Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0E004807.342ON5992739021e-113
KAFR0L014607.342ON5502755829e-67
YLR206W (ENT2)7.342ON6131995869e-67
Suva_10.3007.342ON6181995851e-66
Smik_12.2647.342ON6121995842e-66
Skud_12.2707.342ON6261995826e-66
TDEL0C020507.342ON5011995711e-65
CAGL0A03872g7.342ON5101985702e-65
TPHA0D045607.342ON4871345692e-65
NCAS0H006707.342ON4831345613e-64
NDAI0D006107.342ON4861995595e-64
Suva_4.837.342ON4621345568e-64
Skud_4.947.342ON4471345531e-63
Smik_4.757.342ON4601995505e-63
Kpol_2001.707.342ON5331995547e-63
YDL161W (ENT1)7.342ON4541345452e-62
KNAG0C038007.342ON4471955443e-62
ZYRO0F11550g7.342ON5381345321e-59
SAKL0F10934g7.342ON4981995291e-59
KLTH0H01430g7.342ON5021995177e-58
KAFR0B008907.342ON4141305012e-56
Kwal_56.246107.342ON5081995063e-56
KLLA0C16731g7.342ON4781345026e-56
KNAG0B026507.342ON6462265038e-55
ACL157C7.342ON5152034503e-48
Ecym_47317.342ON5141334406e-47
TBLA0E020407.342ON7011334258e-44
KLTH0D16896g4.346ON4011332132e-17
Kwal_47.168574.346ON3821342087e-17
TBLA0E047604.346ON4261342034e-16
SAKL0G17952g4.346ON4151332016e-16
KLLA0B04587g4.346ON4001331991e-15
Suva_12.2164.346ON4101331972e-15
NDAI0D032004.346ON4351341972e-15
KNAG0M003804.346ON4031331962e-15
NCAS0A062104.346ON4231331963e-15
KAFR0B067404.346ON3991331927e-15
TDEL0D007104.346ON3751341927e-15
Skud_10.3494.346ON4101331928e-15
YJR125C (ENT3)4.346ON4081331919e-15
Smik_10.4184.346ON4091331911e-14
Kpol_1001.24.346ON4181341883e-14
ZYRO0B14784g4.346ON4241341856e-14
CAGL0H04323g4.346ON4121291821e-13
AER155C4.346ON3641341766e-13
TPHA0B004004.346ON3991341751e-12
SAKL0H25762g4.17ON2621371701e-12
Ecym_11334.346ON3921341713e-12
Kwal_55.206114.17ON2541101593e-11
TBLA0G006504.17ON4231311492e-09
TDEL0G017404.17ON2571211443e-09
Ecym_84074.17ON2541371424e-09
KLTH0E05874g4.17ON2551121409e-09
ZYRO0G07876g4.17ON2591091391e-08
TPHA0F002304.17ON2801181347e-08
TBLA0B062204.346ON3391321348e-08
Kpol_388.54.17ON2681091302e-07
Smik_12.194.17ON2471181282e-07
Suva_10.354.17ON2471181283e-07
YLL038C (ENT4)4.17ON2471181247e-07
Skud_12.304.17ON2471061176e-06
ACL061C4.17ON2341001151e-05
KLLA0D03949g4.17ON2251021151e-05
CAGL0E03806g4.17ON2601101097e-05
YHR161C (YAP1801)5.84ON637721118e-05
SAKL0H02530g5.84ON669931111e-04
Skud_8.2255.84ON621871082e-04
NCAS0C058404.17ON2671291053e-04
KAFR0I014604.17ON2751061019e-04
Smik_8.2455.84ON627721020.001
ZYRO0F13508g5.84ON687721000.002
NDAI0H002804.17ON31096940.007
TBLA0H012108.335ON49197840.16
KNAG0J028704.17ON329124820.23
Kpol_344.88.335ON384115761.1
ZYRO0F13684g8.335ON40797761.3
NDAI0A028305.84ON47377733.2
NDAI0A014707.419ON36733723.7
KAFR0B058008.335ON38297715.0
Kpol_1050.735.84ON67156715.3
TBLA0F026207.471ON48252707.2
TDEL0G010805.84ON51542707.4
Ecym_44333.474ON56651698.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0E00480
         (599 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0E00480 Chr5 complement(88019..89818) [1800 bp, 599 aa] {ON}...   352   e-113
KAFR0L01460 Chr12 complement(270433..272085) [1653 bp, 550 aa] {...   228   9e-67
YLR206W Chr12 (554578..556419) [1842 bp, 613 aa] {ON}  ENT2Epsin...   230   9e-67
Suva_10.300 Chr10 (527412..529268) [1857 bp, 618 aa] {ON} YLR206...   229   1e-66
Smik_12.264 Chr12 (501598..503436) [1839 bp, 612 aa] {ON} YLR206...   229   2e-66
Skud_12.270 Chr12 (501192..503072) [1881 bp, 626 aa] {ON} YLR206...   228   6e-66
TDEL0C02050 Chr3 (355071..356576) [1506 bp, 501 aa] {ON} Anc_7.3...   224   1e-65
CAGL0A03872g Chr1 complement(392922..394454) [1533 bp, 510 aa] {...   224   2e-65
TPHA0D04560 Chr4 complement(994552..996015) [1464 bp, 487 aa] {O...   223   2e-65
NCAS0H00670 Chr8 (117595..119046) [1452 bp, 483 aa] {ON} Anc_7.342    220   3e-64
NDAI0D00610 Chr4 (133678..135138) [1461 bp, 486 aa] {ON} Anc_7.3...   219   5e-64
Suva_4.83 Chr4 (155278..156666) [1389 bp, 462 aa] {ON} YDL161W (...   218   8e-64
Skud_4.94 Chr4 (163372..164715) [1344 bp, 447 aa] {ON} YDL161W (...   217   1e-63
Smik_4.75 Chr4 (144483..145865) [1383 bp, 460 aa] {ON} YDL161W (...   216   5e-63
Kpol_2001.70 s2001 complement(192214..193815) [1602 bp, 533 aa] ...   218   7e-63
YDL161W Chr4 (167714..169078) [1365 bp, 454 aa] {ON}  ENT1Epsin-...   214   2e-62
KNAG0C03800 Chr3 (746891..748234) [1344 bp, 447 aa] {ON} Anc_7.3...   214   3e-62
ZYRO0F11550g Chr6 complement(947131..948747) [1617 bp, 538 aa] {...   209   1e-59
SAKL0F10934g Chr6 (856966..858462) [1497 bp, 498 aa] {ON} some s...   208   1e-59
KLTH0H01430g Chr8 (132738..134246) [1509 bp, 502 aa] {ON} some s...   203   7e-58
KAFR0B00890 Chr2 (166365..167609) [1245 bp, 414 aa] {ON} Anc_7.3...   197   2e-56
Kwal_56.24610 s56 complement(1073855..1075381) [1527 bp, 508 aa]...   199   3e-56
KLLA0C16731g Chr3 complement(1463616..1465052) [1437 bp, 478 aa]...   197   6e-56
KNAG0B02650 Chr2 (511995..513935) [1941 bp, 646 aa] {ON} Anc_7.3...   198   8e-55
ACL157C Chr3 complement(79325..80872) [1548 bp, 515 aa] {ON} Syn...   177   3e-48
Ecym_4731 Chr4 (1427875..1429419) [1545 bp, 514 aa] {ON} similar...   174   6e-47
TBLA0E02040 Chr5 complement(494899..497004) [2106 bp, 701 aa] {O...   168   8e-44
KLTH0D16896g Chr4 complement(1395711..1396916) [1206 bp, 401 aa]...    87   2e-17
Kwal_47.16857 s47 (145176..146324) [1149 bp, 382 aa] {ON} YJR125...    85   7e-17
TBLA0E04760 Chr5 complement(1226806..1228086) [1281 bp, 426 aa] ...    83   4e-16
SAKL0G17952g Chr7 complement(1555520..1556767) [1248 bp, 415 aa]...    82   6e-16
KLLA0B04587g Chr2 (411097..412299) [1203 bp, 400 aa] {ON} simila...    81   1e-15
Suva_12.216 Chr12 complement(334254..335486) [1233 bp, 410 aa] {...    80   2e-15
NDAI0D03200 Chr4 complement(764129..765436) [1308 bp, 435 aa] {O...    80   2e-15
KNAG0M00380 Chr13 (56675..57886) [1212 bp, 403 aa] {ON} Anc_4.34...    80   2e-15
NCAS0A06210 Chr1 complement(1229758..1231029) [1272 bp, 423 aa] ...    80   3e-15
KAFR0B06740 Chr2 (1406075..1407274) [1200 bp, 399 aa] {ON} Anc_4...    79   7e-15
TDEL0D00710 Chr4 (127174..128301) [1128 bp, 375 aa] {ON} Anc_4.3...    79   7e-15
Skud_10.349 Chr10 complement(613398..614630) [1233 bp, 410 aa] {...    79   8e-15
YJR125C Chr10 complement(654737..655963) [1227 bp, 408 aa] {ON} ...    78   9e-15
Smik_10.418 Chr10 complement(643833..645062) [1230 bp, 409 aa] {...    78   1e-14
Kpol_1001.2 s1001 (8057..9313) [1257 bp, 418 aa] {ON} (8057..931...    77   3e-14
ZYRO0B14784g Chr2 complement(1205944..1207218) [1275 bp, 424 aa]...    76   6e-14
CAGL0H04323g Chr8 (407884..409122) [1239 bp, 412 aa] {ON} simila...    75   1e-13
AER155C Chr5 complement(929042..930136) [1095 bp, 364 aa] {ON} S...    72   6e-13
TPHA0B00400 Chr2 (83356..84555) [1200 bp, 399 aa] {ON} Anc_4.346...    72   1e-12
SAKL0H25762g Chr8 (2256842..2257630) [789 bp, 262 aa] {ON} some ...    70   1e-12
Ecym_1133 Chr1 (274069..275247) [1179 bp, 392 aa] {ON} similar t...    70   3e-12
Kwal_55.20611 s55 complement(489968..490732) [765 bp, 254 aa] {O...    66   3e-11
TBLA0G00650 Chr7 (140678..141949) [1272 bp, 423 aa] {ON} Anc_4.1...    62   2e-09
TDEL0G01740 Chr7 (342371..343144) [774 bp, 257 aa] {ON} Anc_4.17...    60   3e-09
Ecym_8407 Chr8 (843359..844123) [765 bp, 254 aa] {ON} similar to...    59   4e-09
KLTH0E05874g Chr5 complement(530814..531581) [768 bp, 255 aa] {O...    59   9e-09
ZYRO0G07876g Chr7 complement(636468..637247) [780 bp, 259 aa] {O...    58   1e-08
TPHA0F00230 Chr6 complement(43589..44431) [843 bp, 280 aa] {ON} ...    56   7e-08
TBLA0B06220 Chr2 (1466908..1467927) [1020 bp, 339 aa] {ON} Anc_4...    56   8e-08
Kpol_388.5 s388 complement(17825..18631) [807 bp, 268 aa] {ON} c...    55   2e-07
Smik_12.19 Chr12 complement(50134..50877) [744 bp, 247 aa] {ON} ...    54   2e-07
Suva_10.35 Chr10 complement(70188..70931) [744 bp, 247 aa] {ON} ...    54   3e-07
YLL038C Chr12 complement(65775..66518) [744 bp, 247 aa] {ON}  EN...    52   7e-07
Skud_12.30 Chr12 complement(56967..57710) [744 bp, 247 aa] {ON} ...    50   6e-06
ACL061C Chr3 complement(256803..257507) [705 bp, 234 aa] {ON} Sy...    49   1e-05
KLLA0D03949g Chr4 (333566..334243) [678 bp, 225 aa] {ON} similar...    49   1e-05
CAGL0E03806g Chr5 (356594..357376) [783 bp, 260 aa] {ON} similar...    47   7e-05
YHR161C Chr8 complement(420373..422286) [1914 bp, 637 aa] {ON}  ...    47   8e-05
SAKL0H02530g Chr8 (250148..252157) [2010 bp, 669 aa] {ON} weakly...    47   1e-04
Skud_8.225 Chr8 complement(391820..393685) [1866 bp, 621 aa] {ON...    46   2e-04
NCAS0C05840 Chr3 (1202292..1203095) [804 bp, 267 aa] {ON} Anc_4....    45   3e-04
KAFR0I01460 Chr9 (304865..305692) [828 bp, 275 aa] {ON} Anc_4.17...    44   9e-04
Smik_8.245 Chr8 complement(397342..399225) [1884 bp, 627 aa] {ON...    44   0.001
ZYRO0F13508g Chr6 complement(1114200..1116263) [2064 bp, 687 aa]...    43   0.002
NDAI0H00280 Chr8 complement(48177..49109) [933 bp, 310 aa] {ON} ...    41   0.007
TBLA0H01210 Chr8 (269471..270946) [1476 bp, 491 aa] {ON} Anc_8.3...    37   0.16 
KNAG0J02870 Chr10 (549107..550096) [990 bp, 329 aa] {ON} Anc_4.1...    36   0.23 
Kpol_344.8 s344 complement(20765..21919) [1155 bp, 384 aa] {ON} ...    34   1.1  
ZYRO0F13684g Chr6 complement(1125731..1126954) [1224 bp, 407 aa]...    34   1.3  
NDAI0A02830 Chr1 (636619..638040) [1422 bp, 473 aa] {ON} Anc_5.8...    33   3.2  
NDAI0A01470 Chr1 (326531..327634) [1104 bp, 367 aa] {ON} Anc_7.4...    32   3.7  
KAFR0B05800 Chr2 complement(1200666..1201814) [1149 bp, 382 aa] ...    32   5.0  
Kpol_1050.73 s1050 complement(162665..164488,164492..164527,1645...    32   5.3  
TBLA0F02620 Chr6 complement(634992..636440) [1449 bp, 482 aa] {O...    32   7.2  
TDEL0G01080 Chr7 (220997..222544) [1548 bp, 515 aa] {ON} Anc_5.8...    32   7.4  
Ecym_4433 Chr4 complement(893223..894923) [1701 bp, 566 aa] {ON}...    31   8.0  

