Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0E005007.346ON43743720920.0
Kpol_530.357.346ON42542314610.0
TDEL0C020207.346ON42541414530.0
CAGL0A03927g7.346ON43742914310.0
Skud_12.2667.346ON43641814310.0
Suva_10.2977.346ON43641914290.0
Smik_12.2617.346ON43643114280.0
TPHA0F029307.346ON43643514280.0
SAKL0F11286g7.346ON42341914220.0
YLR203C (MSS51)7.346ON43641814210.0
NCAS0E028807.346ON42942814200.0
KLTH0H01342g7.346ON42242813960.0
NDAI0E044807.346ON44343413890.0
Kwal_56.246317.346ON42242813870.0
KNAG0B026307.346ON43841013820.0
KLLA0D12430g7.346ON41841213730.0
ZYRO0F11616g7.346ON41541313720.0
Ecym_47277.346ON42942513630.0
KAFR0B008407.346ON42641113300.0
KNAG0C037507.346ON42440813220.0
NCAS0A141207.346ON42741413181e-180
NDAI0A019307.346ON45042912931e-176
ACL152W7.346ON42842512731e-174
Suva_15.943.144ON159113721.3
NDAI0B025903.144ON16450692.8
NCAS0B052203.144ON15829693.0
YOL071W (EMI5)3.144ON16222684.3
TDEL0D047903.144ON16350684.4
Smik_15.873.144ON15822674.5
SAKL0D14828g7.5ON59663704.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0E00500
         (437 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0E00500 Chr5 (91769..93082) [1314 bp, 437 aa] {ON} Anc_7.346...   810   0.0  
Kpol_530.35 s530 complement(83032..84309) [1278 bp, 425 aa] {ON}...   567   0.0  
TDEL0C02020 Chr3 complement(349453..350730) [1278 bp, 425 aa] {O...   564   0.0  
CAGL0A03927g Chr1 (397179..398492) [1314 bp, 437 aa] {ON} highly...   555   0.0  
Skud_12.266 Chr12 complement(497291..498601) [1311 bp, 436 aa] {...   555   0.0  
Suva_10.297 Chr10 complement(523465..524775) [1311 bp, 436 aa] {...   555   0.0  
Smik_12.261 Chr12 complement(497673..498983) [1311 bp, 436 aa] {...   554   0.0  
TPHA0F02930 Chr6 (647081..648391) [1311 bp, 436 aa] {ON} Anc_7.3...   554   0.0  
SAKL0F11286g Chr6 (880536..881807) [1272 bp, 423 aa] {ON} simila...   552   0.0  
YLR203C Chr12 complement(550650..551960) [1311 bp, 436 aa] {ON} ...   551   0.0  
NCAS0E02880 Chr5 complement(563006..564295) [1290 bp, 429 aa] {O...   551   0.0  
KLTH0H01342g Chr8 complement(125673..126941) [1269 bp, 422 aa] {...   542   0.0  
NDAI0E04480 Chr5 complement(1007346..1008677) [1332 bp, 443 aa] ...   539   0.0  
Kwal_56.24631 s56 (1080985..1082253) [1269 bp, 422 aa] {ON} YLR2...   538   0.0  
KNAG0B02630 Chr2 complement(508645..509961) [1317 bp, 438 aa] {O...   536   0.0  
KLLA0D12430g Chr4 complement(1055878..1057134) [1257 bp, 418 aa]...   533   0.0  
ZYRO0F11616g Chr6 (953577..954824) [1248 bp, 415 aa] {ON} simila...   533   0.0  
Ecym_4727 Chr4 complement(1420885..1422174) [1290 bp, 429 aa] {O...   529   0.0  
KAFR0B00840 Chr2 (159480..160760) [1281 bp, 426 aa] {ON} Anc_7.3...   516   0.0  
KNAG0C03750 Chr3 (740426..741700) [1275 bp, 424 aa] {ON} Anc_7.3...   513   0.0  
NCAS0A14120 Chr1 (2777017..2778300) [1284 bp, 427 aa] {ON} Anc_7...   512   e-180
NDAI0A01930 Chr1 complement(430531..431883) [1353 bp, 450 aa] {O...   502   e-176
ACL152W Chr3 (85701..86987) [1287 bp, 428 aa] {ON} Syntenic homo...   494   e-174
Suva_15.94 Chr15 (169308..169787) [480 bp, 159 aa] {ON} YOL071W ...    32   1.3  
NDAI0B02590 Chr2 complement(647421..647915) [495 bp, 164 aa] {ON...    31   2.8  
NCAS0B05220 Chr2 complement(970859..971335) [477 bp, 158 aa] {ON...    31   3.0  
YOL071W Chr15 (196507..196995) [489 bp, 162 aa] {ON}  EMI5Subuni...    31   4.3  
TDEL0D04790 Chr4 complement(876408..876899) [492 bp, 163 aa] {ON...    31   4.4  
Smik_15.87 Chr15 (160826..161302) [477 bp, 158 aa] {ON} YOL071W ...    30   4.5  
SAKL0D14828g Chr4 complement(1222126..1223916) [1791 bp, 596 aa]...    32   4.7  

>TBLA0E00500 Chr5 (91769..93082) [1314 bp, 437 aa] {ON} Anc_7.346
           YLR203C
          Length = 437

 Score =  810 bits (2092), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 393/437 (89%), Positives = 393/437 (89%)

Query: 1   MTLLYNTTKPILSKNIIACSNYSKRNLMGFVRSTLGLDXXXXXXXXXXENRFHPWETSPC 60
           MTLLYNTTKPILSKNIIACSNYSKRNLMGFVRSTLGLD          ENRFHPWETSPC
Sbjct: 1   MTLLYNTTKPILSKNIIACSNYSKRNLMGFVRSTLGLDPPPSPNDPTPENRFHPWETSPC 60

Query: 61  DDLRERAARIKTMAKCPVSNLDINYTCPISGIPTHHSRKEWEMDTNYHKNHIADILKKVN 120
           DDLRERAARIKTMAKCPVSNLDINYTCPISGIPTHHSRKEWEMDTNYHKNHIADILKKVN
Sbjct: 61  DDLRERAARIKTMAKCPVSNLDINYTCPISGIPTHHSRKEWEMDTNYHKNHIADILKKVN 120

Query: 121 IYEHDLRSGRPFPEFDFPREQEYDTVINLINWDLYFYTRNFFSMDTEFQLAAVTKMLSYP 180
           IYEHDLRSGRPFPEFDFPREQEYDTVINLINWDLYFYTRNFFSMDTEFQLAAVTKMLSYP
Sbjct: 121 IYEHDLRSGRPFPEFDFPREQEYDTVINLINWDLYFYTRNFFSMDTEFQLAAVTKMLSYP 180

Query: 181 MTIASVLHQFSPYSLTPKGPVTLEGLKSLAALRYXXXXXXXXXXXXXXXXXXXITATSKN 240
           MTIASVLHQFSPYSLTPKGPVTLEGLKSLAALRY                   ITATSKN
Sbjct: 181 MTIASVLHQFSPYSLTPKGPVTLEGLKSLAALRYTLNNNSLSDTSSGNSDSTTITATSKN 240

Query: 241 RPMRIFILGARAEAQLPPHVWKQLQYLFPNSNFEIHFIGPESLLSKDKSHYVTSTTPITK 300
           RPMRIFILGARAEAQLPPHVWKQLQYLFPNSNFEIHFIGPESLLSKDKSHYVTSTTPITK
Sbjct: 241 RPMRIFILGARAEAQLPPHVWKQLQYLFPNSNFEIHFIGPESLLSKDKSHYVTSTTPITK 300

Query: 301 RIDDSMSLVYHTDYFHVYHKAQXXXXXXXXXXXXXXXHPGLAATKETWLNETMQGLLDSK 360
           RIDDSMSLVYHTDYFHVYHKAQ               HPGLAATKETWLNETMQGLLDSK
Sbjct: 301 RIDDSMSLVYHTDYFHVYHKAQDFYPYDPYFDIFFMFHPGLAATKETWLNETMQGLLDSK 360

Query: 361 CPIFMTGFHEKDITADISVLNKNFSKDMDILMKPVKNVFGSTKWELNDSNPQEVYQFNMY 420
           CPIFMTGFHEKDITADISVLNKNFSKDMDILMKPVKNVFGSTKWELNDSNPQEVYQFNMY
Sbjct: 361 CPIFMTGFHEKDITADISVLNKNFSKDMDILMKPVKNVFGSTKWELNDSNPQEVYQFNMY 420

Query: 421 IAGYRGKRYHATETGKS 437
           IAGYRGKRYHATETGKS
Sbjct: 421 IAGYRGKRYHATETGKS 437

>Kpol_530.35 s530 complement(83032..84309) [1278 bp, 425 aa] {ON}
           complement(83032..84309) [1278 nt, 426 aa]
          Length = 425

 Score =  567 bits (1461), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 268/423 (63%), Positives = 321/423 (75%), Gaps = 13/423 (3%)

Query: 17  IACSNYS---KRNLMGFVRSTLGLDXXXXXXXXXXENRFHPWETSPCDDLRERAARIKTM 73
           +   +YS   KR+LMGFVR+ LGLD          ENRFHPW+ SPC DLRERAA+I+T+
Sbjct: 11  LGAGSYSLIQKRSLMGFVRNALGLDPPPSPDDPTPENRFHPWDQSPCVDLRERAAKIRTL 70

Query: 74  AKCPVSNLDINYTCPISGIPTHHSRKEWEMDTNYHKNHIADILKKVNIYEHDLRSGRPFP 133
           AKCPV++ DINYTCP+SGIPTHH ++ W MD +YH++   +ILKKVNIYEHDLRSGRPFP
Sbjct: 71  AKCPVTHKDINYTCPLSGIPTHHDKEAWLMDKDYHESKRYEILKKVNIYEHDLRSGRPFP 130

Query: 134 EFDFPREQEYDTVINLINWDLYFYTRNFFSMDTEFQLAAVTKMLSYPMTIASVLHQFSPY 193
           EFDFP++Q+YD +INL NWDL+FYTR+F+SMDTEFQLAAVTKMLSYP+TI S+LHQFSPY
Sbjct: 131 EFDFPQDQDYDRLINLTNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSLLHQFSPY 190

Query: 194 SLTPKGPVTLEGLKSLAALRYXXXXXXXXXXXXXXXXXXXITATSKNRPMRIFILGARAE 253
           SL PKGPVTLEGLKSLAALRY                   +   +++RPMRIFILGARAE
Sbjct: 191 SLNPKGPVTLEGLKSLAALRY--------TLYPYQNKSQNVKVNTRDRPMRIFILGARAE 242

Query: 254 AQLPPHVWKQLQYLFPNSNFEIHFIGPESLLSKDKSHYVTSTTPITKRIDDSMSLVYHTD 313
           AQLP HVWKQ QYLFP   FEIHFIGPE  L+K+K+ Y+TS+TPI K++DD++ LV+H D
Sbjct: 243 AQLPGHVWKQFQYLFPEQEFEIHFIGPECYLNKEKNQYITSSTPIVKKVDDTLKLVFHPD 302

