 508

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 45/86 (52%), Gaps = 5/86 (5%)

Query: 198 QRVALFQDETLFYLFYKHPGTVIQELTYLELRKRNWRFHKILKTWLTKDPMMEPIVAADG 257
           Q +  F  +TLF++FY + GT  Q L   EL  R W F+++ + W  ++  +E +     
Sbjct: 416 QILTKFDLDTLFFIFYHYQGTYEQFLAARELNIRGWLFNRVNRCWFYRE--VEKLPPGME 473

Query: 258 FSERGSYVFFDPQR-W--EKCQREFI 280
             E  S+ +FD Q+ W   +C  +F+
Sbjct: 474 QKEEVSWRYFDYQKSWLARRCGPDFV 499

>KNAG0A07290 Chr1 (1139630..1141153) [1524 bp, 507 aa] {ON}
           Anc_3.370 YPR072W
          Length = 507

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 29/86 (33%), Positives = 47/86 (54%), Gaps = 8/86 (9%)

Query: 203 FQDETLFYLFYKHPGTVIQELTYLELR-KRNWRFHKILKTWLTKDPMMEPIVAADGFSER 261
           F  +TLF++FY + GT  Q L   EL   R+W+F+K  + W  K+  +E +      SE 
Sbjct: 419 FDLDTLFFIFYHYQGTYEQFLAARELSINRDWQFNKKDRCWYYKE--IEKLPPGMNKSEE 476

Query: 262 GSYVFFDPQR-W--EKCQREFILFYN 284
            S+ +FD ++ W   +C  +F+  YN
Sbjct: 477 ESWRYFDYKKSWLARRCNSDFV--YN 500

>KLLA0B09196g Chr2 complement(803259..805031) [1773 bp, 590 aa] {ON}
           similar to uniprot|Q12514 Saccharomyces cerevisiae
           YPR072W NOT5 Subunit of global transcriptional regulator
          Length = 590

 Score = 40.0 bits (92), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 39/72 (54%), Gaps = 2/72 (2%)

Query: 200 VALFQDETLFYLFYKHPGTVIQELTYLELRKRNWRFHKILKTWLTKDPMMEPIVAADGFS 259
           ++ F  +TLF++FY + G+  Q L   EL  R W F+K+ + W  K+  +E +       
Sbjct: 499 MSKFALDTLFFIFYHYQGSYDQFLASRELSLRGWTFNKVNRCWFHKE--VEKLPPGIEGK 556

Query: 260 ERGSYVFFDPQR 271
           E  ++ +FD Q+
Sbjct: 557 EEVTWRYFDYQK 568

>Kpol_1070.25 s1070
           complement(58286..59491,59501..59509,59592..60437) [2061
           bp, 686 aa] {ON}
           complement(58286..59491,59501..59509,59592..60437) [2061
           nt, 687 aa]
          Length = 686

 Score = 35.0 bits (79), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 30/103 (29%), Positives = 52/103 (50%), Gaps = 9/103 (8%)

Query: 191 NNIELDQQRVAL--FQDETLFYLFYKH--PGTVIQ-ELTYLELRKRNWRFHKILKTWLTK 245
           +N   D+ R+ L  F+   +F LFY +  P T +Q +++ + L +R+W+  K    W  K
Sbjct: 543 DNTNEDKLRLVLERFRPTEIFTLFYHYYFPLTPLQKQISSILLIERDWKLLKNGTMWFLK 602

Query: 246 DPMMEPIVAADGFSERGSYVFFDPQRWEKCQR-EFILFYNAIM 287
               EP  + + F E G+Y  F    W   ++  F L +N++M
Sbjct: 603 --QGEPKFSNESF-EVGNYKIFKADDWTVIEKFNFKLDFNSLM 642

>KLTH0A03652g Chr1 (314336..316654) [2319 bp, 772 aa] {ON} some
           similarities with uniprot|P06102 Saccharomyces
           cerevisiae YIL038C NOT3 Subunit of the CCR4-NOT complex
           which is a global transcriptional regulator with roles
           in transcription initiation and elongation and in mRNA
           degradation
          Length = 772

 Score = 34.7 bits (78), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 21/38 (55%)

Query: 208 LFYLFYKHPGTVIQELTYLELRKRNWRFHKILKTWLTK 245
           LFY FY     + QE+ Y  L +RNW+  K  + W ++
Sbjct: 667 LFYCFYYSITPLEQEIAYTLLGERNWKVSKTGENWFSR 704

>NCAS0A11210 Chr1 (2223815..2225563) [1749 bp, 582 aa] {ON}
           Anc_3.370 YPR072W
          Length = 582

 Score = 33.5 bits (75), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 25/41 (60%), Gaps = 1/41 (2%)

Query: 203 FQDETLFYLFYKHPGTVIQELTYLEL-RKRNWRFHKILKTW 242
           F  +TLF++FY + GT  Q L   EL + R+W F+K+   W
Sbjct: 480 FDLDTLFFIFYHYQGTYDQFLAARELSQNRHWLFNKVDSCW 520

>ZYRO0D16302g Chr4 (1357223..1359712) [2490 bp, 829 aa] {ON} similar
           to uniprot|P06102 Saccharomyces cerevisiae YIL038C NOT3
           Subunit of the CCR4-NOT complex which is a global
           transcriptional regulator with roles in transcription
           initiation and elongation and in mRNA degradation
          Length = 829

 Score = 32.0 bits (71), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 28/115 (24%), Positives = 46/115 (40%), Gaps = 11/115 (9%)

Query: 180 VLQCNTTPPTFNNIELDQQRVALFQDE-------TLFYLFYKHPGTVIQELTYLELRKRN 232
           +L+C+  P   N+   DQ++     +        TLFY +Y     + QE+  + L +R+
Sbjct: 678 ILRCSLRPIIQNSELNDQEKYEAILENFRSLEMFTLFYNYYFAVTPLEQEIASIILSERD 737

Query: 233 WRFHKILKTWLTKDPMMEPIVAADGFSERGSYVFFDPQRWEKCQR-EFILFYNAI 286
           W+  K    W  +    +    A+   E   Y  F    W    R  F L Y A+
Sbjct: 738 WKVSKNCAMWFLRQSETK---FANELCEVADYKIFKLDDWTVIDRLNFKLDYAAL 789

>NCAS0A13350 Chr1 (2627917..2630319) [2403 bp, 800 aa] {ON}
           Anc_7.214 YIL038C
          Length = 800

 Score = 30.0 bits (66), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 18/66 (27%), Positives = 29/66 (43%), Gaps = 3/66 (4%)

Query: 207 TLFYLFYKHPGTVIQELTYLELRKRNWRFHKILKTWLTKDPMMEPIVAADGFSERGSYVF 266
           TLFY +Y     + +E++ + L +R+WR  K    W  +      +   + F E G Y  
Sbjct: 671 TLFYNYYFAVTPLEKEISNVILNERSWRISKDETLWFLR---QGSVKLQNEFCEIGDYKI 727

Query: 267 FDPQRW 272
           F    W
Sbjct: 728 FKLDDW 733

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.137    0.414 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 24,098,853
Number of extensions: 855733
Number of successful extensions: 4638
Number of sequences better than 10.0: 49
Number of HSP's gapped: 4657
Number of HSP's successfully gapped: 54
Length of query: 287
Length of database: 53,481,399
Length adjustment: 108
Effective length of query: 179
Effective length of database: 41,097,471
Effective search space: 7356447309
Effective search space used: 7356447309
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 65 (29.6 bits)