>TBLA0E00480 Chr5 complement(88019..89818) [1800 bp, 599 aa] {ON}
           Anc_7.342 YLR206W
          Length = 599

 Score =  352 bits (902), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 184/273 (67%), Positives = 184/273 (67%)

Query: 1   MSKQFLRSTKNMVKGYSSTQILVRDATANDENTPSIDILDDIAEKTYDSVDFFEIMDMLD 60
           MSKQFLRSTKNMVKGYSSTQILVRDATANDENTPSIDILDDIAEKTYDSVDFFEIMDMLD
Sbjct: 1   MSKQFLRSTKNMVKGYSSTQILVRDATANDENTPSIDILDDIAEKTYDSVDFFEIMDMLD 60

Query: 61  KRLNDKGKYWKHVAKSLTVLDYLIRFGSENCVFWCKENLYLIKTLKEFRVDDAIDYNTGY 120
           KRLNDKGKYWKHVAKSLTVLDYLIRFGSENCVFWCKENLYLIKTLKEFRVDDAIDYNTGY
Sbjct: 61  KRLNDKGKYWKHVAKSLTVLDYLIRFGSENCVFWCKENLYLIKTLKEFRVDDAIDYNTGY 120

Query: 121 DQGQIVRVRATELTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNTSRSDFNRQRA 180
           DQGQIVRVRATELT                                  NTSRSDFNRQRA
Sbjct: 121 DQGQIVRVRATELTSLLMDDERLREERSLHSRGGRRSAPPPRMAPQRRNTSRSDFNRQRA 180

Query: 181 DDHYDDDLQKAIEESKRTAXXXXXXXXXXXXXXXXXFETAXXXXXXXXXXXXXXXXHXXX 240
           DDHYDDDLQKAIEESKRTA                 FETA                H   
Sbjct: 181 DDHYDDDLQKAIEESKRTAEEDERRRRNREGDQEDDFETALQLSKEEEELKKLQELHAQQ 240

Query: 241 XXXXXXXXXXXXXXXXXXXYTDIFGNPISYEEW 273
                              YTDIFGNPISYEEW
Sbjct: 241 IALQNQQNATPTTQNVANVYTDIFGNPISYEEW 273

 Score =  281 bits (719), Expect = 4e-86,   Method: Compositional matrix adjust.
 Identities = 144/199 (72%), Positives = 144/199 (72%)

Query: 401 PMVTGTNNPFXXXXXXXXXXXXXXXXXXXXXXXXXXXXFKQSTSVPPATQSSYTTKTNAS 460
           PMVTGTNNPF                            FKQSTSVPPATQSSYTTKTNAS
Sbjct: 401 PMVTGTNNPFSLSNINNPQQQQPPLMSSSSTTLPDLSSFKQSTSVPPATQSSYTTKTNAS 460

Query: 461 SLPPQPIPQMRTGNQEISDKYNNLNTLLATGTGIDTFGNTGDMRIPAQHTATGTFINSQG 520
           SLPPQPIPQMRTGNQEISDKYNNLNTLLATGTGIDTFGNTGDMRIPAQHTATGTFINSQG
Sbjct: 461 SLPPQPIPQMRTGNQEISDKYNNLNTLLATGTGIDTFGNTGDMRIPAQHTATGTFINSQG 520

Query: 521 TGYKQYINDPKNNPFMSNQYTGLPSTNVVPSYTGYGFGNQPQPQTXXXXXXXXXXXXXXX 580
           TGYKQYINDPKNNPFMSNQYTGLPSTNVVPSYTGYGFGNQPQPQT               
Sbjct: 521 TGYKQYINDPKNNPFMSNQYTGLPSTNVVPSYTGYGFGNQPQPQTTASQPNTQQYQQPNQ 580

Query: 581 XXXXXXXXXXXXGFSLIDL 599
                       GFSLIDL
Sbjct: 581 QHAQQQQNSNAQGFSLIDL 599

>KAFR0L01460 Chr12 complement(270433..272085) [1653 bp, 550 aa] {ON}
           Anc_7.342 YLR206W
          Length = 550

 Score =  228 bits (582), Expect = 9e-67,   Method: Compositional matrix adjust.
 Identities = 131/275 (47%), Positives = 153/275 (55%), Gaps = 17/275 (6%)

Query: 1   MSKQFLRSTKNMVKGYSSTQILVRDATANDENTPSIDILDDIAEKTYDSVDFFEIMDMLD 60
           MSKQF+RS KN++KGYSSTQ+LVRDAT+ND    +ID LDDIA ++YDSVDFFEIMDMLD
Sbjct: 1   MSKQFVRSAKNVMKGYSSTQVLVRDATSNDNRVTNIDTLDDIASRSYDSVDFFEIMDMLD 60

Query: 61  KRLNDKGKYWKHVAKSLTVLDYLIRFGSENCVFWCKENLYLIKTLKEFRVDDAIDYNTGY 120
           KRLNDKGKYWKH+ KSLTVLDYL+RFGSENCV WCKENLY+IKTL+EFR +D    +TG 
Sbjct: 61  KRLNDKGKYWKHIVKSLTVLDYLVRFGSENCVLWCKENLYVIKTLREFRYED----DTGI 116

Query: 121 DQGQIVRVRATELTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNTSRSDFNRQRA 180
           DQGQI+RV+A ELT                                   TSRS  N    
Sbjct: 117 DQGQIIRVKAKELTSLLQDEERLREERRFNNRRNRRNNRSANRSRA---TSRSQSNIGPD 173

Query: 181 DDHYDDDLQKAIEESKRTAXXXXXXXXXXXXXXXX--XFETAXXXXXXXXXXXXXXXXHX 238
               DDDLQ+ IEESK+TA                   F+ A                  
Sbjct: 174 ----DDDLQRVIEESKKTAEEDERRRKELARYDEEDPEFQAA----LQLSKEEEELKNLQ 225

Query: 239 XXXXXXXXXXXXXXXXXXXXXYTDIFGNPISYEEW 273
                                Y D+FGNPISY+E+
Sbjct: 226 DLQRQQQQLQMLQQQQTSANVYYDVFGNPISYDEY 260

 Score =  157 bits (396), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 77/118 (65%), Positives = 88/118 (74%), Gaps = 18/118 (15%)

Query: 463 PPQPIPQM-----------------RTGNQEISDKYNNLNTLLATGTGIDTFGNTGDMRI 505
           PPQ IPQ+                 RTGN+EI++KY+ LN LLA GTG+DTFGNTG  RI
Sbjct: 364 PPQQIPQVAMPPLPQQQEQQPLKQNRTGNEEITEKYSELNNLLAQGTGVDTFGNTGQERI 423

Query: 506 PAQHTATGTFINSQGTGYKQYIND-PKNNPFMSNQYTGLPSTNVVPSYTGYGFGNQPQ 562
           PAQHT TGTFINSQGTGYKQ  N+  KNNPF++ QYTGLPS+N+VPS TGYGFGNQPQ
Sbjct: 424 PAQHTKTGTFINSQGTGYKQVTNERSKNNPFLNTQYTGLPSSNIVPSSTGYGFGNQPQ 481

>YLR206W Chr12 (554578..556419) [1842 bp, 613 aa] {ON}
           ENT2Epsin-like protein required for endocytosis and
           actin patch assembly and functionally redundant with
           Ent1p; contains clathrin-binding motif at C-terminus
          Length = 613

 Score =  230 bits (586), Expect = 9e-67,   Method: Compositional matrix adjust.
 Identities = 114/199 (57%), Positives = 137/199 (68%), Gaps = 8/199 (4%)

Query: 1   MSKQFLRSTKNMVKGYSSTQILVRDATANDENTPSIDILDDIAEKTYDSVDFFEIMDMLD 60
           MSKQF+RS KNM+KGYSSTQ+LVRDATAND  TPSID LDD+A+++YDSVDFFEIMDMLD
Sbjct: 1   MSKQFVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60

Query: 61  KRLNDKGKYWKHVAKSLTVLDYLIRFGSENCVFWCKENLYLIKTLKEFRVDDAIDYNTGY 120
           KRLNDKGKYW+HVAKSLTVLDYL+RFGSENCV WC+EN Y+IKTL+EFR ++     +G+
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHEN----ESGF 116

Query: 121 DQGQIVRVRATELTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNTSRSDFNRQRA 180
           D+GQI+RV+A EL                                     S    N   +
Sbjct: 117 DEGQIIRVKAKELVSLLNDEERLREERSMNTRNRRANRAARPRPRRQRTRS----NPHDS 172

Query: 181 DDHYDDDLQKAIEESKRTA 199
              Y DDL+KA+EES+ TA
Sbjct: 173 SPSYQDDLEKALEESRITA 191

 Score =  176 bits (447), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 81/97 (83%), Positives = 89/97 (91%)

Query: 466 PIPQMRTGNQEISDKYNNLNTLLATGTGIDTFGNTGDMRIPAQHTATGTFINSQGTGYKQ 525
           P+ Q RTGNQ ISDKY++LNTLLATGTGIDTFGNTG+ RIPAQHT TGTFINSQGTGYKQ
Sbjct: 424 PLKQTRTGNQSISDKYSDLNTLLATGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGYKQ 483

Query: 526 YINDPKNNPFMSNQYTGLPSTNVVPSYTGYGFGNQPQ 562
             N+PKNNPF+SNQYTGLPSTN+VP+ TGYGFGNQPQ
Sbjct: 484 VTNEPKNNPFLSNQYTGLPSTNIVPTQTGYGFGNQPQ 520

>Suva_10.300 Chr10 (527412..529268) [1857 bp, 618 aa] {ON} YLR206W
           (REAL)
          Length = 618

 Score =  229 bits (585), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 114/199 (57%), Positives = 138/199 (69%), Gaps = 4/199 (2%)

Query: 1   MSKQFLRSTKNMVKGYSSTQILVRDATANDENTPSIDILDDIAEKTYDSVDFFEIMDMLD 60
           MSKQF+RS KNMVKGYSSTQ+LVRDATAND  TPSID LDD+A+++YDSVDFFEIMDMLD
Sbjct: 1   MSKQFVRSAKNMVKGYSSTQVLVRDATANDPRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60

Query: 61  KRLNDKGKYWKHVAKSLTVLDYLIRFGSENCVFWCKENLYLIKTLKEFRVDDAIDYNTGY 120
           KRLNDKGKYW+HVAKSLTVLDYL+RFGSENCV WC+EN Y+IKTL+EFR ++     +G+
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENE----SGF 116

Query: 121 DQGQIVRVRATELTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNTSRSDFNRQRA 180
           D+GQI+RV+A EL                                      R+  N   +
Sbjct: 117 DEGQIIRVKAKELVSLLNDDERLREERTMNTRNRRTNKTARPTPTPRPRRQRTRSNLYDS 176

Query: 181 DDHYDDDLQKAIEESKRTA 199
              Y +DL+KA+EES+ TA
Sbjct: 177 PPTYQNDLEKALEESRITA 195

 Score =  169 bits (429), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 77/97 (79%), Positives = 88/97 (90%)

Query: 466 PIPQMRTGNQEISDKYNNLNTLLATGTGIDTFGNTGDMRIPAQHTATGTFINSQGTGYKQ 525
           P+ Q RTGNQ ISDKYN+LN LLATGTG DTFGNTG+ RIPAQHT TGTFINSQGTGYKQ
Sbjct: 433 PLTQTRTGNQSISDKYNDLNVLLATGTGADTFGNTGESRIPAQHTKTGTFINSQGTGYKQ 492