Query: 314 YFHVYHKAQXXXXXXXXXXXXXXXHPGLA--ATKETWLNETMQGLLDSKCPIFMTGFHEK 371
           YFHV+H+AQ               HPG A   T E WL ETM+ LLD+KC IF TGF ++
Sbjct: 303 YFHVFHEAQDFFPYDPFLDVFFTFHPGYAYPETTEIWLGETMKALLDTKCAIFTTGFSKQ 362

Query: 372 DITADISVLNKNFSKDMDILMKPVKNVFGSTKWELNDSNPQEVYQFNMYIAGYRGKRYHA 431
           D+  DI V+   +  ++D+LM PVKNVFGSTKWELND NPQEVYQFNMYIAG+RGKRYHA
Sbjct: 363 DLLRDIDVVKNRYGNELDMLMDPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHA 422

Query: 432 TET 434
            E 
Sbjct: 423 IEV 425

>TDEL0C02020 Chr3 complement(349453..350730) [1278 bp, 425 aa] {ON}
           Anc_7.346 YLR203C
          Length = 425

 Score =  564 bits (1453), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 262/414 (63%), Positives = 317/414 (76%), Gaps = 13/414 (3%)

Query: 23  SKRNLMGFVRSTLGLDXXXXXXXXXXENRFHPWETSPCDDLRERAARIKTMAKCPVSNLD 82
            +R ++GFVR+ LGLD          ENRFHPW+ SP  DLRERAARI+T+A+CPV+  +
Sbjct: 23  QRRFIIGFVRNALGLDPPPSPDDPTPENRFHPWDQSPVGDLRERAARIRTLARCPVTGKE 82

Query: 83  INYTCPISGIPTHHSRKEWEMDTNYHKNHIADILKKVNIYEHDLRSGRPFPEFDFPREQE 142
           INYTCP+SGIPTHHSR+ WE D  YH++   +ILKKVNIYEHDLRSGRPFPEFDFP+ Q+
Sbjct: 83  INYTCPLSGIPTHHSREAWEQDKQYHQSKKYEILKKVNIYEHDLRSGRPFPEFDFPQGQD 142

Query: 143 YDTVINLINWDLYFYTRNFFSMDTEFQLAAVTKMLSYPMTIASVLHQFSPYSLTPKGPVT 202
           +D  +N+ NWDL+FYTR F+SMDTEFQLAAVTKMLSYP++IASVLHQFSPYSL PKGPVT
Sbjct: 143 FDRTVNMTNWDLFFYTRQFYSMDTEFQLAAVTKMLSYPISIASVLHQFSPYSLNPKGPVT 202

Query: 203 LEGLKSLAALRYXXXXXXXXXXXXXXXXXXXITATSKNRPMRIFILGARAEAQLPPHVWK 262
           LEGLKSLAALRY                     +++K+RPMRIFILGARAEAQLP HVWK
Sbjct: 203 LEGLKSLAALRYTLYPLENKT-----------ISSTKDRPMRIFILGARAEAQLPGHVWK 251

Query: 263 QLQYLFPNSNFEIHFIGPESLLSKDKSHYVTSTTPITKRIDDSMSLVYHTDYFHVYHKAQ 322
           QLQYLFP   FE+HF+GPE LL+K+K  YVTS+TP+ KR+D+++S VYHTD+FHV H+AQ
Sbjct: 252 QLQYLFPEQMFELHFVGPECLLNKEKHQYVTSSTPVVKRVDETISFVYHTDFFHVLHEAQ 311

Query: 323 XXXXXXXXXXXXXXXHPGLAA--TKETWLNETMQGLLDSKCPIFMTGFHEKDITADISVL 380
                          HPG  A  T  +WLNETM+GLL++KC IF TGF++ D+  D+  +
Sbjct: 312 DFFPYDPYLDVFFCFHPGFGAPETSASWLNETMKGLLETKCAIFTTGFNKADLLRDVDAV 371

Query: 381 NKNFSKDMDILMKPVKNVFGSTKWELNDSNPQEVYQFNMYIAGYRGKRYHATET 434
              + K++D+LM+PVKNVFGSTKWELND NPQEVYQFNMYIAG+RGKRYHA E 
Sbjct: 372 KDKYGKEVDVLMEPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHAIEV 425

>CAGL0A03927g Chr1 (397179..398492) [1314 bp, 437 aa] {ON} highly
           similar to uniprot|P32335 Saccharomyces cerevisiae
           YLR203c MSS51
          Length = 437

 Score =  555 bits (1431), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 268/429 (62%), Positives = 315/429 (73%), Gaps = 28/429 (6%)

Query: 18  ACSNYSKRNLMGFVRSTLGLDXXXXXXXXXXENRFHPWETSPCDDLRERAARIKTMAKCP 77
           AC   SKR LMGFVR+ LGLD          +NRFHPW+ SP  DLRERAARIKT+AKCP
Sbjct: 17  AC--VSKRQLMGFVRNALGLDPPPSPDEPTEQNRFHPWDQSPAVDLRERAARIKTLAKCP 74

Query: 78  VSNLDINYTCPISGIPTHHSRKEWEMDTNYHKNHIADILKKVNIYEHDLRSGRPFPEFDF 137
           V++  I YTCPISGIPTHHSR+ WE D  YH +   +ILKKVNIYEHDLRSGRPFPEFDF
Sbjct: 75  VTHKPIQYTCPISGIPTHHSREAWEQDKEYHASKKYEILKKVNIYEHDLRSGRPFPEFDF 134

Query: 138 PREQEYDTVINLINWDLYFYTRNFFSMDTEFQLAAVTKMLSYPMTIASVLHQFSPYSLTP 197
           PR+Q  D  +NL NWDL+ YTR+F+SMDTEFQLAAVTKMLSYP+TI SVLHQFSPYSL P
Sbjct: 135 PRDQGPDRTVNLTNWDLFLYTRSFYSMDTEFQLAAVTKMLSYPITIGSVLHQFSPYSLNP 194

Query: 198 KGPVTLEGLKSLAALRYXXXXXXXXXXXXXXXXXXXITATSKNRPMRIFILGARAEAQLP 257
           KGP+TLEGLKSLAALRY                   +T T+KN+PMRIFILGARAEAQLP
Sbjct: 195 KGPITLEGLKSLAALRY----------TLYPLQNRAVTTTAKNKPMRIFILGARAEAQLP 244

Query: 258 PHVWKQLQYLFPNSNFEIHFIGPESLLSKDKSHYV--------------TSTTPITKRID 303
            HVWKQLQ+LFP  NFEIHFIGPESL  ++++ Y+              TS+ P+TKRID
Sbjct: 245 GHVWKQLQFLFPQQNFEIHFIGPESLYDRERNEYIRSATANGETAADGTTSSIPVTKRID 304

Query: 304 DSMSLVYHTDYFHVYHKAQXXXXXXXXXXXXXXXHPGLAA--TKETWLNETMQGLLDSKC 361
           ++M   YHTDYFH  H AQ               HPGLA+  +K+TW+ +T++GLLD+KC
Sbjct: 305 ETMKFFYHTDYFHTLHTAQDFFPYDPYQDVFFMFHPGLASPESKDTWMKDTVKGLLDTKC 364

Query: 362 PIFMTGFHEKDITADISVLNKNFSKDMDILMKPVKNVFGSTKWELNDSNPQEVYQFNMYI 421
            IF TGF++KD+  DI +L   + K+MD+LM PVKNVFGSTKWEL+DS+P  VYQFNMYI
Sbjct: 365 AIFTTGFNKKDMADDIQILQDTYGKEMDMLMNPVKNVFGSTKWELDDSDPHSVYQFNMYI 424

Query: 422 AGYRGKRYH 430
           AG+RGKRYH
Sbjct: 425 AGFRGKRYH 433

>Skud_12.266 Chr12 complement(497291..498601) [1311 bp, 436 aa] {ON}
           YLR203C (REAL)
          Length = 436

 Score =  555 bits (1431), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 259/418 (61%), Positives = 315/418 (75%), Gaps = 12/418 (2%)

Query: 15  NIIACSNYSKRNLMGFVRSTLGLDXXXXXXXXXXENRFHPWETSPCDDLRERAARIKTMA 74
           N +   + ++R+LMGFVR+ LGLD          ENRFHPW+ SP  DLRERAA+I+T+A
Sbjct: 24  NRLVVYHQTRRHLMGFVRNALGLDPPPSPDDPTPENRFHPWDQSPSVDLRERAAKIRTLA 83

Query: 75  KCPVSNLDINYTCPISGIPTHHSRKEWEMDTNYHKNHIADILKKVNIYEHDLRSGRPFPE 134
            CPV+  DINYTCP+SGIPTHHSR+ WEMD  YH +   +ILKKVNIYEHDLRSGRPFPE
Sbjct: 84  HCPVTGKDINYTCPLSGIPTHHSREAWEMDKTYHDSKKYEILKKVNIYEHDLRSGRPFPE 143

Query: 135 FDFPREQEYDTVINLINWDLYFYTRNFFSMDTEFQLAAVTKMLSYPMTIASVLHQFSPYS 194
           FDFP++Q YD  +NL NWDL+FYTR+F+SMDTEFQLAAVTKMLSYP+TI SVLH+FSPYS
Sbjct: 144 FDFPQQQGYDKAVNLTNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSVLHKFSPYS 203

Query: 195 LTPKGPVTLEGLKSLAALRYXXXXXXXXXXXXXXXXXXXITATSKNRPMRIFILGARAEA 254
           L PKGP+TLEGLKSLAALRY                   + AT+KNR MRIFILGARAEA
Sbjct: 204 LNPKGPITLEGLKSLAALRY----------TLYPLENRSVLATTKNRAMRIFILGARAEA 253

Query: 255 QLPPHVWKQLQYLFPNSNFEIHFIGPESLLSKDKSHYVTSTTPITKRIDDSMSLVYHTDY 314
           QLP HVWKQLQ+LFP  NFEIHF+GPE L  +DK  YV S TP+ +R+D+++  ++HTD+
Sbjct: 254 QLPGHVWKQLQFLFPEQNFEIHFVGPECLYKRDKQEYVKSATPVVQRVDETLRFIHHTDF 313

Query: 315 FHVYHKAQXXXXXXXXXXXXXXXHPGLAATKE--TWLNETMQGLLDSKCPIFMTGFHEKD 372
           F V+H+AQ               HPG A+ +   +W+ ETM+ LL++KC IF TGF++KD
Sbjct: 314 FDVFHEAQDFFPYDPYMDVFFTFHPGYASPESHGSWMGETMRALLETKCAIFTTGFNKKD 373

Query: 373 ITADISVLNKNFSKDMDILMKPVKNVFGSTKWELNDSNPQEVYQFNMYIAGYRGKRYH 430
           +  DI+ +   + K+MDILM PV+NVFGSTKWELND NPQEVYQFNMYIAG+RGKRYH
Sbjct: 374 LMDDINAVKSKYGKEMDILMDPVRNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYH 431

>Suva_10.297 Chr10 complement(523465..524775) [1311 bp, 436 aa] {ON}
           YLR203C (REAL)
          Length = 436

 Score =  555 bits (1429), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 260/419 (62%), Positives = 315/419 (75%), Gaps = 12/419 (2%)

