Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0E00490singletonON1521526444e-87
Smik_13.3722.341ON76944691.1
YMR167W (MLH1)2.341ON76944691.1
TBLA0H011008.357ON96574653.4
NDAI0A013007.448ON56545643.8
NDAI0A086107.75ON86870635.3
YLR144C (ACF2)8.352ON77976628.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0E00490
         (152 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0E00490 Chr5 complement(90516..90974) [459 bp, 152 aa] {ON}       252   4e-87
Smik_13.372 Chr13 (579389..581698) [2310 bp, 769 aa] {ON} YMR167...    31   1.1  
YMR167W Chr13 (594886..597195) [2310 bp, 769 aa] {ON}  MLH1Prote...    31   1.1  
TBLA0H01100 Chr8 (244045..246942) [2898 bp, 965 aa] {ON} Anc_8.3...    30   3.4  
NDAI0A01300 Chr1 complement(280662..282359) [1698 bp, 565 aa] {O...    29   3.8  
NDAI0A08610 Chr1 complement(1984308..1986914) [2607 bp, 868 aa] ...    29   5.3  
YLR144C Chr12 complement(429677..432016) [2340 bp, 779 aa] {ON} ...    28   8.2  

>TBLA0E00490 Chr5 complement(90516..90974) [459 bp, 152 aa] {ON} 
          Length = 152

 Score =  252 bits (644), Expect = 4e-87,   Method: Compositional matrix adjust.
 Identities = 125/152 (82%), Positives = 125/152 (82%)

Query: 1   MFKAGLPRFHNPTSHGIRWVVPFFKHTPTITNRSYSIVPSHNTISSSSYQTTLCQAHLFQ 60
           MFKAGLPRFHNPTSHGIRWVVPFFKHTPTITNRSYSIVPSHNTISSSSYQTTLCQAHLFQ
Sbjct: 1   MFKAGLPRFHNPTSHGIRWVVPFFKHTPTITNRSYSIVPSHNTISSSSYQTTLCQAHLFQ 60

Query: 61  NTLRTTSFLGVNPSTKHATLTFPETLTPNAVLANPNITFQPVPITDSQEPLQNVTMHLDS 120
           NTLRTTSFLGVNPSTKHATLTFPETLTPNAVLANPNITFQPVPITDSQEPLQNVTMHLDS
Sbjct: 61  NTLRTTSFLGVNPSTKHATLTFPETLTPNAVLANPNITFQPVPITDSQEPLQNVTMHLDS 120

Query: 121 VXXXXXXXXXXXXXXXXXXXXXXXXXXXGQGR 152
           V                           GQGR
Sbjct: 121 VMRKRRKKMKKHKLRKRRRKEKAERRKLGQGR 152

>Smik_13.372 Chr13 (579389..581698) [2310 bp, 769 aa] {ON} YMR167W
           (REAL)
          Length = 769

 Score = 31.2 bits (69), Expect = 1.1,   Method: Composition-based stats.
 Identities = 16/44 (36%), Positives = 25/44 (56%)

Query: 24  FKHTPTITNRSYSIVPSHNTISSSSYQTTLCQAHLFQNTLRTTS 67
           FK +   T++  S++ S+NTI +   + TL QA +  NT   TS
Sbjct: 343 FKASSITTSQPGSLISSNNTIENEEERRTLRQAQVVDNTYTITS 386

>YMR167W Chr13 (594886..597195) [2310 bp, 769 aa] {ON}  MLH1Protein
           required for mismatch repair in mitosis and meiosis as
           well as crossing over during meiosis; forms a complex
           with Pms1p and Msh2p-Msh3p during mismatch repair; human
           homolog is associated with hereditary non-polyposis
           colon cancer
          Length = 769

 Score = 31.2 bits (69), Expect = 1.1,   Method: Composition-based stats.
 Identities = 14/44 (31%), Positives = 26/44 (59%)