Query: 526 YINDPKNNPFMSNQYTGLPSTNVVPSYTGYGFGNQPQ 562
            +N+PKNNPF+++QYTGLPST++VP+ TGYGFGNQPQ
Sbjct: 493 VVNEPKNNPFLNSQYTGLPSTSIVPTQTGYGFGNQPQ 529

>Smik_12.264 Chr12 (501598..503436) [1839 bp, 612 aa] {ON} YLR206W
           (REAL)
          Length = 612

 Score =  229 bits (584), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 113/199 (56%), Positives = 137/199 (68%), Gaps = 8/199 (4%)

Query: 1   MSKQFLRSTKNMVKGYSSTQILVRDATANDENTPSIDILDDIAEKTYDSVDFFEIMDMLD 60
           MSKQF+RS KNM+KGYSSTQ+LVRDATAND  TPSID LDD+A+++YDSVDFFEIMDMLD
Sbjct: 1   MSKQFVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60

Query: 61  KRLNDKGKYWKHVAKSLTVLDYLIRFGSENCVFWCKENLYLIKTLKEFRVDDAIDYNTGY 120
           KRLNDKGKYW+HVAKSLTVLDYL+RFGSENCV WC+EN Y+IKTL+EFR ++     +G+
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENE----SGF 116

Query: 121 DQGQIVRVRATELTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNTSRSDFNRQRA 180
           D+GQI+RV+A EL                                     S    N   +
Sbjct: 117 DEGQIIRVKAKELVSLLNDDERLREERSMNTRNRRDRSAARPRPRRQRTRS----NPHDS 172

Query: 181 DDHYDDDLQKAIEESKRTA 199
              Y +DL+KA+EES+ TA
Sbjct: 173 SPSYQNDLEKALEESRITA 191

 Score =  178 bits (452), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 82/97 (84%), Positives = 89/97 (91%)

Query: 466 PIPQMRTGNQEISDKYNNLNTLLATGTGIDTFGNTGDMRIPAQHTATGTFINSQGTGYKQ 525
           P+ Q RTGNQ ISDKYN+LNTLLATGTG DTFGNTG+ RIPAQHT TGTFINSQGTGYKQ
Sbjct: 425 PLKQTRTGNQSISDKYNDLNTLLATGTGTDTFGNTGEARIPAQHTKTGTFINSQGTGYKQ 484

Query: 526 YINDPKNNPFMSNQYTGLPSTNVVPSYTGYGFGNQPQ 562
            IN+PKNNPF+SNQYTGLPSTN+VP+ TGYGFGNQPQ
Sbjct: 485 VINEPKNNPFLSNQYTGLPSTNIVPTQTGYGFGNQPQ 521

>Skud_12.270 Chr12 (501192..503072) [1881 bp, 626 aa] {ON} YLR206W
           (REAL)
          Length = 626

 Score =  228 bits (582), Expect = 6e-66,   Method: Compositional matrix adjust.
 Identities = 112/199 (56%), Positives = 137/199 (68%), Gaps = 8/199 (4%)

Query: 1   MSKQFLRSTKNMVKGYSSTQILVRDATANDENTPSIDILDDIAEKTYDSVDFFEIMDMLD 60
           M KQF+RS KNMVKGYSSTQ+LVRDATAND  TPSID LDD+A+++YDSVDFFEIMDMLD
Sbjct: 1   MPKQFVRSAKNMVKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60

Query: 61  KRLNDKGKYWKHVAKSLTVLDYLIRFGSENCVFWCKENLYLIKTLKEFRVDDAIDYNTGY 120
           KRLNDKGKYW+HVAKSLTVLDYL+RFGSENCV WC+EN Y+IKTL+EFR ++     +G+
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENE----SGF 116

Query: 121 DQGQIVRVRATELTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNTSRSDFNRQRA 180
           D+GQI+RV+A EL                                      R+  N + +
Sbjct: 117 DEGQIIRVKAKELVSLLNDDERLREERSMNTRNRGANKAPRPGPRR----QRTGSNPRDS 172

Query: 181 DDHYDDDLQKAIEESKRTA 199
              Y D+L+K +EES+ TA
Sbjct: 173 SPSYQDELEKVLEESRITA 191

 Score =  173 bits (439), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 79/97 (81%), Positives = 88/97 (90%)

Query: 466 PIPQMRTGNQEISDKYNNLNTLLATGTGIDTFGNTGDMRIPAQHTATGTFINSQGTGYKQ 525
           P+ Q RTGNQ ISDKYN+LN LLATGTG+DTFGNTG+ RIPAQHT TGTFINSQGTGYKQ
Sbjct: 450 PLEQTRTGNQSISDKYNDLNVLLATGTGLDTFGNTGEARIPAQHTKTGTFINSQGTGYKQ 509

Query: 526 YINDPKNNPFMSNQYTGLPSTNVVPSYTGYGFGNQPQ 562
             ++PKNNPF+SNQYTGLPSTN+VP+ TGYGFGNQPQ
Sbjct: 510 VTSEPKNNPFLSNQYTGLPSTNIVPTQTGYGFGNQPQ 546

>TDEL0C02050 Chr3 (355071..356576) [1506 bp, 501 aa] {ON} Anc_7.342
           YLR206W
          Length = 501

 Score =  224 bits (571), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 113/199 (56%), Positives = 137/199 (68%), Gaps = 17/199 (8%)

Query: 1   MSKQFLRSTKNMVKGYSSTQILVRDATANDENTPSIDILDDIAEKTYDSVDFFEIMDMLD 60
           MSKQF+RS KN+VKGYSS Q+LVR+ATAN+   PS+D LD++AEKTYDSV+FFEIMDM+D
Sbjct: 1   MSKQFVRSAKNVVKGYSSAQVLVRNATANESEGPSVDELDELAEKTYDSVEFFEIMDMID 60

Query: 61  KRLNDKGKYWKHVAKSLTVLDYLIRFGSENCVFWCKENLYLIKTLKEFRVDDAIDYNTGY 120
           KRLNDKGKYW+H+AKSLTVLDYL+RFGSENCV WC+ENLY+IKTL EFR DD    + G 
Sbjct: 61  KRLNDKGKYWRHIAKSLTVLDYLVRFGSENCVLWCRENLYVIKTLMEFRNDD----DGGV 116

Query: 121 DQGQIVRVRATELTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNTSRSDFNRQRA 180
           DQGQI+RV+A ELT                                  N +R        
Sbjct: 117 DQGQIIRVKAKELT-------------NLLSDDERLREEREMNRKGRKNGTRRRRRTTGE 163

Query: 181 DDHYDDDLQKAIEESKRTA 199
            D +DDDLQ+A++ES+ TA
Sbjct: 164 QDGFDDDLQRALDESRLTA 182

 Score =  147 bits (371), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 64/90 (71%), Positives = 78/90 (86%)

Query: 470 MRTGNQEISDKYNNLNTLLATGTGIDTFGNTGDMRIPAQHTATGTFINSQGTGYKQYIND 529
           +RTG+  +++KY  LN LLATGTGIDTFGNTGD RIPAQHT TGTFINSQGTGY+Q   +
Sbjct: 389 VRTGDLAMTEKYGELNKLLATGTGIDTFGNTGDARIPAQHTKTGTFINSQGTGYRQVTGE 448

Query: 530 PKNNPFMSNQYTGLPSTNVVPSYTGYGFGN 559
           PK NPF+ +QYTG+PS+N+VP++TGYGFGN
Sbjct: 449 PKKNPFLQSQYTGIPSSNIVPAHTGYGFGN 478

>CAGL0A03872g Chr1 complement(392922..394454) [1533 bp, 510 aa] {ON}
           highly similar to uniprot|Q05785 Saccharomyces
           cerevisiae YLR206w ENT2
          Length = 510

 Score =  224 bits (570), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 112/198 (56%), Positives = 136/198 (68%), Gaps = 10/198 (5%)

Query: 1   MSKQFLRSTKNMVKGYSSTQILVRDATANDENTPSIDILDDIAEKTYDSVDFFEIMDMLD 60
           M  Q +RS KNMVKGYSSTQ++VRDATAND  +PS+ +L+D+A+KTYD+V+FFEIMDMLD
Sbjct: 1   MPSQLVRSAKNMVKGYSSTQVMVRDATANDSTSPSVGVLEDLADKTYDTVEFFEIMDMLD 60

Query: 61  KRLNDKGKYWKHVAKSLTVLDYLIRFGSENCVFWCKENLYLIKTLKEFRVDDAIDYNTGY 120
           KRLNDKGKYW+HVAKSLTVLDYL+RFGSENCV WCKENLY+IKTL+EFR +D +   +G 
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDEV---SGS 117

Query: 121 DQGQIVRVRATELTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNTSRSDFNRQRA 180
           D+GQI+RV+A ELT                                     RS       
Sbjct: 118 DEGQIIRVKAKELT-------SLLTDDERLREERALNRANRRNGDAKRRRRRSRSRSTSY 170

Query: 181 DDHYDDDLQKAIEESKRT 198
            + YDDDLQKA+EES+ T
Sbjct: 171 RNAYDDDLQKALEESRMT 188

 Score =  160 bits (406), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 73/90 (81%), Positives = 82/90 (91%)

Query: 469 QMRTGNQEISDKYNNLNTLLATGTGIDTFGNTGDMRIPAQHTATGTFINSQGTGYKQYIN 528
           + RTGNQ ISDKY+ LN LLA+GTGIDTFGNTG+ RIPAQHT TGTFINSQGTGYKQ  N
Sbjct: 360 KTRTGNQSISDKYSELNNLLASGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGYKQVTN 419

Query: 529 DPKNNPFMSNQYTGLPSTNVVPSYTGYGFG 558
           +PKNNPF+S+QYTGLPSTN+VPS+TGYGFG
Sbjct: 420 EPKNNPFLSSQYTGLPSTNIVPSHTGYGFG 449

>TPHA0D04560 Chr4 complement(994552..996015) [1464 bp, 487 aa] {ON}
           Anc_7.342 YLR206W
          Length = 487

 Score =  223 bits (569), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 104/134 (77%), Positives = 118/134 (88%), Gaps = 2/134 (1%)

Query: 1   MSKQFLRSTKNMVKGYSSTQILVRDATANDENTPSIDILDDIAEKTYDSVDFFEIMDMLD 60
           MS QF+RS KN+VKGYSSTQ+LVR+ATAN+   P+ID+L DIAEKTYDS DFFEIMDMLD
Sbjct: 1   MSNQFVRSMKNVVKGYSSTQVLVRNATANEGTGPNIDLLADIAEKTYDSADFFEIMDMLD 60

Query: 61  KRLNDKGKYWKHVAKSLTVLDYLIRFGSENCVFWCKENLYLIKTLKEFRVDDAIDYNTGY 120
           KRLNDKGKYWKH+AKSLTVLDYL+RFGSENCV WCKENLYLIKTL EFR +D  + + G 
Sbjct: 61  KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYLIKTLTEFRYED--ENSGGV 118

Query: 121 DQGQIVRVRATELT 134
           DQGQI+RV+A ELT
Sbjct: 119 DQGQIIRVKAKELT 132

 Score =  146 bits (368), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 65/88 (73%), Positives = 78/88 (88%)

Query: 471 RTGNQEISDKYNNLNTLLATGTGIDTFGNTGDMRIPAQHTATGTFINSQGTGYKQYINDP 530
           RTGN+E+++KYN LN LLA+GTGIDTFGNTG+ RIPAQHT TGTFINSQGTGY+Q   + 
Sbjct: 375 RTGNKEMTNKYNELNQLLASGTGIDTFGNTGETRIPAQHTQTGTFINSQGTGYRQQSGES 434

Query: 531 KNNPFMSNQYTGLPSTNVVPSYTGYGFG 558
           K NPF+SNQYTGLPS+N++P+ TGYGFG
Sbjct: 435 KVNPFLSNQYTGLPSSNIIPTQTGYGFG 462

>NCAS0H00670 Chr8 (117595..119046) [1452 bp, 483 aa] {ON} Anc_7.342
          Length = 483

 Score =  220 bits (561), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 99/134 (73%), Positives = 120/134 (89%), Gaps = 4/134 (2%)

Query: 1   MSKQFLRSTKNMVKGYSSTQILVRDATANDENTPSIDILDDIAEKTYDSVDFFEIMDMLD 60
           MSKQF+RS KNMVKGYS+TQ+LVRDAT+ND + PS ++L ++A++++DSVDFFEIMDMLD
Sbjct: 1   MSKQFVRSAKNMVKGYSTTQVLVRDATSNDASNPSFELLYELAQRSFDSVDFFEIMDMLD 60