Query: 14  KNIIACSNYSKRNLMGFVRSTLGLDXXXXXXXXXXENRFHPWETSPCDDLRERAARIKTM 73
           +N +  S+ ++R+LMGFVR+ LGLD          ENRFHPW+ SP  DLRERAA+I+T+
Sbjct: 23  QNRLVVSHQTRRHLMGFVRNALGLDPPPSPDDPTPENRFHPWDQSPSVDLRERAAKIRTL 82

Query: 74  AKCPVSNLDINYTCPISGIPTHHSRKEWEMDTNYHKNHIADILKKVNIYEHDLRSGRPFP 133
           A CPV+  DINYTCP+SGIPTHHSR+ WEMD  YH +   +ILKKVNIYEHDLRSGRPFP
Sbjct: 83  AHCPVTGKDINYTCPLSGIPTHHSREAWEMDKAYHDSKKYEILKKVNIYEHDLRSGRPFP 142

Query: 134 EFDFPREQEYDTVINLINWDLYFYTRNFFSMDTEFQLAAVTKMLSYPMTIASVLHQFSPY 193
           EFDFP++Q YD  +NL NWDL+ YTR+F+SMDTEFQLAAVTKMLSYP+TI S+LH+FSPY
Sbjct: 143 EFDFPQQQGYDKAVNLTNWDLFLYTRSFYSMDTEFQLAAVTKMLSYPITIGSLLHKFSPY 202

Query: 194 SLTPKGPVTLEGLKSLAALRYXXXXXXXXXXXXXXXXXXXITATSKNRPMRIFILGARAE 253
           SL PKGP+TLEGLKSLAALRY                   + AT++NR MRIFILGARAE
Sbjct: 203 SLNPKGPITLEGLKSLAALRY----------TLYPLENRSVLATTRNRAMRIFILGARAE 252

Query: 254 AQLPPHVWKQLQYLFPNSNFEIHFIGPESLLSKDKSHYVTSTTPITKRIDDSMSLVYHTD 313
           AQLP HVWKQLQ+LFP  NFEIHFIGPE L  +DK  YV S TP+ +RID+++   +HTD
Sbjct: 253 AQLPGHVWKQLQFLFPEQNFEIHFIGPECLYKRDKQEYVKSATPVVQRIDETLKFFHHTD 312

Query: 314 YFHVYHKAQXXXXXXXXXXXXXXXHPGLAATKE--TWLNETMQGLLDSKCPIFMTGFHEK 371
           +F V+H+AQ               HPG A+ +   +W+ ETM  LL++KC IF TGF++K
Sbjct: 313 FFQVFHEAQDFFPYDPYMDVFFTFHPGYASPESHGSWMGETMTALLETKCAIFTTGFNKK 372

Query: 372 DITADISVLNKNFSKDMDILMKPVKNVFGSTKWELNDSNPQEVYQFNMYIAGYRGKRYH 430
           D+  DI+++   + K+MDILM PVKNVFGSTKWELND NPQEVYQFNMYIAG+RGKRYH
Sbjct: 373 DLMDDINLVKSKYGKEMDILMDPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYH 431

>Smik_12.261 Chr12 complement(497673..498983) [1311 bp, 436 aa] {ON}
           YLR203C (REAL)
          Length = 436

 Score =  554 bits (1428), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 266/431 (61%), Positives = 322/431 (74%), Gaps = 12/431 (2%)

Query: 2   TLLYNTTKPILSKNIIACSNYSKRNLMGFVRSTLGLDXXXXXXXXXXENRFHPWETSPCD 61
           T LY+      S N +  S+ ++R+LMGFVR+ LGLD          ENRFHPW+ SP  
Sbjct: 11  TQLYSHLLRRSSHNRLVLSHQTRRHLMGFVRNALGLDPPPSPDDPTPENRFHPWDQSPSV 70

Query: 62  DLRERAARIKTMAKCPVSNLDINYTCPISGIPTHHSRKEWEMDTNYHKNHIADILKKVNI 121
           DLRERAA+I+T+A CPV+  DINYTCP+SGIPTHHSR+ WEMD  YH +   +ILKKVNI
Sbjct: 71  DLRERAAKIRTLAHCPVTGKDINYTCPLSGIPTHHSREAWEMDKAYHDSKKYEILKKVNI 130

Query: 122 YEHDLRSGRPFPEFDFPREQEYDTVINLINWDLYFYTRNFFSMDTEFQLAAVTKMLSYPM 181
           YEHDLRSGRPFPEFDFP+ Q YD  +NL NWDL+FYTR+F+SMDTEFQLAAVTKMLSYP+
Sbjct: 131 YEHDLRSGRPFPEFDFPQNQGYDKAVNLTNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPI 190

Query: 182 TIASVLHQFSPYSLTPKGPVTLEGLKSLAALRYXXXXXXXXXXXXXXXXXXXITATSKNR 241
           TI S+LH+FSPYSL PKGP+TLEGLKSLAALRY                   +TAT KNR
Sbjct: 191 TIGSLLHKFSPYSLNPKGPITLEGLKSLAALRY---------TLYPLENRSLLTAT-KNR 240

Query: 242 PMRIFILGARAEAQLPPHVWKQLQYLFPNSNFEIHFIGPESLLSKDKSHYVTSTTPITKR 301
            MRIFILGARAEAQLP HVWKQLQ+LFP  NFEIHFIGPE L  +DK  YV STTP+ +R
Sbjct: 241 AMRIFILGARAEAQLPGHVWKQLQFLFPEQNFEIHFIGPECLYKRDKQEYVKSTTPVVQR 300

Query: 302 IDDSMSLVYHTDYFHVYHKAQXXXXXXXXXXXXXXXHPGLAATKE--TWLNETMQGLLDS 359
           +D+++  ++ TD+F V+H+AQ               HPG A+ +   +W+ ETM+ LL++
Sbjct: 301 VDETLKFIHRTDFFEVFHEAQDFFPYDPYMDVFFTFHPGYASPESHGSWMGETMKALLET 360

Query: 360 KCPIFMTGFHEKDITADISVLNKNFSKDMDILMKPVKNVFGSTKWELNDSNPQEVYQFNM 419
           KC IF TGF++KD+T D++++   + K+MDILM PVKNVFGSTKWELND NPQEVYQFNM
Sbjct: 361 KCAIFTTGFNKKDLTDDLNLVKSKYGKEMDILMDPVKNVFGSTKWELNDMNPQEVYQFNM 420

Query: 420 YIAGYRGKRYH 430
           YIAG+RGKRYH
Sbjct: 421 YIAGFRGKRYH 431

>TPHA0F02930 Chr6 (647081..648391) [1311 bp, 436 aa] {ON} Anc_7.346
           YLR203C
          Length = 436

 Score =  554 bits (1428), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 262/435 (60%), Positives = 325/435 (74%), Gaps = 12/435 (2%)

Query: 2   TLLYNTTKPILSKNII-ACSNYSKRNLMGFVRSTLGLDXXXXXXXXXXENRFHPWETSPC 60
           TL +  +  IL+KN + +  +  KR+LMGFV++ LGLD          ENRFHPW+ SP 
Sbjct: 10  TLRHPMSMNILNKNTLTSLPSSQKRSLMGFVKNALGLDPSPSPDDPTPENRFHPWDQSPS 69

Query: 61  DDLRERAARIKTMAKCPVSNLDINYTCPISGIPTHHSRKEWEMDTNYHKNHIADILKKVN 120
            DLRERAARI+T+AKCPV+  +INYTCP+SGIPTHHSR+ WE D +YH++   +ILKKVN
Sbjct: 70  PDLRERAARIRTLAKCPVTKKEINYTCPLSGIPTHHSREAWEADKDYHQSKRYEILKKVN 129

Query: 121 IYEHDLRSGRPFPEFDFPREQEYDTVINLINWDLYFYTRNFFSMDTEFQLAAVTKMLSYP 180
           IYEHDLRSGRPFPEFDFP +Q +D V+NL NWDL+FYTRNF+SMDTEFQLAAVTKMLSYP
Sbjct: 130 IYEHDLRSGRPFPEFDFPLDQIHDRVVNLTNWDLFFYTRNFYSMDTEFQLAAVTKMLSYP 189

Query: 181 MTIASVLHQFSPYSLTPKGPVTLEGLKSLAALRYXXXXXXXXXXXXXXXXXXXITATSKN 240
           MTI S+LHQFSPYSL PKGP+TLEGLKSLAALRY                   I+    +
Sbjct: 190 MTIGSILHQFSPYSLNPKGPITLEGLKSLAALRY---------SLYPFQRKSNISLKLHD 240

Query: 241 RPMRIFILGARAEAQLPPHVWKQLQYLFPNSNFEIHFIGPESLLSKDKSHYVTSTTPITK 300
           RPMRIFILGARAEAQLP HVWKQLQ+LFP+  FEIHFIG E LL+ +K+ Y+ S  P+ K
Sbjct: 241 RPMRIFILGARAEAQLPGHVWKQLQFLFPDQTFEIHFIGTECLLNNEKNKYIKSAIPVVK 300

Query: 301 RIDDSMSLVYHTDYFHVYHKAQXXXXXXXXXXXXXXXHPGLAA--TKETWLNETMQGLLD 358
           +ID++M L+YH+DYFHVYH+AQ               HPG AA  T + W+ +TM+ LL+
Sbjct: 301 KIDETMKLIYHSDYFHVYHEAQDFVPYDPYLDVFFTFHPGFAAPETSDLWMGDTMKALLE 360

Query: 359 SKCPIFMTGFHEKDITADISVLNKNFSKDMDILMKPVKNVFGSTKWELNDSNPQEVYQFN 418
           +KC IF TGF+++DIT D+ ++   + K+MD LM P+KN +GSTKWELND NPQE++QFN
Sbjct: 361 TKCAIFTTGFNKQDITNDVEIVKARYGKEMDTLMDPIKNSYGSTKWELNDMNPQEIFQFN 420

Query: 419 MYIAGYRGKRYHATE 433
           MY+AG+RGKRYH  +
Sbjct: 421 MYVAGFRGKRYHTIK 435

>SAKL0F11286g Chr6 (880536..881807) [1272 bp, 423 aa] {ON} similar
           to uniprot|P32335 Saccharomyces cerevisiae YLR203C MSS51
           Protein required for the maturation and translation of
           COX1 mRNA involved in maturation of COX1 and COB mRNA
          Length = 423

 Score =  552 bits (1422), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 253/419 (60%), Positives = 317/419 (75%), Gaps = 12/419 (2%)

Query: 18  ACSNYSKRNLMGFVRSTLGLDXXXXXXXXXXENRFHPWETSPCDDLRERAARIKTMAKCP 77
           + +   KR+++GFVR+ LGLD          +NRFHPW+ SP  DLR RAA I+ +A+CP
Sbjct: 15  SATRIQKRHIIGFVRNALGLDPPPSPDDPTPDNRFHPWDQSPSPDLRTRAATIRALARCP 74

Query: 78  VSNLDINYTCPISGIPTHHSRKEWEMDTNYHKNHIADILKKVNIYEHDLRSGRPFPEFDF 137
           V+  +INYTCP SGIPTHHSR+ WE DT YH     +ILKKVNIYEHDLRSGRPFPEFDF
Sbjct: 75  VTGKEINYTCPQSGIPTHHSREAWEQDTMYHATKKYEILKKVNIYEHDLRSGRPFPEFDF 134