Query: 24  FKHTPTITNRSYSIVPSHNTISSSSYQTTLCQAHLFQNTLRTTS 67
           FK +   TN+  S++P ++TI S   + +L QA + +N+  T +
Sbjct: 343 FKASSISTNKPESLIPFNDTIESDRNRKSLRQAQVVENSYTTAN 386

>TBLA0H01100 Chr8 (244045..246942) [2898 bp, 965 aa] {ON} Anc_8.357
           YDR166C
          Length = 965

 Score = 29.6 bits (65), Expect = 3.4,   Method: Composition-based stats.
 Identities = 18/74 (24%), Positives = 33/74 (44%)

Query: 9   FHNPTSHGIRWVVPFFKHTPTITNRSYSIVPSHNTISSSSYQTTLCQAHLFQNTLRTTSF 68
           F   T + IR ++  F+  P I N + +  PS   ++    +     +++ Q+ L+  + 
Sbjct: 687 FQRLTIYAIRDILFSFERLPRINNITVTGYPSKELLTKIESKQLDSMSNVLQSVLQNAAK 746

Query: 69  LGVNPSTKHATLTF 82
              NP T H  LT 
Sbjct: 747 EKDNPRTSHTILTL 760

>NDAI0A01300 Chr1 complement(280662..282359) [1698 bp, 565 aa] {ON}
           Anc_7.448 YPR034W
          Length = 565

 Score = 29.3 bits (64), Expect = 3.8,   Method: Composition-based stats.
 Identities = 14/45 (31%), Positives = 23/45 (51%)

Query: 24  FKHTPTITNRSYSIVPSHNTISSSSYQTTLCQAHLFQNTLRTTSF 68
           + + P    ++Y I PSH TIS  + +      +LFQ  L + +F
Sbjct: 316 YNNNPLNQKKNYLIKPSHKTISLEARECYKLAEYLFQPNLASETF 360

>NDAI0A08610 Chr1 complement(1984308..1986914) [2607 bp, 868 aa]
           {ON} Anc_7.75 YOR322C
          Length = 868

 Score = 28.9 bits (63), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 37/70 (52%), Gaps = 6/70 (8%)

Query: 38  VPSHNTISSSSYQTTLCQAHLFQNTLRTTSFLGVNPST--KHATLTFPETLTPNAVLANP 95
           VPS+++I S+  Q  +   +     LR  S LG   ST   H +L+ P TLTP++  AN 
Sbjct: 71  VPSYDSIRSTKSQNNV---NTSPTKLRRKSTLGSTLSTTFSHLSLSTP-TLTPSSSTANS 126

Query: 96  NITFQPVPIT 105
           N+    VP T
Sbjct: 127 NVNASNVPTT 136

>YLR144C Chr12 complement(429677..432016) [2340 bp, 779 aa] {ON}
           ACF2Intracellular beta-1,3-endoglucanase, expression is
           induced during sporulation; may have a role in cortical
           actin cytoskeleton assembly
          Length = 779

 Score = 28.5 bits (62), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 19/76 (25%), Positives = 30/76 (39%), Gaps = 6/76 (7%)

Query: 33  RSYSIVPSHNTISSSSYQTTLCQAHLFQNTLRTTSFLGVNPSTKHATLTFPET------L 86
           +SY +  S+NT+    +        LF+N +   ++ G+ P   H     P T       
Sbjct: 649 QSYFLYESNNTVQPKEFIGNKVSGILFENKIDHATYFGMEPQYIHMIHAIPITSASSWVR 708

Query: 87  TPNAVLANPNITFQPV 102
           TPN V        QP+
Sbjct: 709 TPNFVKEEWEEKMQPI 724

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.130    0.399 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 14,228,480
Number of extensions: 557391
Number of successful extensions: 2034
Number of sequences better than 10.0: 37
Number of HSP's gapped: 2028
Number of HSP's successfully gapped: 37
Length of query: 152
Length of database: 53,481,399
Length adjustment: 100
Effective length of query: 52
Effective length of database: 42,014,799
Effective search space: 2184769548
Effective search space used: 2184769548
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 60 (27.7 bits)