Query: 61  KRLNDKGKYWKHVAKSLTVLDYLIRFGSENCVFWCKENLYLIKTLKEFRVDDAIDYNTGY 120
           KRLNDKGKYW+HVAKSLTVLDYL+RFGSENCV WCKENLY+IKTL+EFR +D    + G 
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHED----DGGA 116

Query: 121 DQGQIVRVRATELT 134
           DQGQI+RV+A ELT
Sbjct: 117 DQGQIIRVKAKELT 130

 Score =  160 bits (404), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 73/91 (80%), Positives = 82/91 (90%)

Query: 471 RTGNQEISDKYNNLNTLLATGTGIDTFGNTGDMRIPAQHTATGTFINSQGTGYKQYINDP 530
           RTGNQ I+DKY+ LNTLLATGTGIDTFGNTG+ RIPAQHT TGTFINSQGTGY+Q  NDP
Sbjct: 370 RTGNQSITDKYSQLNTLLATGTGIDTFGNTGEQRIPAQHTQTGTFINSQGTGYRQVTNDP 429

Query: 531 KNNPFMSNQYTGLPSTNVVPSYTGYGFGNQP 561
           KNNPF+++QYTGLPSTN+V + TGYGFGN P
Sbjct: 430 KNNPFLNSQYTGLPSTNIVSTQTGYGFGNAP 460

>NDAI0D00610 Chr4 (133678..135138) [1461 bp, 486 aa] {ON} Anc_7.342
           YDL161W
          Length = 486

 Score =  219 bits (559), Expect = 5e-64,   Method: Compositional matrix adjust.
 Identities = 110/199 (55%), Positives = 136/199 (68%), Gaps = 13/199 (6%)

Query: 1   MSKQFLRSTKNMVKGYSSTQILVRDATANDENTPSIDILDDIAEKTYDSVDFFEIMDMLD 60
           MSKQF+RS KNM+KGYS+TQ+LVRDAT+ND + PS +IL +I+++++DSVDFFEIMDMLD
Sbjct: 1   MSKQFVRSAKNMMKGYSTTQVLVRDATSNDSSNPSFEILYEISKRSFDSVDFFEIMDMLD 60

Query: 61  KRLNDKGKYWKHVAKSLTVLDYLIRFGSENCVFWCKENLYLIKTLKEFRVDDAIDYNTGY 120
           KRLNDKGKYWKH+AKSLTVLDYL+RFGSENCV WCK+NLY+IKTLKEF+++D        
Sbjct: 61  KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKQNLYIIKTLKEFKLED-----DNV 115

Query: 121 DQGQIVRVRATELTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNTSRSDFNRQRA 180
           D+  I+RV+A ELT                                  N SR   N  R 
Sbjct: 116 DESSIIRVKAKELT--------ALLQDDERLKEERSINLKNNRRSERKNRSRRGTNATRR 167

Query: 181 DDHYDDDLQKAIEESKRTA 199
               D+DLQKA+EES+ TA
Sbjct: 168 GTKSDEDLQKALEESRITA 186

 Score =  158 bits (400), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 73/88 (82%), Positives = 80/88 (90%), Gaps = 1/88 (1%)

Query: 471 RTGNQEISDKYNNLNTLLATGTGIDTFGNTGDMRIPAQHTATGTFINSQGTGYKQYINDP 530
           RTGNQ ISDKYN LN LLA+GTGIDTFGNTGD RIPAQHT TGTFINSQGTGYKQ +NDP
Sbjct: 369 RTGNQSISDKYNELNNLLASGTGIDTFGNTGDQRIPAQHTQTGTFINSQGTGYKQIVNDP 428

Query: 531 -KNNPFMSNQYTGLPSTNVVPSYTGYGF 557
            K NPF++NQYTGLPS+N+VPS+TGYGF
Sbjct: 429 VKKNPFLNNQYTGLPSSNIVPSHTGYGF 456

>Suva_4.83 Chr4 (155278..156666) [1389 bp, 462 aa] {ON} YDL161W
           (REAL)
          Length = 462

 Score =  218 bits (556), Expect = 8e-64,   Method: Compositional matrix adjust.
 Identities = 102/134 (76%), Positives = 116/134 (86%), Gaps = 4/134 (2%)

Query: 1   MSKQFLRSTKNMVKGYSSTQILVRDATANDENTPSIDILDDIAEKTYDSVDFFEIMDMLD 60
           MSKQ +RS KN+VKGYSSTQ+LVR+AT+ND N  S D L ++AEK+YDS DFFEIMDMLD
Sbjct: 1   MSKQLVRSAKNLVKGYSSTQVLVRNATSNDNNQVSKDSLIELAEKSYDSADFFEIMDMLD 60

Query: 61  KRLNDKGKYWKHVAKSLTVLDYLIRFGSENCVFWCKENLYLIKTLKEFRVDDAIDYNTGY 120
           KRLNDKGKYW+H+AK+LTVLDYLIRFGSENCV WCKENLY+IKTLKEFR DD    + G 
Sbjct: 61  KRLNDKGKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHDD----DEGT 116

Query: 121 DQGQIVRVRATELT 134
           DQGQIVRV+A ELT
Sbjct: 117 DQGQIVRVKAKELT 130

 Score =  167 bits (422), Expect = 9e-45,   Method: Compositional matrix adjust.
 Identities = 75/101 (74%), Positives = 88/101 (87%)

Query: 465 QPIPQMRTGNQEISDKYNNLNTLLATGTGIDTFGNTGDMRIPAQHTATGTFINSQGTGYK 524
           +P+ Q RTGNQ ++DKY+ LN LL TGTGIDTFGN GD R+PAQHT TGTFINSQGTGY+
Sbjct: 347 EPLTQTRTGNQSMTDKYSKLNELLGTGTGIDTFGNFGDTRVPAQHTKTGTFINSQGTGYR 406

Query: 525 QYINDPKNNPFMSNQYTGLPSTNVVPSYTGYGFGNQPQPQT 565
           Q  NDPK+NPF+++QYTGLPSTNVVP+ TGYGFGNQPQ Q+
Sbjct: 407 QVSNDPKHNPFLNSQYTGLPSTNVVPAQTGYGFGNQPQQQS 447

>Skud_4.94 Chr4 (163372..164715) [1344 bp, 447 aa] {ON} YDL161W
           (REAL)
          Length = 447

 Score =  217 bits (553), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 101/134 (75%), Positives = 117/134 (87%), Gaps = 4/134 (2%)

Query: 1   MSKQFLRSTKNMVKGYSSTQILVRDATANDENTPSIDILDDIAEKTYDSVDFFEIMDMLD 60
           MSKQF+RS KN+VKGYSSTQ+LVR+AT+ND +  S D L ++AEK+YDS DFFEIMDMLD
Sbjct: 1   MSKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLD 60

Query: 61  KRLNDKGKYWKHVAKSLTVLDYLIRFGSENCVFWCKENLYLIKTLKEFRVDDAIDYNTGY 120
           KRLNDKGKYW+H+AK+LTVLDYLIRFGSENCV WCKENLY+IKTLKEFR +D    + G 
Sbjct: 61  KRLNDKGKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHED----DEGV 116

Query: 121 DQGQIVRVRATELT 134
           DQGQIVRV+A ELT
Sbjct: 117 DQGQIVRVKAKELT 130

 Score =  157 bits (398), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 70/93 (75%), Positives = 80/93 (86%)

Query: 466 PIPQMRTGNQEISDKYNNLNTLLATGTGIDTFGNTGDMRIPAQHTATGTFINSQGTGYKQ 525
           P+ Q RTGNQ ++DKY  LN LLATGTGIDTFGN GD R+PAQHT TGTFINSQGTGY+Q
Sbjct: 333 PLTQTRTGNQSMTDKYGKLNELLATGTGIDTFGNVGDSRVPAQHTKTGTFINSQGTGYRQ 392

Query: 526 YINDPKNNPFMSNQYTGLPSTNVVPSYTGYGFG 558
             NDPK NPF+++QYTGLPSTN+VP+ TGYGFG
Sbjct: 393 VSNDPKQNPFLNSQYTGLPSTNIVPTQTGYGFG 425

>Smik_4.75 Chr4 (144483..145865) [1383 bp, 460 aa] {ON} YDL161W
           (REAL)
          Length = 460

 Score =  216 bits (550), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 111/199 (55%), Positives = 135/199 (67%), Gaps = 17/199 (8%)

Query: 1   MSKQFLRSTKNMVKGYSSTQILVRDATANDENTPSIDILDDIAEKTYDSVDFFEIMDMLD 60
           MSKQF+RS KN+VKGYSSTQ+LVR+AT+ND +  S D L ++AEK+YDS DFFEIMDMLD
Sbjct: 1   MSKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLD 60

Query: 61  KRLNDKGKYWKHVAKSLTVLDYLIRFGSENCVFWCKENLYLIKTLKEFRVDDAIDYNTGY 120
           KRLNDKGKYW+H+AK+LTVLDYLIRFGSENCV WCKENLY+IKTLKEFR +D    + G 
Sbjct: 61  KRLNDKGKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHED----DEGI 116

Query: 121 DQGQIVRVRATELTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNTSRSDFNRQRA 180
           DQGQIVRV++ ELT                                     RS     R+
Sbjct: 117 DQGQIVRVKSKELT-------------ALLSDDERLNEERNMNIKGRNRKGRSRRGTGRS 163

Query: 181 DDHYDDDLQKAIEESKRTA 199
            +  D+DLQ+A++ S+ TA
Sbjct: 164 SNDNDNDLQRALDASRMTA 182

 Score =  162 bits (409), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 74/94 (78%), Positives = 81/94 (86%)

Query: 465 QPIPQMRTGNQEISDKYNNLNTLLATGTGIDTFGNTGDMRIPAQHTATGTFINSQGTGYK 524
           +P+ Q RTGNQ ++DKYN LN LLATGTGIDTFGN GD R+PAQHT TGTFINSQGTGYK
Sbjct: 345 EPLTQTRTGNQSMTDKYNKLNELLATGTGIDTFGNVGDARVPAQHTKTGTFINSQGTGYK 404

Query: 525 QYINDPKNNPFMSNQYTGLPSTNVVPSYTGYGFG 558
           Q  NDPK NPF+S QYTGLPSTNVVP+ TGYGFG
Sbjct: 405 QVSNDPKYNPFLSGQYTGLPSTNVVPTQTGYGFG 438

>Kpol_2001.70 s2001 complement(192214..193815) [1602 bp, 533 aa]
           {ON} complement(192214..193815) [1602 nt, 534 aa]
          Length = 533

 Score =  218 bits (554), Expect = 7e-63,   Method: Compositional matrix adjust.
 Identities = 115/199 (57%), Positives = 132/199 (66%), Gaps = 21/199 (10%)

Query: 1   MSKQFLRSTKNMVKGYSSTQILVRDATANDENTPSIDILDDIAEKTYDSVDFFEIMDMLD 60
           M KQF+RS KN+VKGYSSTQ++VR+AT+ND   P ID LD +AEKTYDSV+FFEIMDMLD
Sbjct: 1   MPKQFVRSAKNVVKGYSSTQVMVRNATSNDSGGPDIDTLDALAEKTYDSVEFFEIMDMLD 60

Query: 61  KRLNDKGKYWKHVAKSLTVLDYLIRFGSENCVFWCKENLYLIKTLKEFRVDDAIDYNTGY 120
           KRLNDKGKYWKH+AKSLTVLDYL+RFGSENCV WCKENLY+I+TLKEF   D  D    +
Sbjct: 61  KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYIIQTLKEFSYIDDSD----H 116

Query: 121 DQGQIVRVRATELTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNTSRSDFNRQRA 180
           DQGQI+RV+A ELT                                      SD      
Sbjct: 117 DQGQIIRVKAKELTSLLNDEERLRDERGMNRRGGRRERARPR-------RRPSD------ 163

Query: 181 DDHYDDDLQKAIEESKRTA 199
               DD+LQ+AIEESKRTA
Sbjct: 164 ----DDELQRAIEESKRTA 178

 Score =  159 bits (401), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 71/89 (79%), Positives = 82/89 (92%)

Query: 471 RTGNQEISDKYNNLNTLLATGTGIDTFGNTGDMRIPAQHTATGTFINSQGTGYKQYINDP 530
           RTGNQ+I+DK+  LN LLA+GTGIDTFGNTG+ RIPAQHT TGTFINSQGTGY+Q  NDP
Sbjct: 384 RTGNQDITDKFGELNQLLASGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGYRQVTNDP 443

Query: 531 KNNPFMSNQYTGLPSTNVVPSYTGYGFGN 559
           KNNPF+++QYTGLPSTN+VPS+TGYGFGN
Sbjct: 444 KNNPFLNSQYTGLPSTNIVPSHTGYGFGN 472

>YDL161W Chr4 (167714..169078) [1365 bp, 454 aa] {ON}
           ENT1Epsin-like protein involved in endocytosis and actin
           patch assembly and functionally redundant with Ent2p;
           binds clathrin via a clathrin-binding domain motif at
           C-terminus
          Length = 454