Query: 138 PREQEYDTVINLINWDLYFYTRNFFSMDTEFQLAAVTKMLSYPMTIASVLHQFSPYSLTP 197
           P++Q+YD ++N+ NWDL+FYTR F+SMDTEFQLAAVTKMLSYP T+ SVLH+FSPY+L P
Sbjct: 135 PQDQDYDRMVNMTNWDLFFYTRQFYSMDTEFQLAAVTKMLSYPTTVGSVLHEFSPYALNP 194

Query: 198 KGPVTLEGLKSLAALRYXXXXXXXXXXXXXXXXXXXITATSKNRPMRIFILGARAEAQLP 257
           KGP+TLEGLKSLAALRY                   ++A +K+RPMRIFILGARAEAQLP
Sbjct: 195 KGPITLEGLKSLAALRY----------TLYPQQHRKVSAATKDRPMRIFILGARAEAQLP 244

Query: 258 PHVWKQLQYLFPNSNFEIHFIGPESLLSKDKSHYVTSTTPITKRIDDSMSLVYHTDYFHV 317
            HVWKQ Q+LFP  NFE+HFIGPES   ++K  Y+TS+TPI +R+D+++S VYHTDYFHV
Sbjct: 245 GHVWKQFQFLFPEINFELHFIGPESFYDREKREYITSSTPIVRRVDETLSFVYHTDYFHV 304

Query: 318 YHKAQXXXXXXXXXXXXXXXHPGLAATKET--WLNETMQGLLDSKCPIFMTGFHEKDITA 375
           +H+AQ               HPG AA + T  W+ +TM+GLL++KC IF TGF+E+D+  
Sbjct: 305 FHEAQDFFPYDPYLDIFFCFHPGFAAPESTEHWMGKTMEGLLETKCAIFTTGFNEQDLVR 364

Query: 376 DISVLNKNFSKDMDILMKPVKNVFGSTKWELNDSNPQEVYQFNMYIAGYRGKRYHATET 434
           D++ + + +  +MD+LM+PV+N+FGSTKWELND NPQEVYQFNMYIAG+RGKRYHA E 
Sbjct: 365 DMTAVREKYGNEMDMLMEPVRNLFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHAIEV 423

>YLR203C Chr12 complement(550650..551960) [1311 bp, 436 aa] {ON}
           MSS51Specific translational activator for the
           mitochondrial COX1 mRNA; loosely associated with the
           matrix face of the mitochondrial inner membrane;
           influences both COX1 mRNA translation and Cox1p assembly
           into cytochrome c oxidase
          Length = 436

 Score =  551 bits (1421), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 258/418 (61%), Positives = 318/418 (76%), Gaps = 12/418 (2%)

Query: 15  NIIACSNYSKRNLMGFVRSTLGLDXXXXXXXXXXENRFHPWETSPCDDLRERAARIKTMA 74
           N +  S+ ++R+LMGFVR+ LGLD          ENRFHPW+ SP  DLRERAA+I+T+A
Sbjct: 24  NRLVVSHQTRRHLMGFVRNALGLDPPPSPEDPTPENRFHPWDQSPSVDLRERAAKIRTLA 83

Query: 75  KCPVSNLDINYTCPISGIPTHHSRKEWEMDTNYHKNHIADILKKVNIYEHDLRSGRPFPE 134
            CPV+  DINYTCP+SGIPTHHSR+ WEMD  YH +   +ILKKVNIYEHDLRSGRPFPE
Sbjct: 84  HCPVTGKDINYTCPLSGIPTHHSREAWEMDKAYHDSKKYEILKKVNIYEHDLRSGRPFPE 143

Query: 135 FDFPREQEYDTVINLINWDLYFYTRNFFSMDTEFQLAAVTKMLSYPMTIASVLHQFSPYS 194
           FDFP++Q YD  +NL NWDL+FYTR+F+SMDTEFQLAAVTKMLSYP+TI S+LH+FSPYS
Sbjct: 144 FDFPQQQGYDKAVNLTNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSLLHKFSPYS 203

Query: 195 LTPKGPVTLEGLKSLAALRYXXXXXXXXXXXXXXXXXXXITATSKNRPMRIFILGARAEA 254
           L PKGP+TLEGLKSLAALRY                   +  T+KNR MRIFILGARAEA
Sbjct: 204 LNPKGPITLEGLKSLAALRY----------TLYPLENRSLPTTTKNRAMRIFILGARAEA 253

Query: 255 QLPPHVWKQLQYLFPNSNFEIHFIGPESLLSKDKSHYVTSTTPITKRIDDSMSLVYHTDY 314
           QLP HVWKQLQ+LFP  +FEIHFIGPE L  +DK  YV STTP+ +R+D+++  +Y T++
Sbjct: 254 QLPGHVWKQLQFLFPEQSFEIHFIGPECLYKRDKQEYVKSTTPVVQRVDETLKFIYRTNF 313

Query: 315 FHVYHKAQXXXXXXXXXXXXXXXHPGLAATKE--TWLNETMQGLLDSKCPIFMTGFHEKD 372
           F V+H+AQ               HPG A+ +   +W+ ETM+ LL++KC IF TGF++KD
Sbjct: 314 FEVFHEAQDFFPYDPYMDVFFTFHPGYASPESHGSWMGETMKALLETKCAIFTTGFNKKD 373

Query: 373 ITADISVLNKNFSKDMDILMKPVKNVFGSTKWELNDSNPQEVYQFNMYIAGYRGKRYH 430
           +T DI+++   + K+MD+LM+PV+NVFGSTKWELND NPQEVYQFNMYIAG+RGKRYH
Sbjct: 374 LTDDINLVKSKYGKEMDVLMEPVRNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYH 431

>NCAS0E02880 Chr5 complement(563006..564295) [1290 bp, 429 aa] {ON}
           Anc_7.346 YLR203C
          Length = 429

 Score =  551 bits (1420), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 262/428 (61%), Positives = 315/428 (73%), Gaps = 14/428 (3%)

Query: 4   LYNTTKPILSKNIIACSNYSKRNLMGFVRSTLGLDXXXXXXXXXXENRFHPWETSPCDDL 63
           +Y TT  +L +N    +    R+LMGFVR+ LGLD          ENRFHPW+ SP  DL
Sbjct: 9   VYRTT--LLPRNAFNVAGNQTRHLMGFVRNALGLDPPTSPDDPTPENRFHPWDQSPSPDL 66

Query: 64  RERAARIKTMAKCPVSNLDINYTCPISGIPTHHSRKEWEMDTNYHKNHIADILKKVNIYE 123
           RERAARI+T+A+CPV+  +INYTCPISGIPTHHSR+ WE D  YH +   ++LKKVNIYE
Sbjct: 67  RERAARIRTLARCPVTGKEINYTCPISGIPTHHSREAWEQDKEYHASKRYELLKKVNIYE 126

Query: 124 HDLRSGRPFPEFDFPREQEYDTVINLINWDLYFYTRNFFSMDTEFQLAAVTKMLSYPMTI 183
           HDLRSGRPFPEFDFPR+Q  D ++N+ NWDL+ YTR F+SMDTEFQ+AAVTKMLSYP+TI
Sbjct: 127 HDLRSGRPFPEFDFPRDQGQDRMVNMTNWDLFLYTRAFYSMDTEFQMAAVTKMLSYPITI 186

Query: 184 ASVLHQFSPYSLTPKGPVTLEGLKSLAALRYXXXXXXXXXXXXXXXXXXXITATSKNRPM 243
            SVLHQFSPYSL PKGP++LEGLKSLAALRY                   + +T+K RPM
Sbjct: 187 GSVLHQFSPYSLQPKGPISLEGLKSLAALRY----------TLYPMQNRLVISTTKARPM 236

Query: 244 RIFILGARAEAQLPPHVWKQLQYLFPNSNFEIHFIGPESLLSKDKSHYVTSTTPITKRID 303
           RIFILGARAE+QLP HVWKQLQYLFP   FEIHFIGPES   KDK  Y+  TTPIT+ +D
Sbjct: 237 RIFILGARAESQLPGHVWKQLQYLFPEQTFEIHFIGPESYYDKDKKKYIQLTTPITESVD 296

Query: 304 DSMSLVYHTDYFHVYHKAQXXXXXXXXXXXXXXXHPGLAATK--ETWLNETMQGLLDSKC 361
           +++ L+YHT+YFH  H+AQ               HPG A+ +  E W+ +TM+GLLD+KC
Sbjct: 297 ETLKLIYHTEYFHKLHEAQDFFPYDPYMDVFFIFHPGFASAEIGEHWMKDTMKGLLDTKC 356

Query: 362 PIFMTGFHEKDITADISVLNKNFSKDMDILMKPVKNVFGSTKWELNDSNPQEVYQFNMYI 421
            IF TGF + D+  DI+V+   + K++DILMKP KNVFGSTKWELND NPQEVYQFNMYI
Sbjct: 357 AIFTTGFTKNDLLEDIAVVQDKYGKELDILMKPTKNVFGSTKWELNDMNPQEVYQFNMYI 416

Query: 422 AGYRGKRY 429
           AG+RGKRY
Sbjct: 417 AGFRGKRY 424

>KLTH0H01342g Chr8 complement(125673..126941) [1269 bp, 422 aa] {ON}
           similar to uniprot|P32335 Saccharomyces cerevisiae
           YLR203C MSS51 Protein required for the maturation and
           translation of COX1 mRNA involved in maturation of COX1
           and COB mRNA
          Length = 422

 Score =  542 bits (1396), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 257/428 (60%), Positives = 319/428 (74%), Gaps = 14/428 (3%)

Query: 11  ILSKNII-ACS-NYSKRNLMGFVRSTLGLDXXXXXXXXXXENRFHPWETSPCDDLRERAA 68
           ILS+N + +C  N  KR++MGFVR+ LGLD          ENRFHPW+ SP  DLRERAA
Sbjct: 5   ILSRNTVRSCQHNVQKRHIMGFVRNALGLDPPPSPDEPTPENRFHPWDQSPSPDLRERAA 64

Query: 69  RIKTMAKCPVSNLDINYTCPISGIPTHHSRKEWEMDTNYHKNHIADILKKVNIYEHDLRS 128
            I+ +AKCPV+  +INYTCP SGIPTH+SR+ WE D  Y ++   +ILKKVNIYEHDLRS
Sbjct: 65  TIRALAKCPVTGREINYTCPKSGIPTHYSREAWENDLEYQQSKRPEILKKVNIYEHDLRS 124

Query: 129 GRPFPEFDFPREQEYDTVINLINWDLYFYTRNFFSMDTEFQLAAVTKMLSYPMTIASVLH 188
           GRPFPEFDFP +Q++D ++NL NWDL+FYTR F+SMDTEFQLAAVTKMLSYP+TI SVLH
Sbjct: 125 GRPFPEFDFPLDQDFDRMVNLTNWDLFFYTRGFYSMDTEFQLAAVTKMLSYPVTIGSVLH 184