 Score =  214 bits (545), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 99/134 (73%), Positives = 117/134 (87%), Gaps = 4/134 (2%)

Query: 1   MSKQFLRSTKNMVKGYSSTQILVRDATANDENTPSIDILDDIAEKTYDSVDFFEIMDMLD 60
           MSKQF+RS KN+VKGYSSTQ+LVR+AT+ND +  S D L ++AEK+YDS DFFEIMDMLD
Sbjct: 1   MSKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLD 60

Query: 61  KRLNDKGKYWKHVAKSLTVLDYLIRFGSENCVFWCKENLYLIKTLKEFRVDDAIDYNTGY 120
           KRLNDKGKYW+H+AK+LTV+DYLIRFGSENCV WC+ENLY+IKTLKEFR +D    + G 
Sbjct: 61  KRLNDKGKYWRHIAKALTVIDYLIRFGSENCVLWCRENLYIIKTLKEFRHED----DEGI 116

Query: 121 DQGQIVRVRATELT 134
           DQGQIVRV+A ELT
Sbjct: 117 DQGQIVRVKAKELT 130

 Score =  150 bits (378), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 72/120 (60%), Positives = 92/120 (76%), Gaps = 2/120 (1%)

Query: 440 KQSTSVPPATQ--SSYTTKTNASSLPPQPIPQMRTGNQEISDKYNNLNTLLATGTGIDTF 497
           +QS+S P   Q  ++ + +        +P+ Q RTGNQ ++DKY+ LN LLATGTGIDTF
Sbjct: 312 EQSSSSPKRNQLVAASSPQQLQQQKQQEPLIQNRTGNQSMTDKYSKLNELLATGTGIDTF 371

Query: 498 GNTGDMRIPAQHTATGTFINSQGTGYKQYINDPKNNPFMSNQYTGLPSTNVVPSYTGYGF 557
           GN G+ RIPAQHT TGTFINSQGTGY+Q  +DP +NPF+++QYTGLPST+VVP+ TGYGF
Sbjct: 372 GNVGEARIPAQHTKTGTFINSQGTGYRQVSDDPNHNPFLNSQYTGLPSTSVVPTQTGYGF 431

>KNAG0C03800 Chr3 (746891..748234) [1344 bp, 447 aa] {ON} Anc_7.342
           YLR206W
          Length = 447

 Score =  214 bits (544), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 106/195 (54%), Positives = 136/195 (69%), Gaps = 17/195 (8%)

Query: 5   FLRSTKNMVKGYSSTQILVRDATANDENTPSIDILDDIAEKTYDSVDFFEIMDMLDKRLN 64
            LRS KN+VKGYS T++LVRDATAN+   PS ++LDD+A+K+Y+SV+FFEI+DMLDKR+N
Sbjct: 1   MLRSAKNIVKGYSDTEVLVRDATANNSTNPSRELLDDLADKSYNSVEFFEILDMLDKRIN 60

Query: 65  DKGKYWKHVAKSLTVLDYLIRFGSENCVFWCKENLYLIKTLKEFRVDDAIDYNTGYDQGQ 124
           DKGKYW+HVAK+LTVLDYL+RFGSENCV WC+ENLY+IKTL+EF  +DA     G D+G+
Sbjct: 61  DKGKYWRHVAKALTVLDYLVRFGSENCVIWCQENLYIIKTLREFSHEDA----GGEDEGK 116

Query: 125 IVRVRATELTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNTSRSDFNRQRADDHY 184
           I+RV+A ELT                                     RS  +R+R ++  
Sbjct: 117 IIRVKAKELTSLLMDEERLKEERAMNIRRRGGPK------------RRSGGSRER-NNRS 163

Query: 185 DDDLQKAIEESKRTA 199
           D+DLQ+AIEESKRTA
Sbjct: 164 DEDLQRAIEESKRTA 178

 Score =  158 bits (399), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 74/117 (63%), Positives = 90/117 (76%)

Query: 444 SVPPATQSSYTTKTNASSLPPQPIPQMRTGNQEISDKYNNLNTLLATGTGIDTFGNTGDM 503
           S P +T ++        +   +P+ Q R+GNQ ISDKY+ LN LLA+GTGIDTFGNTG+ 
Sbjct: 312 SAPASTTAARPAAIETPATQTKPLTQTRSGNQAISDKYSALNNLLASGTGIDTFGNTGEQ 371

Query: 504 RIPAQHTATGTFINSQGTGYKQYINDPKNNPFMSNQYTGLPSTNVVPSYTGYGFGNQ 560
           RIPAQHT TGTFINSQGTGY+Q  ND K NPF++ QYTGLPSTN+VP+ TG+GFGNQ
Sbjct: 372 RIPAQHTQTGTFINSQGTGYRQVNNDDKPNPFLNGQYTGLPSTNIVPTQTGFGFGNQ 428

>ZYRO0F11550g Chr6 complement(947131..948747) [1617 bp, 538 aa] {ON}
           some similarities with uniprot|Q12518 Saccharomyces
           cerevisiae YDL161W ENT1
          Length = 538

 Score =  209 bits (532), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 93/134 (69%), Positives = 114/134 (85%), Gaps = 4/134 (2%)

Query: 1   MSKQFLRSTKNMVKGYSSTQILVRDATANDENTPSIDILDDIAEKTYDSVDFFEIMDMLD 60
           M  QF+RS KN +KGY+S Q+LVRDATAN+   PS+D+LD++A ++YDSV+FFEIMDM+D
Sbjct: 1   MPTQFVRSAKNALKGYTSAQVLVRDATANEVEGPSVDMLDELAHRSYDSVEFFEIMDMID 60

Query: 61  KRLNDKGKYWKHVAKSLTVLDYLIRFGSENCVFWCKENLYLIKTLKEFRVDDAIDYNTGY 120
           KRLNDKGKYW+HVAKSLTVLDYL+RFGSENCV WC+ENLY+IKTL+EFR DD    +   
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENLYIIKTLREFRHDD----DGTQ 116

Query: 121 DQGQIVRVRATELT 134
           D GQI+RV+A ELT
Sbjct: 117 DGGQIIRVKAKELT 130

 Score =  157 bits (398), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 70/96 (72%), Positives = 83/96 (86%)

Query: 464 PQPIPQMRTGNQEISDKYNNLNTLLATGTGIDTFGNTGDMRIPAQHTATGTFINSQGTGY 523
           PQP+  +RTGNQ ISDKYN+LN LLA  TG+DTFGN GD RIPAQHT TGTFINSQGTG+
Sbjct: 417 PQPMQPVRTGNQSISDKYNDLNQLLAQPTGVDTFGNVGDARIPAQHTKTGTFINSQGTGF 476

Query: 524 KQYINDPKNNPFMSNQYTGLPSTNVVPSYTGYGFGN 559
           KQY N+PK NPF+  Q+TG+P+++VVPS+TGYGFGN
Sbjct: 477 KQYSNEPKKNPFLPTQFTGIPTSSVVPSHTGYGFGN 512

>SAKL0F10934g Chr6 (856966..858462) [1497 bp, 498 aa] {ON} some
           similarities with uniprot|Q12518 Saccharomyces
           cerevisiae YDL161W ENT1
          Length = 498

 Score =  208 bits (529), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 104/199 (52%), Positives = 130/199 (65%), Gaps = 19/199 (9%)

Query: 1   MSKQFLRSTKNMVKGYSSTQILVRDATANDENTPSIDILDDIAEKTYDSVDFFEIMDMLD 60
           MSK  LR+ KN+V GYSS Q+LVR+AT+N+   P++D LD++AEKTYD+V+FFEIMDMLD
Sbjct: 1   MSKALLRTAKNVVNGYSSVQVLVRNATSNEPTGPTVDQLDELAEKTYDNVEFFEIMDMLD 60

Query: 61  KRLNDKGKYWKHVAKSLTVLDYLIRFGSENCVFWCKENLYLIKTLKEFRVDDAIDYNTGY 120
           KRLNDKGK W+HVAKSLTVLDYL+R+GSENCV W +ENLY+IKTL+EF  +D +    G 
Sbjct: 61  KRLNDKGKNWRHVAKSLTVLDYLVRYGSENCVLWSQENLYIIKTLREFMHEDEM----GV 116

Query: 121 DQGQIVRVRATELTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNTSRSDFNRQRA 180
           D GQI+RV+A ELT                                          R R 
Sbjct: 117 DHGQIIRVKAKELTSLLRDEERLTEERNMRKKRRGKTRRPE---------------RSRG 161

Query: 181 DDHYDDDLQKAIEESKRTA 199
            + YDDDLQ+A+EES+ TA
Sbjct: 162 GEEYDDDLQRALEESRLTA 180

 Score =  153 bits (387), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 73/90 (81%), Positives = 79/90 (87%), Gaps = 1/90 (1%)

Query: 471 RTGNQEISDKYNNLNTLLATGTGIDTFGNTGDMRIPAQHTATGTFINSQGTGYKQYIND- 529
           RTGNQ IS KYN+LN LLA+GTG+DTFGNTG  RIPAQHT TG FINSQGTGYKQ  ND 
Sbjct: 375 RTGNQSISQKYNDLNNLLASGTGLDTFGNTGQTRIPAQHTRTGNFINSQGTGYKQVTNDQ 434

Query: 530 PKNNPFMSNQYTGLPSTNVVPSYTGYGFGN 559
           PKNNPF++ QYTGLPST+VVPSYTGYGFGN
Sbjct: 435 PKNNPFLAAQYTGLPSTSVVPSYTGYGFGN 464

>KLTH0H01430g Chr8 (132738..134246) [1509 bp, 502 aa] {ON} some
           similarities with uniprot|Q12518 Saccharomyces
           cerevisiae YDL161W ENT1
          Length = 502

 Score =  203 bits (517), Expect = 7e-58,   Method: Compositional matrix adjust.
 Identities = 104/199 (52%), Positives = 132/199 (66%), Gaps = 23/199 (11%)

Query: 1   MSKQFLRSTKNMVKGYSSTQILVRDATANDENTPSIDILDDIAEKTYDSVDFFEIMDMLD 60
           MSK  +R  KN+V GYS+TQ+L+R+AT+ND + PS+D++D+IAE+++DSV FFEIMDMLD
Sbjct: 1   MSKSLMRRAKNVVNGYSTTQVLLREATSNDPDGPSLDLMDEIAERSWDSVSFFEIMDMLD 60

Query: 61  KRLNDKGKYWKHVAKSLTVLDYLIRFGSENCVFWCKENLYLIKTLKEFRVDDAIDYNTGY 120
           KRLNDKGK W+HVAKSLTVLDYL+R GSE+CV W KENLY+IKTL+EF  +D     TG 
Sbjct: 61  KRLNDKGKNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYIIKTLREFTHED----ETGV 116

Query: 121 DQGQIVRVRATELTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNTSRSDFNRQRA 180
           DQGQIVRV+A ELT                                          R++ 
Sbjct: 117 DQGQIVRVKARELTALLQDEERLREERELKG-------------------RNRRPRRRKN 157

Query: 181 DDHYDDDLQKAIEESKRTA 199
            D YDDD+Q+A+EES+ TA
Sbjct: 158 SDSYDDDMQRALEESRMTA 176

 Score =  149 bits (376), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 70/92 (76%), Positives = 80/92 (86%), Gaps = 2/92 (2%)

Query: 471 RTGNQEISDKYNNLNTLLATGTGIDTFGNTGDMRIPAQHTATGTFINSQGTGYKQYINDP 530
           RTGNQ ++DK+++LN LLA+GTG+DTFGNTG  RIPAQHT TGTFINSQGTGYKQ  N P
Sbjct: 388 RTGNQSVTDKFSDLNNLLASGTGLDTFGNTGQTRIPAQHTKTGTFINSQGTGYKQVSNMP 447

Query: 531 --KNNPFMSNQYTGLPSTNVVPSYTGYGFGNQ 560
             K+NPF+  QYTGLPST+VVPSYTGYGFGNQ
Sbjct: 448 QGKHNPFLGQQYTGLPSTSVVPSYTGYGFGNQ 479

>KAFR0B00890 Chr2 (166365..167609) [1245 bp, 414 aa] {ON} Anc_7.342
           YLR206W
          Length = 414

 Score =  197 bits (501), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 91/130 (70%), Positives = 107/130 (82%), Gaps = 4/130 (3%)

Query: 5   FLRSTKNMVKGYSSTQILVRDATANDENTPSIDILDDIAEKTYDSVDFFEIMDMLDKRLN 64
            LRS KN+VKGYSSTQ LVRDAT+N  + P ID L ++AE TY++++FFEIMDMLDKR+N
Sbjct: 1   MLRSAKNLVKGYSSTQKLVRDATSNSHDNPPIDQLSELAEMTYNNMEFFEIMDMLDKRIN 60

Query: 65  DKGKYWKHVAKSLTVLDYLIRFGSENCVFWCKENLYLIKTLKEFRVDDAIDYNTGYDQGQ 124
            KGKYWKHV KSL VLDYL+RFGSENCV WCKENLY+IKTL+EF  +D     +G DQGQ
Sbjct: 61  SKGKYWKHVIKSLIVLDYLVRFGSENCVIWCKENLYIIKTLREFTYEDE----SGMDQGQ 116

Query: 125 IVRVRATELT 134
           +VRVRA ELT
Sbjct: 117 MVRVRAKELT 126

 Score =  152 bits (385), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 82/159 (51%), Positives = 98/159 (61%), Gaps = 30/159 (18%)

Query: 401 PMVTGTNNPFXXXXXXXXXXXXXXXXXXXXXXXXXXXXFKQSTSVPPATQSSYTTKTNAS 460
           P+ TG+NNPF                             +Q T  P    ++  T+    
Sbjct: 275 PLATGSNNPFALNNKK----------------------LQQHTPEPSVIDTTLNTQA--- 309

Query: 461 SLPPQPIPQMRTGNQEISDKYNNLNTLLATGTGIDTFGNTGDMRIPAQHTATGTFINSQG 520
                P+ Q RTG+Q ISDKY+ LNTLLATGTGIDTFGNTG+ RIPAQHT TGTFINSQG
Sbjct: 310 -----PLKQTRTGSQSISDKYSALNTLLATGTGIDTFGNTGNQRIPAQHTKTGTFINSQG 364

Query: 521 TGYKQYINDPKNNPFMSNQYTGLPSTNVVPSYTGYGFGN 559
           TGYKQ   +  NN F+++QYTGLPS+N+VPS TGYGFGN
Sbjct: 365 TGYKQVSTNGFNNVFLNSQYTGLPSSNIVPSQTGYGFGN 403

>Kwal_56.24610 s56 complement(1073855..1075381) [1527 bp, 508 aa]
           {ON} YDL161W (ENT1) - Ent1p [contig 161] FULL
          Length = 508

 Score =  199 bits (506), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 103/199 (51%), Positives = 129/199 (64%), Gaps = 23/199 (11%)

Query: 1   MSKQFLRSTKNMVKGYSSTQILVRDATANDENTPSIDILDDIAEKTYDSVDFFEIMDMLD 60
           MSK  +R  KN+V GYS+TQ+L+R+AT+ND   PS+DI+D+IAE+++DSV FFEIMDMLD
Sbjct: 1   MSKSLIRKAKNVVNGYSTTQVLLREATSNDPEGPSLDIMDEIAERSWDSVSFFEIMDMLD 60

Query: 61  KRLNDKGKYWKHVAKSLTVLDYLIRFGSENCVFWCKENLYLIKTLKEFRVDDAIDYNTGY 120
           KRLNDKGK W+HVAKSLTVLDYL+R GSE+CV W KENLY+IKTL+EF  +D +    G 
Sbjct: 61  KRLNDKGKNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYVIKTLREFMHEDEL----GI 116

Query: 121 DQGQIVRVRATELTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNTSRSDFNRQRA 180
           DQGQIVRV+A ELT                                   T      R+  
Sbjct: 117 DQGQIVRVKARELT-------------------ALLLDDERLREERSLRTKNRKPRRRPT 157

Query: 181 DDHYDDDLQKAIEESKRTA 199
               D+DLQ+A+EES+ TA
Sbjct: 158 AGSEDEDLQRAMEESRLTA 176

 Score =  148 bits (373), Expect = 9e-38,   Method: Compositional matrix adjust.
 Identities = 67/88 (76%), Positives = 76/88 (86%)

Query: 471 RTGNQEISDKYNNLNTLLATGTGIDTFGNTGDMRIPAQHTATGTFINSQGTGYKQYINDP 530
           RTGNQ I++K++ LN LLA+GTG+DTFGNTG  RIPAQHT TG FINSQGTGYKQ  + P
Sbjct: 396 RTGNQSITEKHSELNNLLASGTGLDTFGNTGQTRIPAQHTKTGNFINSQGTGYKQVSSTP 455

Query: 531 KNNPFMSNQYTGLPSTNVVPSYTGYGFG 558
           K+NPF+  QYTGLPSTNVVPSYTGYGFG
Sbjct: 456 KHNPFLGQQYTGLPSTNVVPSYTGYGFG 483

>KLLA0C16731g Chr3 complement(1463616..1465052) [1437 bp, 478 aa]
           {ON} some similarities with uniprot|Q12518 Saccharomyces
           cerevisiae YDL161W ENT1
          Length = 478

 Score =  197 bits (502), Expect = 6e-56,   Method: Compositional matrix adjust.
 Identities = 90/134 (67%), Positives = 111/134 (82%), Gaps = 3/134 (2%)

Query: 1   MSKQFLRSTKNMVKGYSSTQILVRDATANDENTPSIDILDDIAEKTYDSVDFFEIMDMLD 60
           MSK FLRS KN+V GYS  Q+LVR AT+ND++ PS+D L+++AE+T+D+V+FFEIMDMLD
Sbjct: 1   MSKAFLRSAKNLVNGYSQAQVLVRSATSNDKDGPSVDQLEELAERTFDNVEFFEIMDMLD 60

Query: 61  KRLNDKGKYWKHVAKSLTVLDYLIRFGSENCVFWCKENLYLIKTLKEFRVDDAIDYNTGY 120
           KRLNDKG+ W+HVAKSLT LD+L+R GSENCVFWCKENLY+IKTL+EF   D     T  
Sbjct: 61  KRLNDKGRNWRHVAKSLTCLDFLVRCGSENCVFWCKENLYIIKTLREFTHTDEF---TEI 117

Query: 121 DQGQIVRVRATELT 134
           D G+IVRV+A ELT
Sbjct: 118 DNGEIVRVKAKELT 131

 Score =  160 bits (404), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 71/97 (73%), Positives = 86/97 (88%), Gaps = 1/97 (1%)

Query: 465 QPIPQMRTGNQEISDKYNNLNTLLATGTGIDTFGNTGDMRIPAQHTATGTFINSQGTGYK 524
           +P+P+ RTGNQ ISDK++ LN LLA+GTGIDTFGNTG+ R+PAQHT TGTFINSQGTGYK
Sbjct: 354 KPVPKQRTGNQSISDKFSELNNLLASGTGIDTFGNTGETRVPAQHTKTGTFINSQGTGYK 413

Query: 525 QYIND-PKNNPFMSNQYTGLPSTNVVPSYTGYGFGNQ 560
           Q  ND PK+NPF+++QYTG+PS+ + PSYTGYGFGNQ
Sbjct: 414 QITNDAPKHNPFLTSQYTGIPSSAIAPSYTGYGFGNQ 450

>KNAG0B02650 Chr2 (511995..513935) [1941 bp, 646 aa] {ON} Anc_7.342
           YLR206W
          Length = 646

 Score =  198 bits (503), Expect = 8e-55,   Method: Compositional matrix adjust.
 Identities = 108/226 (47%), Positives = 134/226 (59%), Gaps = 36/226 (15%)

Query: 1   MSKQFLRSTKNMVKGYSSTQILVRDATANDENTPSIDILDDIAEKTYDSVDFFEIMDMLD 60
           MS+QF+RS KN++KGYSSTQ+LVRDATAND  TP +D L+DIA  ++DSVDFFEIMD+L+
Sbjct: 1   MSRQFVRSAKNVMKGYSSTQVLVRDATANDGRTPHLDTLEDIAGLSFDSVDFFEIMDVLE 60

Query: 61  KRLNDKGKYWKHVAKSLTVLDYLIRFGSENCVFWCKENLYLIKTLKEFR-VDDAIDYNTG 119
           KRLND GKYW+H+ KSLTVLDYL+RFGSE+C  W +++L+L+K L+ FR VDD I    G
Sbjct: 61  KRLNDSGKYWRHIEKSLTVLDYLVRFGSEHCADWARDHLFLLKALRNFRFVDDGI----G 116

Query: 120 YDQGQIVRVRATELTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNTSRSDFNRQR 179
           +DQGQIVRV+A +L                                           RQR
Sbjct: 117 FDQGQIVRVKARDLVELLQSGEQLGGRKAKRARGASRRDRGRRRGGDRGGGEY----RQR 172

Query: 180 ADD----HY-----------------------DDDLQKAIEESKRT 198
            DD    +Y                       DDDLQ+AIEESKRT
Sbjct: 173 GDDPEDEYYPRPAGGPPPQRQGYESGGARGNDDDDLQRAIEESKRT 218

 Score =  152 bits (384), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 70/100 (70%), Positives = 85/100 (85%), Gaps = 3/100 (3%)

Query: 464 PQPIPQMRTGNQEISDKYNNLNTLLATGTGIDTFGNTGDMRIPAQHTATGTFINSQGTGY 523
           PQP+P+M TGNQE+++KY+ LN LLA GTG+DTFGN G  RIPAQHT TGTFINSQGTG+
Sbjct: 488 PQPMPRMNTGNQEVTNKYSELNNLLAQGTGVDTFGNEGTQRIPAQHTQTGTFINSQGTGF 547

Query: 524 KQYIN---DPKNNPFMSNQYTGLPSTNVVPSYTGYGFGNQ 560
           KQ  +   DP +NPF+++QYTGLPST +VP+YTGYGFGNQ
Sbjct: 548 KQVNSEGKDPNSNPFLNSQYTGLPSTGIVPAYTGYGFGNQ 587

>ACL157C Chr3 complement(79325..80872) [1548 bp, 515 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR206W
           (ENT2) and YDL161W (ENT1)
          Length = 515

 Score =  177 bits (450), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 93/203 (45%), Positives = 125/203 (61%), Gaps = 26/203 (12%)

Query: 1   MSKQFLRSTKNMVKGYSSTQILVRDATANDENTPSIDILDDIAEKTYDSVDFFEIMDMLD 60
           MSKQ LRS KN+V GYS  QILVR+AT+N+E  PS+D ++++AE++Y +V+FFEI+ MLD
Sbjct: 1   MSKQLLRSAKNVVNGYSPAQILVRNATSNEEYGPSMDQMEELAERSYSAVEFFEIVVMLD 60

Query: 61  KRLNDKGKYWKHVAKSLTVLDYLIRFGSENCVFWCKENLYLIKTLKEFRVDDAIDYNTGY 120
           KRL+DK K+W+HVAKSLTV D+L+R G+E CV W +ENLYL + L EF     +D +TG 
Sbjct: 61  KRLSDKPKHWRHVAKSLTVTDFLVRTGAETCVDWARENLYLFRRLTEFY---HVDESTGV 117

Query: 121 DQGQIVRVRATELTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNTSRSDFNRQRA 180
           D GQI+RV+A EL                                      R+  NRQ +
Sbjct: 118 DHGQIIRVKARELV-------------------ALLRDEERLREERNMRLGRNPRNRQAS 158

Query: 181 ----DDHYDDDLQKAIEESKRTA 199
                +  D DLQ+A+EES+ TA
Sbjct: 159 VPPPAEDLDPDLQRALEESRITA 181

 Score =  154 bits (389), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 75/99 (75%), Positives = 86/99 (86%), Gaps = 4/99 (4%)

Query: 465 QPIPQM---RTGNQEISDKYNNLNTLLATGTGIDTFGNTGDMRIPAQHTATGTFINSQGT 521
           QP PQ+   RTGNQ I+DKY+ LNTLLA+GTG+DTFGNTG  RIPAQHT TGTFINSQGT
Sbjct: 393 QPGPQLQPTRTGNQSITDKYSELNTLLASGTGLDTFGNTGQTRIPAQHTKTGTFINSQGT 452

Query: 522 GYKQYIND-PKNNPFMSNQYTGLPSTNVVPSYTGYGFGN 559
           GYKQ  N+ PK+NPF++ QYTGLPSTN+VPS+TGYGFGN
Sbjct: 453 GYKQVGNEPPKHNPFIATQYTGLPSTNMVPSHTGYGFGN 491

>Ecym_4731 Chr4 (1427875..1429419) [1545 bp, 514 aa] {ON} similar to
           Ashbya gossypii ACL157C
          Length = 514

 Score =  174 bits (440), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 77/133 (57%), Positives = 105/133 (78%), Gaps = 3/133 (2%)

Query: 1   MSKQFLRSTKNMVKGYSSTQILVRDATANDENTPSIDILDDIAEKTYDSVDFFEIMDMLD 60
           MSKQ LRS KN++ GYS  Q+LVR+AT+NDE  PS+D ++++AE+TY +V+FFEIM MLD
Sbjct: 1   MSKQLLRSAKNVMNGYSQAQVLVRNATSNDEYGPSLDQMEELAERTYSAVEFFEIMVMLD 60