Query: 189 QFSPYSLTPKGPVTLEGLKSLAALRYXXXXXXXXXXXXXXXXXXXITATSKNRPMRIFIL 248
           QFSPYSL PKGPVTLEGLKSLAALRY                   +T+ +KN P+RIFIL
Sbjct: 185 QFSPYSLNPKGPVTLEGLKSLAALRY----------TLYPEQNRRVTSITKNSPLRIFIL 234

Query: 249 GARAEAQLPPHVWKQLQYLFPNSNFEIHFIGPESLLSKDKSHYVTSTTPITKRIDDSMSL 308
           GARAEAQLP HVWKQLQ++FP +N E+HF+GPES   ++K  YV S++PI +R+D+++S 
Sbjct: 235 GARAEAQLPGHVWKQLQFMFPETNIELHFVGPESYYDRNKREYVHSSSPIVRRVDETLSF 294

Query: 309 VYHTDYFHVYHKAQXXXXXXXXXXXXXXXHPGLAA--TKETWLNETMQGLLDSKCPIFMT 366
           VYHTDYFHV+H+AQ               HPG AA  ++E W+ +TM+ LL++KC +F T
Sbjct: 295 VYHTDYFHVFHEAQDFFPYDPYTDIFFCFHPGFAAPESRENWMGKTMEALLETKCAVFTT 354

Query: 367 GFHEKDITADISVLNKNFSKDMDILMKPVKNVFGSTKWELNDSNPQEVYQFNMYIAGYRG 426
           GF+E D+  D+  +     K++D+LM+PV N FGSTKWELND NPQEVYQFNM+IAG+RG
Sbjct: 355 GFNELDLRRDVGTVVGKHGKELDMLMEPVHNAFGSTKWELNDMNPQEVYQFNMFIAGFRG 414

Query: 427 KRYHATET 434
           KRYHA E 
Sbjct: 415 KRYHAIEV 422

>NDAI0E04480 Chr5 complement(1007346..1008677) [1332 bp, 443 aa]
           {ON} Anc_7.346 YLR203C
          Length = 443

 Score =  539 bits (1389), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 256/434 (58%), Positives = 315/434 (72%), Gaps = 12/434 (2%)

Query: 2   TLLYNTTKPILSKNIIACSNYSKRNLMGFVRSTLGLDXXXXXXXXXXENRFHPWETSPCD 61
           T L  T  P   +N    S++S R+LMGFVR+ LGLD          ENRFHPW+ SPC 
Sbjct: 19  TTLCFTPNPRNFRNNAHVSHHSSRSLMGFVRNALGLDPKSSPDDPTPENRFHPWDQSPCQ 78

Query: 62  DLRERAARIKTMAKCPVSNLDINYTCPISGIPTHHSRKEWEMDTNYHKNHIADILKKVNI 121
           DLRERAA+I+T+A CPV+N +INYTCPISGIPTHHS+  WEMD NYH N I +ILKKVNI
Sbjct: 79  DLRERAAKIRTLAHCPVTNKEINYTCPISGIPTHHSKNAWEMDENYHSNKIYEILKKVNI 138

Query: 122 YEHDLRSGRPFPEFDFPREQEYDTVINLINWDLYFYTRNFFSMDTEFQLAAVTKMLSYPM 181
           YEHDLRSGRPFPEF FP++Q++D +IN+ NWDL+ YTR+F+SMDTEFQ+AAVTKMLSYP+
Sbjct: 139 YEHDLRSGRPFPEFVFPQDQDFDRMINMTNWDLFLYTRSFYSMDTEFQMAAVTKMLSYPI 198

Query: 182 TIASVLHQFSPYSLTPKGPVTLEGLKSLAALRYXXXXXXXXXXXXXXXXXXXITATSKNR 241
           TI S+LHQFSPYSL PKGP+TLEGLKS+AALRY                       +KNR
Sbjct: 199 TIGSILHQFSPYSLQPKGPITLEGLKSMAALRY----------TLYPFHNKSFMTLTKNR 248

Query: 242 PMRIFILGARAEAQLPPHVWKQLQYLFPNSNFEIHFIGPESLLSKDKSHYVTSTTPITKR 301
           PMRIF+LGARAEAQLP H+WKQLQYLFP   FE+ FIGPE+   K+K  Y+    P+ + 
Sbjct: 249 PMRIFLLGARAEAQLPGHIWKQLQYLFPEQKFELFFIGPEAYYDKEKKQYLKLDKPLIQT 308

Query: 302 IDDSMSLVYHTDYFHVYHKAQXXXXXXXXXXXXXXXHPGLAA--TKETWLNETMQGLLDS 359
           IDD++ L + T+YFH  H++Q               HPG +A  T E W+N+TM+ LL++
Sbjct: 309 IDDTLKLTFITEYFHTLHESQDLFPYDPYMDVFFIFHPGFSAIETTEHWMNDTMKSLLET 368

Query: 360 KCPIFMTGFHEKDITADISVLNKNFSKDMDILMKPVKNVFGSTKWELNDSNPQEVYQFNM 419
           +C IF TGF   D+  D+++L++ +  D+DILMKPVKNVFGSTKWELND NPQ+VYQFNM
Sbjct: 369 QCAIFNTGFSRNDMLNDMNILDEKYKNDLDILMKPVKNVFGSTKWELNDLNPQDVYQFNM 428

Query: 420 YIAGYRGKRYHATE 433
           YIAG+RGKRY   E
Sbjct: 429 YIAGFRGKRYPTVE 442

>Kwal_56.24631 s56 (1080985..1082253) [1269 bp, 422 aa] {ON} YLR203C
           (MSS51) - involved in maturation of COX1 and COB mRNA
           [contig 161] FULL
          Length = 422

 Score =  538 bits (1387), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 254/428 (59%), Positives = 317/428 (74%), Gaps = 14/428 (3%)

Query: 11  ILSKNIIACSNYS--KRNLMGFVRSTLGLDXXXXXXXXXXENRFHPWETSPCDDLRERAA 68
           IL+++ +  S+ S  KR++MGFVR+ LGLD          ENRFHPW+ SP  DLRERAA
Sbjct: 5   ILNRSSLRNSHCSLQKRHIMGFVRNALGLDPPPSPDEPTPENRFHPWDQSPSPDLRERAA 64

Query: 69  RIKTMAKCPVSNLDINYTCPISGIPTHHSRKEWEMDTNYHKNHIADILKKVNIYEHDLRS 128
            I+ +AKCPV+  +INYTCP SGIPTHHSR+ WE D +Y ++   +ILKKVNIYEHDLRS
Sbjct: 65  TIRALAKCPVTGREINYTCPKSGIPTHHSREAWEKDLDYQQSKRPEILKKVNIYEHDLRS 124

Query: 129 GRPFPEFDFPREQEYDTVINLINWDLYFYTRNFFSMDTEFQLAAVTKMLSYPMTIASVLH 188
           GRPFPEFDFP +Q++D ++NL NWDL+FYTR FFSMDTEFQLAAVTKMLSYP+TI SVLH
Sbjct: 125 GRPFPEFDFPLDQDFDRMVNLTNWDLFFYTRGFFSMDTEFQLAAVTKMLSYPITIGSVLH 184

Query: 189 QFSPYSLTPKGPVTLEGLKSLAALRYXXXXXXXXXXXXXXXXXXXITATSKNRPMRIFIL 248
           QFSPYSL PKGP+TLEGLKSLAALRY                   +T+ +KN P+RIF+L
Sbjct: 185 QFSPYSLNPKGPITLEGLKSLAALRY----------TLYPDQNRRVTSIAKNSPLRIFVL 234

Query: 249 GARAEAQLPPHVWKQLQYLFPNSNFEIHFIGPESLLSKDKSHYVTSTTPITKRIDDSMSL 308
           GARAEAQLP HVWKQLQ++FP +  EIHF+GPES   ++K  YV S  PI +R+D++++ 
Sbjct: 235 GARAEAQLPGHVWKQLQFMFPETQMEIHFVGPESYYDRNKREYVHSAAPIIRRVDETLNF 294

Query: 309 VYHTDYFHVYHKAQXXXXXXXXXXXXXXXHPGLAA--TKETWLNETMQGLLDSKCPIFMT 366
           VYHTDYFHV+H+AQ               HPG AA  ++E W+ +TM+ LL++KC IF T
Sbjct: 295 VYHTDYFHVFHEAQDFFPYDPYTDIFFCFHPGFAAPESRENWMGKTMEALLETKCAIFTT 354

Query: 367 GFHEKDITADISVLNKNFSKDMDILMKPVKNVFGSTKWELNDSNPQEVYQFNMYIAGYRG 426
           GF+E D+  D+  +   + K++DI+M P KN FGSTKWELND NPQEVYQFNM++AG+RG
Sbjct: 355 GFNEVDLQRDLDAVVAEYGKELDIIMDPAKNAFGSTKWELNDVNPQEVYQFNMFMAGFRG 414

Query: 427 KRYHATET 434
           KRYHA E 
Sbjct: 415 KRYHAIEV 422

>KNAG0B02630 Chr2 complement(508645..509961) [1317 bp, 438 aa] {ON}
           Anc_7.346 YLR203C
          Length = 438

 Score =  536 bits (1382), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 249/410 (60%), Positives = 302/410 (73%), Gaps = 4/410 (0%)

Query: 23  SKRNLMGFVRSTLGLDXXXXXXXXXXENRFHPWETSPCDDLRERAARIKTMAKCPVSNLD 82
           ++R LMGFVR+ LGL+          ENRFHPW+ SP D LRERAARIKT+AKCPV+ L+
Sbjct: 27  ARRQLMGFVRNALGLEPPPSPMDPTPENRFHPWDQSPVDALRERAARIKTLAKCPVTGLN 86

Query: 83  INYTCPISGIPTHHSRKEWEMDTNYHKNHIADILKKVNIYEHDLRSGRPFPEFDFPREQE 142
           + YTCP+SGIPTHHSR+ WE DT YH     + LKKVNIYEHDLRSGRPFPEFDFP+EQ 
Sbjct: 87  VEYTCPLSGIPTHHSREAWEQDTQYHATKRYETLKKVNIYEHDLRSGRPFPEFDFPQEQG 146

Query: 143 YDTVINLINWDLYFYTRNFFSMDTEFQLAAVTKMLSYPMTIASVLHQFSPYSLTPKGPVT 202
           YD V+N+ NWDL+FYTR F+SMDTEFQLAAVTKMLSYP+TIAS+L QFSPYSL PKGP+T
Sbjct: 147 YDKVVNMTNWDLFFYTRGFYSMDTEFQLAAVTKMLSYPVTIASLLAQFSPYSLNPKGPIT 206

Query: 203 LEGLKSLAALRYXXXXXXXXXXXXXXXXXXXITATSKNRPMRIFILGARAEAQLPPHVWK 262
           LEGLKSLAA+RY                        KNRPMR+F+LGARAEAQLP HVWK
Sbjct: 207 LEGLKSLAAVRY--TLYSQSFNNSARAGGVTTGGALKNRPMRLFVLGARAEAQLPGHVWK 264