Query: 61  KRLNDKGKYWKHVAKSLTVLDYLIRFGSENCVFWCKENLYLIKTLKEFRVDDAIDYNTGY 120
           +RLNDK K W+HVAKSLTV DYL+R G+E CV W +EN+++I+ L EF     +D ++G 
Sbjct: 61  RRLNDKPKNWRHVAKSLTVTDYLVRTGAEACVDWARENMFIIRKLTEFV---HVDESSGT 117

Query: 121 DQGQIVRVRATEL 133
           D GQ++RV+A EL
Sbjct: 118 DHGQLIRVKAKEL 130

 Score =  144 bits (364), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 68/90 (75%), Positives = 76/90 (84%), Gaps = 1/90 (1%)

Query: 471 RTGNQEISDKYNNLNTLLATGTGIDTFGNTGDMRIPAQHTATGTFINSQGTGYKQYIND- 529
           RTGNQ ISDKY  LN LLATGTGIDTFGNTG  RI +QHT T TFINS GTG+KQ  N+ 
Sbjct: 404 RTGNQSISDKYGELNALLATGTGIDTFGNTGQARISSQHTKTETFINSHGTGFKQVSNEP 463

Query: 530 PKNNPFMSNQYTGLPSTNVVPSYTGYGFGN 559
           PK+NPF++ QYTGLPSTN+VPS+TGYGFGN
Sbjct: 464 PKHNPFLTTQYTGLPSTNIVPSHTGYGFGN 493

>TBLA0E02040 Chr5 complement(494899..497004) [2106 bp, 701 aa] {ON}
           Anc_7.342 YLR206W
          Length = 701

 Score =  168 bits (425), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 75/133 (56%), Positives = 103/133 (77%), Gaps = 4/133 (3%)

Query: 1   MSKQFLRSTKNMVKGYSSTQILVRDATANDENTPSIDILDDIAEKTYDSVDFFEIMDMLD 60
           MS QF+RSTKNM KGYS TQ+LVRDATAN+++  SID+LD + E +YD+ +F +I  +LD
Sbjct: 1   MSHQFVRSTKNMFKGYSPTQVLVRDATANNDSGTSIDVLDQLGEMSYDTHEFRDIFSVLD 60

Query: 61  KRLNDKGKYWKHVAKSLTVLDYLIRFGSENCVFWCKENLYLIKTLKEFRVDDAIDYNTGY 120
           +R++DK KYW+HVAKSLTV+DYL+RFGSE CV W ++N   ++ L++F   D+     G 
Sbjct: 61  RRISDKPKYWRHVAKSLTVVDYLVRFGSEACVQWARDNARQLEILRDFYYSDS----AGI 116

Query: 121 DQGQIVRVRATEL 133
           DQGQ++RV+A EL
Sbjct: 117 DQGQLIRVKAAEL 129

 Score =  109 bits (272), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 57/80 (71%)

Query: 470 MRTGNQEISDKYNNLNTLLATGTGIDTFGNTGDMRIPAQHTATGTFINSQGTGYKQYIND 529
           M TGN  IS KY+NLN LLA GTGIDTFGN G  RIPAQHT TGTFINSQGTGYKQ  + 
Sbjct: 594 MHTGNSVISAKYSNLNQLLAQGTGIDTFGNEGATRIPAQHTKTGTFINSQGTGYKQVTSS 653

Query: 530 PKNNPFMSNQYTGLPSTNVV 549
               P +  QYTGLP+   V
Sbjct: 654 SSPIPLLPTQYTGLPAQTAV 673

>KLTH0D16896g Chr4 complement(1395711..1396916) [1206 bp, 401 aa]
           {ON} similar to uniprot|P47160 Saccharomyces cerevisiae
           YJR125C ENT3 Protein containing an N-terminal epsin-like
           domain involved in clathrin recruitment and traffic
           between the Golgi and endosomes associates with the
           clathrin adaptor Gga2p
          Length = 401

 Score = 86.7 bits (213), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 49/133 (36%), Positives = 77/133 (57%), Gaps = 5/133 (3%)

Query: 2   SKQFLRSTKNMVKGYSSTQILVRDATANDENTPSIDILDDIAEKTYDSVDFFEIMDMLDK 61
           +K++ R  +NMV  Y+  +  VR+AT N+    S  +++ I++ TY+  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNMVFNYTEMEAKVREATNNEPWGASSTLMEQISQGTYNYREREEILGMIFR 74

Query: 62  RLNDK-GKYWKHVAKSLTVLDYLIRFGSENCVFWCKENLYLIKTLKEFRVDDAIDYNTGY 120
           R  +K    W+ + K+L +LDYLIR G+E  +   + NL LIK L+ F   D+     G 
Sbjct: 75  RFTEKTASEWRQIYKALQLLDYLIRHGAERFIDDTRANLSLIKMLESFHYIDS----QGR 130

Query: 121 DQGQIVRVRATEL 133
           DQG  VR RA EL
Sbjct: 131 DQGINVRNRAHEL 143

>Kwal_47.16857 s47 (145176..146324) [1149 bp, 382 aa] {ON} YJR125C
           (ENT3) - Ent3p [contig 219] FULL
          Length = 382

 Score = 84.7 bits (208), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 49/134 (36%), Positives = 77/134 (57%), Gaps = 5/134 (3%)

Query: 2   SKQFLRSTKNMVKGYSSTQILVRDATANDENTPSIDILDDIAEKTYDSVDFFEIMDMLDK 61
           +K++ R  +N+V  Y+  +  VR+AT N+    S  +++ IA+ TY+  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMEAKVREATNNEPWGASSTLMEQIAQGTYNYREREEILGMIFR 74

Query: 62  RLNDK-GKYWKHVAKSLTVLDYLIRFGSENCVFWCKENLYLIKTLKEFRVDDAIDYNTGY 120
           R  +K    W+ + K+L +LDYLIR G+E  +   + NL LIK L+ F   D+     G 
Sbjct: 75  RFTEKTASEWRQIYKALQLLDYLIRHGAERFIDDTRANLSLIKMLESFHYIDS----QGR 130

Query: 121 DQGQIVRVRATELT 134
           DQG  VR RA EL 
Sbjct: 131 DQGINVRNRAHELA 144

>TBLA0E04760 Chr5 complement(1226806..1228086) [1281 bp, 426 aa]
           {ON} Anc_4.346 YJR125C
          Length = 426

 Score = 82.8 bits (203), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 45/134 (33%), Positives = 77/134 (57%), Gaps = 5/134 (3%)

Query: 2   SKQFLRSTKNMVKGYSSTQILVRDATANDENTPSIDILDDIAEKTYDSVDFFEIMDMLDK 61
           +K++ R  +N+V  Y+  +  VR+AT N+    S  +++ IA+ TY+  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTDMEAKVREATNNEPWGASSTLMEQIAQGTYNPREREEILSMILR 74

Query: 62  RLNDK-GKYWKHVAKSLTVLDYLIRFGSENCVFWCKENLYLIKTLKEFRVDDAIDYNTGY 120
           R  +K G  W+ + K+L +L+YLI  G+E  +   + +L LI+ L+ F   D+     G 
Sbjct: 75  RFTEKSGNLWRQIYKALQLLEYLITHGAERFIDEARSSLGLIRMLESFHYVDS----EGR 130

Query: 121 DQGQIVRVRATELT 134
           DQG  VR RA  +T
Sbjct: 131 DQGANVRSRAQAMT 144

>SAKL0G17952g Chr7 complement(1555520..1556767) [1248 bp, 415 aa]
           {ON} similar to uniprot|P47160 Saccharomyces cerevisiae
           YJR125C ENT3 Protein containing an N-terminal epsin-like
           domain involved in clathrin recruitment and traffic
           between the Golgi and endosomes associates with the
           clathrin adaptor Gga2p
          Length = 415

 Score = 82.0 bits (201), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 47/133 (35%), Positives = 76/133 (57%), Gaps = 5/133 (3%)

Query: 2   SKQFLRSTKNMVKGYSSTQILVRDATANDENTPSIDILDDIAEKTYDSVDFFEIMDMLDK 61
           +K++ R  +N+V  Y+  +  VR+AT N+    S  +++ I+  TY+  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMEAKVREATNNEPWGASSTLMEQISAGTYNYREREEILGMIFR 74

Query: 62  RLNDK-GKYWKHVAKSLTVLDYLIRFGSENCVFWCKENLYLIKTLKEFRVDDAIDYNTGY 120
           R  +K    W+ + K+L +L+YLI+ GSE  +   + NL LIK L+ F   D+     G 
Sbjct: 75  RFTEKTASEWRQIYKALQLLEYLIKHGSERFIDDSRANLTLIKMLESFHYTDS----QGR 130

Query: 121 DQGQIVRVRATEL 133
           DQG  VR RA EL
Sbjct: 131 DQGINVRNRAQEL 143

>KLLA0B04587g Chr2 (411097..412299) [1203 bp, 400 aa] {ON} similar
           to uniprot|P47160 Saccharomyces cerevisiae YJR125C ENT3
           Protein containing an N-terminal epsin-like domain
           involved in clathrin recruitment and traffic between the
           Golgi and endosomes associates with the clathrin adaptor
           Gga2p
          Length = 400

 Score = 81.3 bits (199), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 45/133 (33%), Positives = 78/133 (58%), Gaps = 5/133 (3%)

Query: 2   SKQFLRSTKNMVKGYSSTQILVRDATANDENTPSIDILDDIAEKTYDSVDFFEIMDMLDK 61
           +K++ R  +N+V  Y+  +  VR+AT N+    S  +++ IA+ TY+  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMEAKVREATNNEPWGASSTLMEHIAQGTYNYREREEILGMIFR 74

Query: 62  RLNDK-GKYWKHVAKSLTVLDYLIRFGSENCVFWCKENLYLIKTLKEFRVDDAIDYNTGY 120
           R  +K    W+ + K+L +L+YL++ GSE  +   + NL L+K L+ F   D+     G 
Sbjct: 75  RFTEKTASEWRQIYKALQLLEYLVKHGSERFIDDVRTNLNLVKMLESFHYIDS----QGR 130

Query: 121 DQGQIVRVRATEL 133
           DQG  VR RA++L
Sbjct: 131 DQGINVRNRASQL 143

>Suva_12.216 Chr12 complement(334254..335486) [1233 bp, 410 aa] {ON}
           YJR125C (REAL)
          Length = 410

 Score = 80.5 bits (197), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 46/133 (34%), Positives = 76/133 (57%), Gaps = 5/133 (3%)

Query: 2   SKQFLRSTKNMVKGYSSTQILVRDATANDENTPSIDILDDIAEKTYDSVDFFEIMDMLDK 61
           +K++ R  +N+V  Y+  +  VR+AT N+    S  ++D I++ TY+  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMEGKVREATNNEPWGASSTLMDQISQGTYNFREREEILSMIFR 74

Query: 62  RLNDK-GKYWKHVAKSLTVLDYLIRFGSENCVFWCKENLYLIKTLKEFRVDDAIDYNTGY 120
           R  +K G  W+ + K+L +LDYLI+ GSE  +   + ++ LIK L+ F   D+     G 
Sbjct: 75  RFTEKAGSEWRQIYKALQLLDYLIKHGSERFIDDTRSSINLIKILESFHYTDS----QGR 130

Query: 121 DQGQIVRVRATEL 133
           DQG  VR R   L
Sbjct: 131 DQGINVRTRVKAL 143

>NDAI0D03200 Chr4 complement(764129..765436) [1308 bp, 435 aa] {ON}
           Anc_4.346
          Length = 435

 Score = 80.5 bits (197), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 47/134 (35%), Positives = 78/134 (58%), Gaps = 5/134 (3%)

Query: 2   SKQFLRSTKNMVKGYSSTQILVRDATANDENTPSIDILDDIAEKTYDSVDFFEIMDMLDK 61
           +K++ R  +N+V  Y+  +  VR+AT N+    S  +++ IA+ TY+  + +EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMESKVREATNNEPWGASSTLMEQIAQGTYNVRERYEIVGMIFR 74

Query: 62  RLNDK-GKYWKHVAKSLTVLDYLIRFGSENCVFWCKENLYLIKTLKEFRVDDAIDYNTGY 120
           R  +K G  W+ + K+L +LDYLI+ GSE  +   + +L LI+ L+ F   D+     G 
Sbjct: 75  RFTEKAGSEWRQIYKALQLLDYLIKHGSEPFIDDVRSSLKLIQMLETFHYIDS----EGR 130

Query: 121 DQGQIVRVRATELT 134
           DQG  VR RA  L 
Sbjct: 131 DQGINVRNRAKLLV 144

>KNAG0M00380 Chr13 (56675..57886) [1212 bp, 403 aa] {ON} Anc_4.346
           YJR125C
          Length = 403