Query: 263 QLQYLFPNSNFEIHFIGPESLLSKDKSHYVTSTTPITKRIDDSMSLVYHTDYFHVYHKAQ 322
           QL YLFP  +FE+ FIGPES   + +  YV S TP+ +++D+++  +++TDYFHV H++Q
Sbjct: 265 QLSYLFPEQSFEMVFIGPESYYDRARGQYVRSPTPVVEKVDETLKFIHYTDYFHVLHESQ 324

Query: 323 XXXXXXXXXXXXXXXHPGLAA--TKETWLNETMQGLLDSKCPIFMTGFHEKDITADISVL 380
                          HPG A+   ++TWL+ T+  LLD+KC IF TGF   D+  D+++L
Sbjct: 325 DFFPYDPYFDCFFTFHPGFASPENRDTWLSNTLPALLDTKCAIFTTGFDRDDLMNDVALL 384

Query: 381 NKNFSKDMDILMKPVKNVFGSTKWELNDSNPQEVYQFNMYIAGYRGKRYH 430
           N+ F  +MDILM+P KNVFGSTKWELND NP EVYQFNMYIAG+RGKRYH
Sbjct: 385 NEKFGSEMDILMEPTKNVFGSTKWELNDLNPHEVYQFNMYIAGFRGKRYH 434

>KLLA0D12430g Chr4 complement(1055878..1057134) [1257 bp, 418 aa]
           {ON} similar to uniprot|P32335 Saccharomyces cerevisiae
           YLR203C MSS51 Protein required for the maturation and
           translation of COX1 mRNA involved in maturation of COX1
           and COB mRNA
          Length = 418

 Score =  533 bits (1373), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 250/412 (60%), Positives = 307/412 (74%), Gaps = 14/412 (3%)

Query: 25  RNLMGFVRSTLGLDXXXXXXXXXXENRFHPWETSPCDDLRERAARIKTMAKCPVSNLDIN 84
           R +MGFVR+ LGLD          ENRFHPW+ SP  DLRERAARIK MA CPV++ DI 
Sbjct: 17  RPIMGFVRNALGLDPPASPDDPTPENRFHPWDQSPSPDLRERAARIKAMATCPVTHKDIQ 76

Query: 85  YTCPISGIPTHHSRKEWEMDTNYHKNHIADILKKVNIYEHDLRSGRPFPEFDFPREQEYD 144
           +TCP+SGIPTHHSR+ WE DT YHK+   ++LKKVNIYEHDLRSGRPFPEFDFP++Q+YD
Sbjct: 77  FTCPLSGIPTHHSREAWEKDTEYHKSKRYELLKKVNIYEHDLRSGRPFPEFDFPQDQDYD 136

Query: 145 TVINLINWDLYFYTRNFFSMDTEFQLAAVTKMLSYPMTIASVLHQFSPYSLTPKGPVTLE 204
            ++N+ NWDL+FYTR+F+SMDTEFQLAAVTKMLSYP+TI SVLHQ+SPYSL PKGP+TLE
Sbjct: 137 RMVNMSNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSVLHQYSPYSLNPKGPITLE 196

Query: 205 GLKSLAALRYXXXXXXXXXXXXXXXXXXXITATSKNRPMRIFILGARAEAQLPPHVWKQL 264
           GLKSLAALRY                        ++ P+RIFILG RAEAQLP HVWKQL
Sbjct: 197 GLKSLAALRYTLYPEQSGRFR-----------AGQDTPIRIFILGTRAEAQLPGHVWKQL 245

Query: 265 QYLFPNSNFEIHFIGPESLLSKDKSHYVTSTTP-ITKRIDDSMSLVYHTDYFHVYHKAQX 323
           QYL P+++ E+HF+GPES   ++K  YV S+T  I KRID+ M L YHTD+FHV+H+AQ 
Sbjct: 246 QYLIPDTSIELHFVGPESFYDREKRSYVQSSTETIVKRIDEKMQLFYHTDFFHVFHEAQD 305

Query: 324 XXXXXXXXXXXXXXHPGLAA--TKETWLNETMQGLLDSKCPIFMTGFHEKDITADISVLN 381
                         HPG AA  T+E W+ +TM+ L+ +KC +F TGF ++D+  DIS++ 
Sbjct: 306 FFPYDPYNDVFFCFHPGFAAPETEEYWMGDTMKALMQTKCAVFTTGFSKEDLLRDISIVQ 365

Query: 382 KNFSKDMDILMKPVKNVFGSTKWELNDSNPQEVYQFNMYIAGYRGKRYHATE 433
             +  ++D+LM+PV NVFGSTKWELND+NP EVYQFNMYIAG+RGKRYHA E
Sbjct: 366 DKYGSELDMLMEPVPNVFGSTKWELNDTNPHEVYQFNMYIAGFRGKRYHAIE 417

>ZYRO0F11616g Chr6 (953577..954824) [1248 bp, 415 aa] {ON} similar
           to uniprot|P32335 Saccharomyces cerevisiae YLR203C MSS51
           Protein required for the maturation and translation of
           COX1 mRNA involved in maturation of COX1 and COB mRNA
          Length = 415

 Score =  533 bits (1372), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 251/413 (60%), Positives = 308/413 (74%), Gaps = 13/413 (3%)

Query: 23  SKRNLMGFVRSTLGLDXXXXXXXXXXENRFHPWETSPCDDLRERAARIKTMAKCPVSNLD 82
            +R ++GFVR+ LGLD          ENRFH W+ SP  DLRERAARI+ +A+CPV+  +
Sbjct: 13  QRRTIIGFVRNALGLDPPPSPDDPTPENRFHLWDQSPAGDLRERAARIRALAQCPVTGKE 72

Query: 83  INYTCPISGIPTHHSRKEWEMDTNYHKNHIADILKKVNIYEHDLRSGRPFPEFDFPREQE 142
           INYTCP+SGIPTHHS++ WE D  YH++   ++LKKVNIYEHDLRSGRPFPEFDFP++ E
Sbjct: 73  INYTCPLSGIPTHHSKEAWEQDKKYHESKKWELLKKVNIYEHDLRSGRPFPEFDFPQDLE 132

Query: 143 YDTVINLINWDLYFYTRNFFSMDTEFQLAAVTKMLSYPMTIASVLHQFSPYSLTPKGPVT 202
           +D  +N+ NWDL+FYTR F+SMDTEFQLAAVTKMLSYP+TIASVL+QFSPYSL PKGP+T
Sbjct: 133 FDRTVNMTNWDLFFYTRQFYSMDTEFQLAAVTKMLSYPITIASVLNQFSPYSLNPKGPIT 192

Query: 203 LEGLKSLAALRYXXXXXXXXXXXXXXXXXXXITATSKNRPMRIFILGARAEAQLPPHVWK 262
           LEGLKSLAALRY                     A +K+RPMR+FILGARAEA LP HVWK
Sbjct: 193 LEGLKSLAALRYTLYPFENKT-----------VAATKDRPMRLFILGARAEALLPGHVWK 241

Query: 263 QLQYLFPNSNFEIHFIGPESLLSKDKSHYVTSTTPITKRIDDSMSLVYHTDYFHVYHKAQ 322
           QLQ+LFP + FE+HFIGPE L++K+K  YV+S  P+ KRID+++S VYHTDYFHVYH AQ
Sbjct: 242 QLQFLFPETAFELHFIGPECLVNKEKHQYVSSPAPVVKRIDETLSFVYHTDYFHVYHDAQ 301

Query: 323 XXXXXXXXXXXXXXXHPGLAATKET--WLNETMQGLLDSKCPIFMTGFHEKDITADISVL 380
                          HPG  A + T  WL +T+ GLL++KC IF TG ++  +  DI+ +
Sbjct: 302 DFFPYDPYLDAFFCFHPGFGAPESTKLWLEKTIPGLLETKCAIFATGVNKSALLRDINAV 361

Query: 381 NKNFSKDMDILMKPVKNVFGSTKWELNDSNPQEVYQFNMYIAGYRGKRYHATE 433
               SK++DILM+P KN++GSTKWELND NPQEVYQFNMYIAG+RGKRYHA E
Sbjct: 362 MDKHSKEIDILMEPTKNIYGSTKWELNDVNPQEVYQFNMYIAGFRGKRYHAIE 414

>Ecym_4727 Chr4 complement(1420885..1422174) [1290 bp, 429 aa] {ON}
           similar to Ashbya gossypii ACL152W
          Length = 429

 Score =  529 bits (1363), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 246/425 (57%), Positives = 309/425 (72%), Gaps = 13/425 (3%)

Query: 11  ILSKNIIACSNYSKRNLMGFVRSTLGLDXXXXXXXXXXENRFHPWETSPCDDLRERAARI 70
           I S +   C    +R +MGFVR+ LGLD          +NRFHPW+ SP  +LRERAARI
Sbjct: 15  ISSSSSRVCGKQQRRQIMGFVRNALGLDPPTSPDEPTVDNRFHPWDQSPSPELRERAARI 74

Query: 71  KTMAKCPVSNLDINYTCPISGIPTHHSRKEWEMDTNYHKNHIADILKKVNIYEHDLRSGR 130
           K +AKCPV+  +I ++C  SGIPTHHS + W+ D+ YH++    +LKKVNIYEHDLRSGR
Sbjct: 75  KALAKCPVTGKNIQFSCKYSGIPTHHSEEAWKNDSEYHESKRYRLLKKVNIYEHDLRSGR 134

Query: 131 PFPEFDFPREQEYDTVINLINWDLYFYTRNFFSMDTEFQLAAVTKMLSYPMTIASVLHQF 190
           PF EFDFP +Q+YD ++N++NWDLYFYTR+FFSMDTEFQLAAVTKMLSYP+TI S+LHQ+
Sbjct: 135 PFLEFDFPEQQDYDRMVNMMNWDLYFYTRSFFSMDTEFQLAAVTKMLSYPITIGSILHQY 194

Query: 191 SPYSLTPKGPVTLEGLKSLAALRYXXXXXXXXXXXXXXXXXXXITATSKNRPMRIFILGA 250
           SPYSL PKGP+TLEGLKSLAALRY                      + +++P+R+FILGA
Sbjct: 195 SPYSLNPKGPITLEGLKSLAALRYTLYPEQNRR-----------VRSIQDKPLRVFILGA 243

Query: 251 RAEAQLPPHVWKQLQYLFPNSNFEIHFIGPESLLSKDKSHYVTSTTPITKRIDDSMSLVY 310
           RAEAQLP HVWKQLQYLFP S  E+HF+GPES   ++K  YVTS+ P+ KRIDD+M + Y
Sbjct: 244 RAEAQLPGHVWKQLQYLFPESLIELHFVGPESNYDREKREYVTSSIPVVKRIDDTMKMHY 303

Query: 311 HTDYFHVYHKAQXXXXXXXXXXXXXXXHPGLAA--TKETWLNETMQGLLDSKCPIFMTGF 368
           HTDYFHV+H+AQ               HPG  +  T++TW+N T+Q LL +KC IF TGF
Sbjct: 304 HTDYFHVFHEAQDFFPYDPYNDIFFCFHPGFGSPETRDTWMNSTLQALLQTKCAIFTTGF 363

Query: 369 HEKDITADISVLNKNFSKDMDILMKPVKNVFGSTKWELNDSNPQEVYQFNMYIAGYRGKR 428
           ++KD+  D+  + + +  ++D+L+ P KNVFGSTKWELND NP EVYQFNMYIAG+RGKR
Sbjct: 364 NKKDLMDDLQAVKEKYGDELDMLVDPTKNVFGSTKWELNDLNPHEVYQFNMYIAGFRGKR 423

Query: 429 YHATE 433
           YHA E
Sbjct: 424 YHAIE 428

>KAFR0B00840 Chr2 (159480..160760) [1281 bp, 426 aa] {ON} Anc_7.346
           YLR203C
          Length = 426

 Score =  516 bits (1330), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 250/411 (60%), Positives = 297/411 (72%), Gaps = 12/411 (2%)

Query: 25  RNLMGFVRSTLGLDXXXXXXXXXXENRFHPWETSPCDDLRERAARIKTMAKCPVSNLDIN 84
           R L+GFVR+ LGL+           NRF+PW+ SP  +LRERAA+IK MA+CP++  +IN
Sbjct: 25  RTLVGFVRNALGLEPPPTPDEPRVSNRFYPWDQSPSPELRERAAKIKAMARCPITGKEIN 84

Query: 85  YTCPISGIPTHHSRKEWEMDTNYHKNHIADILKKVNIYEHDLRSGRPFPEFDFPREQEYD 144
           YTCPISGIPTHHSR+ WE D  YH+N I DILKKVNIYEHDLRSGR FPEFDFP +Q +D
Sbjct: 85  YTCPISGIPTHHSREAWEQDEAYHRNKIPDILKKVNIYEHDLRSGRSFPEFDFPSDQTFD 144

Query: 145 TVINLINWDLYFYTRNFFSMDTEFQLAAVTKMLSYPMTIASVLHQFSPYSLTPKGPVTLE 204
             +NL NWDLYFYTR+F+SMDTEFQLA VTKMLSYP+TIASVLHQ+SPYSL P GP+TLE
Sbjct: 145 RAVNLANWDLYFYTRSFYSMDTEFQLATVTKMLSYPITIASVLHQYSPYSLYPHGPITLE 204

Query: 205 GLKSLAALRYXXXXXXXXXXXXXXXXXXXITATSKNRPMRIFILGARAEAQLPPHVWKQL 264
           GLKS+AALRY                    +  +K RPMRIFILGARAE+QLP HVWKQ 
Sbjct: 205 GLKSIAALRYSLYPSQHKSSR---------SVLNKTRPMRIFILGARAESQLPGHVWKQF 255

Query: 265 QYLFPNSNFEIHFIGPESLLSKDKSHYVTSTTPITKRIDDSMSLVYHTDYFHVYHKAQXX 324
           QYLFP   FEI FIGPE  L ++ S+ V     I KRIDD++SLVYH   FH  HKAQ  
Sbjct: 256 QYLFPLQTFEIIFIGPECQL-REPSNSVGGANNIVKRIDDTISLVYHPKLFHDIHKAQDF 314

Query: 325 XXXXXXXXXXXXXHPGLAA--TKETWLNETMQGLLDSKCPIFMTGFHEKDITADISVLNK 382
                        HPG A+  TKE W+N+T++ LLD+KC +F TGF +KD++ D+ +LNK
Sbjct: 315 FPYDPYNDVFFVFHPGFASPETKELWMNDTVKALLDTKCAVFHTGFSKKDLSNDVKLLNK 374

Query: 383 NFSKDMDILMKPVKNVFGSTKWELNDSNPQEVYQFNMYIAGYRGKRYHATE 433
            +   +D LM PVKN+FGSTKWELND NPQEVYQFNMYI+ +RGKRYH  E
Sbjct: 375 MYGDKLDTLMTPVKNLFGSTKWELNDLNPQEVYQFNMYISAFRGKRYHPIE 425

>KNAG0C03750 Chr3 (740426..741700) [1275 bp, 424 aa] {ON} Anc_7.346
           YLR203C
          Length = 424

 Score =  513 bits (1322), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 247/408 (60%), Positives = 297/408 (72%), Gaps = 18/408 (4%)

Query: 25  RNLMGFVRSTLGLDXXXXXXXXXXENRFHPWETSPCDDLRERAARIKTMAKCPVSNLDIN 84
           R +MG+VR+  GL+           NRFHPWE SPC DLR+RAARIKT+A+CPV+  +IN
Sbjct: 29  RTIMGYVRNAFGLEPRDSPDTPQISNRFHPWEESPCADLRDRAARIKTLARCPVTGKNIN 88

Query: 85  YTCPISGIPTHHSRKEWEMDTNYHKNHIADILKKVNIYEHDLRSGRPFPEFDFPREQEYD 144
           YTCPISGIPTHHSRK WE DT+YHKN   + LKKVNIYEHDLRSGR FPEFDFP EQ  D
Sbjct: 89  YTCPISGIPTHHSRKAWEDDTDYHKNKTYEKLKKVNIYEHDLRSGRSFPEFDFPAEQGRD 148

Query: 145 TVINLINWDLYFYTRNFFSMDTEFQLAAVTKMLSYPMTIASVLHQFSPYSLTPKGPVTLE 204
             +NL NWDL+ YTR F+SMDTEF LA VTKMLSYP+TIASVLH+FSPY L P+GPVTLE
Sbjct: 149 RAVNLQNWDLFLYTRQFYSMDTEFHLATVTKMLSYPITIASVLHEFSPYKLQPRGPVTLE 208

Query: 205 GLKSLAALRYXXXXXXXXXXXXXXXXXXXITATSKNRPMRIFILGARAEAQLPPHVWKQL 264
           GLKS+AALRY                    T+ S N PMRIFI+G RAE+QLP HVWKQL
Sbjct: 209 GLKSIAALRYTLYPKLGK------------TSLSNNSPMRIFIVGTRAESQLPGHVWKQL 256

Query: 265 QYLFPNSNFEIHFIGPESLLSKDKSHYVTSTTPITKRIDDSMSLVYHTDYFHVYHKAQXX 324
           QYLF    FEIHFIGPE  L + K+    ++TP+ K++DD++SL+YH  YFH  HK+   
Sbjct: 257 QYLFSERIFEIHFIGPECQLKEPKN----TSTPLIKKVDDTLSLIYHPQYFHELHKSGDL 312

Query: 325 XXXXXXXXXXXXXHPGLA--ATKETWLNETMQGLLDSKCPIFMTGFHEKDITADISVLNK 382
                        HPG A   T++ WL+ET+  LL++KC IF TGF+E DIT D+++++K
Sbjct: 313 FPYNPYKDVFFIFHPGFAYPDTRKLWLDETIPNLLETKCAIFHTGFNEGDITNDVTLIDK 372

Query: 383 NFSKDMDILMKPVKNVFGSTKWELNDSNPQEVYQFNMYIAGYRGKRYH 430
            +  ++D+LMKP+KNVFGS KWELND NPQEVYQFNMYIAG+RGKRYH
Sbjct: 373 CYRNEIDVLMKPIKNVFGSVKWELNDINPQEVYQFNMYIAGFRGKRYH 420

>NCAS0A14120 Chr1 (2777017..2778300) [1284 bp, 427 aa] {ON}
           Anc_7.346 YLR203C
          Length = 427

 Score =  512 bits (1318), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 240/414 (57%), Positives = 302/414 (72%), Gaps = 16/414 (3%)

Query: 23  SKRNLMGFVRSTLGLDXXXXXXXXXXENRFHPWETSPCDDLRERAARIKTMAKCPVSNLD 82
           S R L+GFV++ LG+D           NRF+PW+ SP   +RERAARIK  AKCPV+  +
Sbjct: 28  SHRTLVGFVKNALGIDPPPLPTEPVFANRFYPWDESPSPAIRERAARIKAQAKCPVTGKE 87

Query: 83  INYTCPISGIPTHHSRKEWEMDTNYHKNHIADILKKVNIYEHDLRSGRPFPEFDFPREQE 142
           I +TCP+SGIPTH+S++ WE DTNYHKN I + L+KVNIYEHDLRSGRPFPEFDFP EQ 
Sbjct: 88  IRFTCPLSGIPTHYSKEAWENDTNYHKNKIYEKLRKVNIYEHDLRSGRPFPEFDFPGEQA 147

Query: 143 YDTVINLINWDLYFYTRNFFSMDTEFQLAAVTKMLSYPMTIASVLHQFSPYSLTPKGPVT 202
            D+ +N+ NWDL+FYTR F+SMDTEFQLA VTKMLSYP+TI S+L+++SPY+L PKGPVT
Sbjct: 148 RDSTVNMTNWDLFFYTRQFYSMDTEFQLATVTKMLSYPITIGSILYKYSPYNLIPKGPVT 207

Query: 203 LEGLKSLAALRYXXXXXXXXXXXXXXXXXXXITATSKNRPMRIFILGARAEAQLPPHVWK 262
           LEGLKSLAALRY                     AT+K RPMRIFILGARAE+QLP H+WK
Sbjct: 208 LEGLKSLAALRYTLRNNAF--------------ATTKTRPMRIFILGARAESQLPIHIWK 253

Query: 263 QLQYLFPNSNFEIHFIGPESLLSKDKSHYVTSTTPITKRIDDSMSLVYHTDYFHVYHKAQ 322
           QLQ+LFP   FEI+FIGPE  L +  S+Y++S + I KR+D+S++L Y+ DYF  +HKAQ
Sbjct: 254 QLQFLFPAQAFEINFIGPECSLLEQDSNYLSSDSRIVKRVDESLTLAYYPDYFDKFHKAQ 313

Query: 323 XXXXXXXXXXXXXXXHPGLAA--TKETWLNETMQGLLDSKCPIFMTGFHEKDITADISVL 380
                          HPG A+  + +TW+ +TM+ LLD+KC IF TGF + DI  DI+ +
Sbjct: 314 DFFPYDPYNDIFFTFHPGFASPESSKTWMGDTMKALLDTKCAIFTTGFSQDDIMKDITSV 373

Query: 381 NKNFSKDMDILMKPVKNVFGSTKWELNDSNPQEVYQFNMYIAGYRGKRYHATET 434
              + +++D+LM P+KNVFGSTKWELND NPQ+VYQFNMYIAG+RGKRYH  + 
Sbjct: 374 QDTYGEEVDMLMNPIKNVFGSTKWELNDLNPQQVYQFNMYIAGFRGKRYHTVKA 427

>NDAI0A01930 Chr1 complement(430531..431883) [1353 bp, 450 aa] {ON}
           Anc_7.346 YLR203C
          Length = 450

 Score =  502 bits (1293), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 237/429 (55%), Positives = 304/429 (70%), Gaps = 30/429 (6%)

Query: 22  YSKRNLMGFVRSTLGLDXXXXXXXXXXENRFHPWETSPCDDLRERAARIKTMAKCPVSNL 81
           +S R+ +GFV++ LG++          ENRFHPW+ SP  DLRERAARI+ +AKCPV+  
Sbjct: 36  FSNRHFVGFVKNALGMEPPPSPNEPAFENRFHPWDQSPSPDLRERAARIRALAKCPVTGK 95

Query: 82  DINYTCPISGIPTHHSRKEWEMDTNYHKNHIADILKKVNIYEHDLRSGRPFPEFDFPREQ 141
           +INYTCPISGIPTHHS++ WE DTNYH+N I DILKKVN++EHDLRSGR FPEF+FP+ Q
Sbjct: 96  EINYTCPISGIPTHHSKEAWENDTNYHQNKIYDILKKVNVFEHDLRSGRSFPEFEFPQSQ 155

Query: 142 EYDTVINLINWDLYFYTRNFFSMDTEFQLAAVTKMLSYPMTIASVLHQFSPYSLTPKGPV 201
           ++D  +++ NWD++FYTR F SMD+EFQLA VTKMLSYP+TIAS+LH++ PY+L P GP+
Sbjct: 156 DHDCAVSMNNWDMFFYTRQFVSMDSEFQLATVTKMLSYPITIASILHKYCPYALEPNGPI 215

Query: 202 TLEGLKSLAALRYXXXXXXXXXXXXXXXXXXXITATSKNRPMRIFILGARAEAQLPPHVW 261
           TLEGLKS+AAL+Y                      T+K RPMRIFILGARAE+QLP H+W
Sbjct: 216 TLEGLKSIAALKYSLRHNEF--------------ETTKERPMRIFILGARAESQLPEHIW 261

Query: 262 KQLQYLFPNSNFEIHFIGPESLL------------SKDKSHYVTSTTP--ITKRIDDSMS 307
           KQ  YLFP  NFEI+FIGPE  +            +   S  +T   P  I KRID+ ++
Sbjct: 262 KQFSYLFPFQNFEINFIGPECSVLMNNNNMNAEETNTTTSGSMTEIRPNRIVKRIDERLN 321

Query: 308 LVYHTDYFHVYHKAQXXXXXXXXXXXXXXXHPGLAATKET--WLNETMQGLLDSKCPIFM 365
           LVYHTD+FH  H A+               HPG A+ + T  W+ ETM+ LLD+KC IF 
Sbjct: 322 LVYHTDFFHTLHNARDFFPYDSYNDVFFTFHPGFASPENTKSWMGETMKALLDTKCAIFT 381

Query: 366 TGFHEKDITADISVLNKNFSKDMDILMKPVKNVFGSTKWELNDSNPQEVYQFNMYIAGYR 425
           TGF+++D+  DI ++ + + K++D+LMKP KNVFGSTKWELND +PQEVYQ+NMYIAG+R
Sbjct: 382 TGFNKQDLLKDIDIVQETYGKEVDMLMKPTKNVFGSTKWELNDMDPQEVYQYNMYIAGFR 441

Query: 426 GKRYHATET 434
           GKRYHA + 
Sbjct: 442 GKRYHAVKV 450

>ACL152W Chr3 (85701..86987) [1287 bp, 428 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YLR203C (MSS51)
          Length = 428

 Score =  494 bits (1273), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 240/425 (56%), Positives = 301/425 (70%), Gaps = 14/425 (3%)

Query: 12  LSKNIIACSNYSKRNLMGFVRSTLGLDXXXXXXXXXXENRFHPWETSPCDDLRERAARIK 71
           + +   A +   +R +MGFVR+ LGLD          ENRFH WE SP  DLRERAARI+
Sbjct: 16  VGRGCAAGACGQRRPIMGFVRNALGLDPPASPDEPTDENRFHVWEQSPSPDLRERAARIR 75

Query: 72  TMAKCPVSNLDINYTCPISGIPTHHSRKEWEMDTNYHKNHIADILKKVNIYEHDLRSGRP 131
            +A+CPV+  DI Y+C  SGIPTHHSR+ WE D  YH++     L+KVN+YEHDLRSGRP
Sbjct: 76  ALARCPVTGKDIRYSCERSGIPTHHSREAWEQDEEYHRSKRWATLRKVNVYEHDLRSGRP 135

Query: 132 FPEFDFPREQEYDTVINLINWDLYFYTRNFFSMDTEFQLAAVTKMLSYPMTIASVLHQFS 191
           F EFDFP+EQ  D ++N++NWDL+ YTR F+SMDT+FQLAAVTKMLSYP+TI S+LHQFS
Sbjct: 136 FAEFDFPQEQGRDRMVNMLNWDLFLYTRQFYSMDTDFQLAAVTKMLSYPITIGSLLHQFS 195

Query: 192 PYSLTPKGPVTLEGLKSLAALRYXXXXXXXXXXXXXXXXXXXITATSKNRPMRIFILGAR 251
           PY+L P+GP+TLEGLKSLAALRY                        +++PMRIFILGAR
Sbjct: 196 PYALEPRGPITLEGLKSLAALRYTLYPESES------------ARAVRSKPMRIFILGAR 243

Query: 252 AEAQLPPHVWKQLQYLFPNSNFEIHFIGPESLLSKDKSHYVTSTTPITKRIDDSMSLVYH 311
           AEAQLP HVWKQLQYLFP SN EIHFIGPE+L  + +  YV S+TP++KR+D ++ LV+H
Sbjct: 244 AEAQLPGHVWKQLQYLFPGSNMEIHFIGPEALYDRQRKEYVHSSTPVSKRVDGTLKLVHH 303

Query: 312 TDYFHVYHKAQXXXXXXXXXXXXXXXHPGLAAT--KETWLNETMQGLLDSKCPIFMTGFH 369
           TDY HV+H+AQ               HPG A+   + +W+++T+  LL++KC IF+TGFH
Sbjct: 304 TDYLHVFHEAQDFFPYDPYNDVFFCFHPGFASAEGRSSWMDKTVPALLETKCAIFVTGFH 363

Query: 370 EKDITADISVLNKNFSKDMDILMKPVKNVFGSTKWELNDSNPQEVYQFNMYIAGYRGKRY 429
             D+  D   L  +   +MD+LM P KN+FGSTKWELND NP EVYQFNMYIAG+RGKRY
Sbjct: 364 RDDMFGDFEALRASHDAEMDVLMHPTKNIFGSTKWELNDMNPHEVYQFNMYIAGFRGKRY 423

Query: 430 HATET 434
           HA + 
Sbjct: 424 HAIQV 428

>Suva_15.94 Chr15 (169308..169787) [480 bp, 159 aa] {ON} YOL071W
           (REAL)
          Length = 159

 Score = 32.3 bits (72), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 29/113 (25%), Positives = 53/113 (46%), Gaps = 22/113 (19%)

Query: 51  RFHPWETSPCDDLRERAARIKTMAKCPVSNLDINYTCPISGIPTHHSRKEWEMDTNYH-K 109
           R H W +S  DD  +   RIK     P+  ++ +     + +  + SRK   ++T+    
Sbjct: 28  RSHRWYSSEKDDHDDVMTRIKI---APIKRINESLDKKRARL-IYQSRKRGILETDLLLS 83

Query: 110 NHIADILKKVNIYEHDLRSGRPFPEFDFPREQEYDTVINLINWDLYFY-TRNF 161
              A  LKK+N  E                 +EYD+++N ++WD+Y++ T+N+
Sbjct: 84  GFAAKYLKKMNQEEL----------------EEYDSLLNELDWDIYYWATKNY 120

>NDAI0B02590 Chr2 complement(647421..647915) [495 bp, 164 aa] {ON}
           Anc_3.144 YOL071W
          Length = 164

 Score = 31.2 bits (69), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 29/50 (58%), Gaps = 5/50 (10%)

Query: 117 KKVNIYEHDLR----SGRPFPEFDFPREQEYDTVINLINWDLYFY-TRNF 161
           +K  I E DL     + +   + D    +EYD ++N ++WD+Y++ T+NF
Sbjct: 77  RKRGILETDLLLSAFAAKYLKDMDVVELKEYDELLNELDWDIYYWATKNF 126

>NCAS0B05220 Chr2 complement(970859..971335) [477 bp, 158 aa] {ON}
           Anc_3.144 YOL071W
          Length = 158

 Score = 31.2 bits (69), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 13/29 (44%), Positives = 23/29 (79%), Gaps = 3/29 (10%)

Query: 136 DFPREQ--EYDTVINLINWDLYFY-TRNF 161
           D  +EQ  EYD+++N ++WD+Y++ T+NF
Sbjct: 91  DMNKEQLNEYDSLLNELDWDIYYWATKNF 119

>YOL071W Chr15 (196507..196995) [489 bp, 162 aa] {ON}  EMI5Subunit
           of succinate dehydrogenase, which couples succinate
           oxidation to ubiquinone reduction; required for FAD
           cofactor attachment to Sdh1p; mutations in human
           ortholog PGL2 are associated with neuroendocrine tumors
           (paraganglioma)
          Length = 162

 Score = 30.8 bits (68), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 10/22 (45%), Positives = 20/22 (90%), Gaps = 1/22 (4%)

Query: 141 QEYDTVINLINWDLYFY-TRNF 161
           +EYD+++N ++WD+Y++ T+NF
Sbjct: 102 EEYDSLLNELDWDIYYWATKNF 123

>TDEL0D04790 Chr4 complement(876408..876899) [492 bp, 163 aa] {ON}
           Anc_3.144 YOL071W
          Length = 163

 Score = 30.8 bits (68), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 29/50 (58%), Gaps = 5/50 (10%)

Query: 117 KKVNIYEHDLR----SGRPFPEFDFPREQEYDTVINLINWDLYFY-TRNF 161
           +K  I E DL     + +   +      +EYD+++N ++WD+Y++ T+NF
Sbjct: 72  RKRGILETDLLLSRFAAKYLKDMSLKELEEYDSLLNELDWDIYYWATKNF 121

>Smik_15.87 Chr15 (160826..161302) [477 bp, 158 aa] {ON} YOL071W
           (REAL)
          Length = 158

 Score = 30.4 bits (67), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 10/22 (45%), Positives = 20/22 (90%), Gaps = 1/22 (4%)

Query: 141 QEYDTVINLINWDLYFY-TRNF 161
           +EYD+++N ++WD+Y++ T+NF
Sbjct: 99  EEYDSLLNELDWDIYYWATKNF 120

>SAKL0D14828g Chr4 complement(1222126..1223916) [1791 bp, 596 aa]
           {ON} similar to uniprot|P27825 Saccharomyces cerevisiae
           YAL058W CNE1 Functions in endoplasmic reticulum protein
           quality control; Calnexin and calreticulin homolog
          Length = 596

 Score = 31.6 bits (70), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 30/63 (47%), Gaps = 14/63 (22%)

Query: 116 LKKVNIYEHDLRSGRPFPEFDFPREQEYDTVINLINWDLYFYTRNFFSMDTEFQLAAVTK 175
           L K+ + + +++   P PE   P+E E D           F TRNFF + T F    VTK
Sbjct: 444 LPKLELEKREIKVNEPEPEIAKPKEPEAD-----------FETRNFFDVITNF---VVTK 489

Query: 176 MLS 178
            L+
Sbjct: 490 FLA 492

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.134    0.413 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 44,338,678
Number of extensions: 1835817
Number of successful extensions: 4634
Number of sequences better than 10.0: 30
Number of HSP's gapped: 4693
Number of HSP's successfully gapped: 30
Length of query: 437
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 324
Effective length of database: 40,524,141
Effective search space: 13129821684
Effective search space used: 13129821684
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 67 (30.4 bits)