 Score = 80.1 bits (196), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 45/133 (33%), Positives = 77/133 (57%), Gaps = 5/133 (3%)

Query: 2   SKQFLRSTKNMVKGYSSTQILVRDATANDENTPSIDILDDIAEKTYDSVDFFEIMDMLDK 61
           +K++ R  +N+V  ++  +  VR+AT N+    S  +++ IA+ TY+  +  E+M ML +
Sbjct: 15  AKKYFRKAQNVVFNFTEMESKVREATNNEPWGASSTLMEQIAQGTYNYKEREEVMMMLMR 74

Query: 62  RLNDK-GKYWKHVAKSLTVLDYLIRFGSENCVFWCKENLYLIKTLKEFRVDDAIDYNTGY 120
           R  +K G  W+ + K+L +LDYLIR GSE  +   +  L +++ L+ F   D    + G 
Sbjct: 75  RFTEKAGSEWRQIYKALQLLDYLIRRGSEKFIDDVRAALRIVRLLESFHYID----SQGR 130

Query: 121 DQGQIVRVRATEL 133
           DQG  VR RA ++
Sbjct: 131 DQGVNVRNRAKQI 143

>NCAS0A06210 Chr1 complement(1229758..1231029) [1272 bp, 423 aa]
           {ON} Anc_4.346
          Length = 423

 Score = 80.1 bits (196), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 46/133 (34%), Positives = 77/133 (57%), Gaps = 5/133 (3%)

Query: 2   SKQFLRSTKNMVKGYSSTQILVRDATANDENTPSIDILDDIAEKTYDSVDFFEIMDMLDK 61
           +K++ R  +N+V  Y+  +  VR+AT N+    S  +++ IA+ TY+  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMEGKVREATNNEPWGASSTLMEQIAQGTYNIREREEILSMIFR 74

Query: 62  RLNDK-GKYWKHVAKSLTVLDYLIRFGSENCVFWCKENLYLIKTLKEFRVDDAIDYNTGY 120
           R  +K G  W+ + K+L +LDYLI+ GSE  +   + ++ ++K L+ F   DA     G 
Sbjct: 75  RFTEKTGSEWRQIYKALQLLDYLIKHGSEKFIDDVRSSVAVLKLLQTFHYIDA----EGR 130

Query: 121 DQGQIVRVRATEL 133
           DQG  VR R T L
Sbjct: 131 DQGINVRNRVTTL 143

>KAFR0B06740 Chr2 (1406075..1407274) [1200 bp, 399 aa] {ON}
           Anc_4.346 YJR125C
          Length = 399

 Score = 78.6 bits (192), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 48/133 (36%), Positives = 77/133 (57%), Gaps = 5/133 (3%)

Query: 2   SKQFLRSTKNMVKGYSSTQILVRDATANDENTPSIDILDDIAEKTYDSVDFFEIMDMLDK 61
           +K++ R  +N+V  Y+  +  VR+AT N+    S  +++ IA+ TY+  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMEGKVREATNNEPWGASSTLMEQIAQGTYNLREREEILGMIFR 74

Query: 62  RLNDK-GKYWKHVAKSLTVLDYLIRFGSENCVFWCKENLYLIKTLKEFRVDDAIDYNTGY 120
           R  +K G  W+ + KSL +LDYLIR GSE  +   + ++ LI+ L+ F   D+     G 
Sbjct: 75  RFTEKAGSEWRQIYKSLQLLDYLIRRGSERFIDDVRSSIRLIELLETFHYIDS----QGR 130

Query: 121 DQGQIVRVRATEL 133
           DQG  VR RA  L
Sbjct: 131 DQGINVRNRAKAL 143

>TDEL0D00710 Chr4 (127174..128301) [1128 bp, 375 aa] {ON} Anc_4.346
           YJR125C
          Length = 375

 Score = 78.6 bits (192), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 46/134 (34%), Positives = 76/134 (56%), Gaps = 5/134 (3%)

Query: 2   SKQFLRSTKNMVKGYSSTQILVRDATANDENTPSIDILDDIAEKTYDSVDFFEIMDMLDK 61
           +K++ R  +N+V  Y+  +  VR+AT N+    S  +++ I++ TY+  +  EI+ M+ +
Sbjct: 15  AKKYFRRAQNVVFNYTDMEAKVREATNNEPWGASTTLMEQISQGTYNMREREEILGMIFR 74

Query: 62  RLNDK-GKYWKHVAKSLTVLDYLIRFGSENCVFWCKENLYLIKTLKEFRVDDAIDYNTGY 120
           RL +K    W+ + K+L +LDYLIR  SE  +   + ++ LIK L+ F   D+     G 
Sbjct: 75  RLTEKRANEWRQIYKALQLLDYLIRHASERFIDDTRSSISLIKMLESFHYIDS----QGR 130

Query: 121 DQGQIVRVRATELT 134
           DQG  VR RA  L 
Sbjct: 131 DQGINVRNRAKALA 144

>Skud_10.349 Chr10 complement(613398..614630) [1233 bp, 410 aa] {ON}
           YJR125C (REAL)
          Length = 410

 Score = 78.6 bits (192), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 46/133 (34%), Positives = 76/133 (57%), Gaps = 5/133 (3%)

Query: 2   SKQFLRSTKNMVKGYSSTQILVRDATANDENTPSIDILDDIAEKTYDSVDFFEIMDMLDK 61
           +K++ R  +N+V  Y+  +  VR+AT N+    S  ++D I++ TY+  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMEGKVREATNNEPWGASSTLMDQISQGTYNFREREEILSMIFR 74

Query: 62  RLNDK-GKYWKHVAKSLTVLDYLIRFGSENCVFWCKENLYLIKTLKEFRVDDAIDYNTGY 120
           R  +K G  W+ + K+L +LDYLI+ GSE  +   + ++ LIK L+ F   D+     G 
Sbjct: 75  RFTEKAGSEWRQIYKALQLLDYLIKHGSERFIDDTRSSINLIKILETFHYIDS----QGR 130

Query: 121 DQGQIVRVRATEL 133
           DQG  VR R   L
Sbjct: 131 DQGINVRTRVKTL 143

>YJR125C Chr10 complement(654737..655963) [1227 bp, 408 aa] {ON}
           ENT3Protein containing an N-terminal epsin-like domain
           involved in clathrin recruitment and traffic between the
           Golgi and endosomes; associates with the clathrin
           adaptor Gga2p
          Length = 408

 Score = 78.2 bits (191), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 45/133 (33%), Positives = 76/133 (57%), Gaps = 5/133 (3%)

Query: 2   SKQFLRSTKNMVKGYSSTQILVRDATANDENTPSIDILDDIAEKTYDSVDFFEIMDMLDK 61
           +K++ R  +N+V  Y+  +  VR+AT N+    S  ++D I++ TY+  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMEGKVREATNNEPWGASSTLMDQISQGTYNFREREEILSMIFR 74

Query: 62  RLNDK-GKYWKHVAKSLTVLDYLIRFGSENCVFWCKENLYLIKTLKEFRVDDAIDYNTGY 120
           R  +K G  W+ + K+L +LDYLI+ GSE  +   + ++ LI+ L+ F   D+     G 
Sbjct: 75  RFTEKAGSEWRQIYKALQLLDYLIKHGSERFIDDTRNSINLIRILETFHYIDS----QGR 130

Query: 121 DQGQIVRVRATEL 133
           DQG  VR R   L
Sbjct: 131 DQGINVRTRVKAL 143

>Smik_10.418 Chr10 complement(643833..645062) [1230 bp, 409 aa] {ON}
           YJR125C (REAL)
          Length = 409

 Score = 78.2 bits (191), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 45/133 (33%), Positives = 76/133 (57%), Gaps = 5/133 (3%)

Query: 2   SKQFLRSTKNMVKGYSSTQILVRDATANDENTPSIDILDDIAEKTYDSVDFFEIMDMLDK 61
           +K++ R  +N+V  Y+  +  VR+AT N+    S  ++D I++ TY+  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMEGKVREATNNEPWGASSTLMDQISQGTYNFREREEILSMIFR 74

Query: 62  RLNDK-GKYWKHVAKSLTVLDYLIRFGSENCVFWCKENLYLIKTLKEFRVDDAIDYNTGY 120
           R  +K G  W+ + K+L +LDYLI+ GSE  +   + ++ LI+ L+ F   D+     G 
Sbjct: 75  RFTEKAGSEWRQIYKALQLLDYLIKHGSERFIDDTRNSINLIRILETFHYIDS----QGR 130

Query: 121 DQGQIVRVRATEL 133
           DQG  VR R   L
Sbjct: 131 DQGINVRTRVKAL 143

>Kpol_1001.2 s1001 (8057..9313) [1257 bp, 418 aa] {ON} (8057..9313)
           [1257 nt, 419 aa]
          Length = 418

 Score = 77.0 bits (188), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 44/134 (32%), Positives = 77/134 (57%), Gaps = 5/134 (3%)

Query: 2   SKQFLRSTKNMVKGYSSTQILVRDATANDENTPSIDILDDIAEKTYDSVDFFEIMDMLDK 61
           +K++ R  +N++  Y+  +  VR+AT N+    S  +++ I++ TY+  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVMFNYTEMEGKVREATNNEPWGASSTLMEQISQGTYNIREREEILSMIFR 74

Query: 62  RLNDK-GKYWKHVAKSLTVLDYLIRFGSENCVFWCKENLYLIKTLKEFRVDDAIDYNTGY 120
           R  +K    W+ + K+L +L+YLI+ GSE  +   + +L LIK L+ F   D+     G 
Sbjct: 75  RFTEKTASEWRQIYKALQLLEYLIKHGSERFIDDVRSSLSLIKMLESFHYIDS----QGR 130

Query: 121 DQGQIVRVRATELT 134
           DQG  VR +A  LT
Sbjct: 131 DQGINVRNKAQSLT 144

>ZYRO0B14784g Chr2 complement(1205944..1207218) [1275 bp, 424 aa]
           {ON} similar to uniprot|P47160 Saccharomyces cerevisiae
           YJR125C ENT3 Protein containing an N-terminal epsin-like
           domain involved in clathrin recruitment and traffic
           between the Golgi and endosomes associates with the
           clathrin adaptor Gga2p
          Length = 424

 Score = 75.9 bits (185), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 45/134 (33%), Positives = 77/134 (57%), Gaps = 5/134 (3%)

Query: 2   SKQFLRSTKNMVKGYSSTQILVRDATANDENTPSIDILDDIAEKTYDSVDFFEIMDMLDK 61
           +K++ R  +N+V  Y+  +  VR+AT N+    S  +++ IA+ TY+  +  EI+ M+ +
Sbjct: 50  AKKYFRKAQNVVFNYTEMEAKVREATNNEPWGTSSTLMEYIAQGTYNLREREEILGMIFR 109

Query: 62  RLNDK-GKYWKHVAKSLTVLDYLIRFGSENCVFWCKENLYLIKTLKEFRVDDAIDYNTGY 120
           R  +K    W+ + K+L +L+YLI+ GSE  +   + ++ L+K L+ F   D+     G 
Sbjct: 110 RFTEKTANEWRQIYKALQLLEYLIKHGSERFIDDTRCSISLLKMLESFHYVDS----QGR 165

Query: 121 DQGQIVRVRATELT 134
           DQG  VR RA  LT
Sbjct: 166 DQGINVRTRAKALT 179

>CAGL0H04323g Chr8 (407884..409122) [1239 bp, 412 aa] {ON} similar
           to uniprot|P47160 Saccharomyces cerevisiae YJR125c ENT3
           cytoskeletal adaptor
          Length = 412

 Score = 74.7 bits (182), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 42/129 (32%), Positives = 75/129 (58%), Gaps = 5/129 (3%)

Query: 2   SKQFLRSTKNMVKGYSSTQILVRDATANDENTPSIDILDDIAEKTYDSVDFFEIMDMLDK 61
           +K++ R  +N+V  Y+  +  VR+AT N+    S  +++ IA+ TY+  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVYNYTDMESKVREATNNEPWGASSTLMEQIAQGTYNIREREEILGMIFR 74

Query: 62  RLNDK-GKYWKHVAKSLTVLDYLIRFGSENCVFWCKENLYLIKTLKEFRVDDAIDYNTGY 120
           R  +K G  W+ + K+L +L+YLI+ GSE  +   + ++ ++K L+ F   D+     G 
Sbjct: 75  RFTEKSGSEWRQIYKALQLLEYLIKHGSERFIDDTRNSISIVKLLESFHYIDS----QGR 130

Query: 121 DQGQIVRVR 129
           DQG  VR R
Sbjct: 131 DQGVNVRNR 139

>AER155C Chr5 complement(929042..930136) [1095 bp, 364 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJR125C
           (ENT3)
          Length = 364

 Score = 72.4 bits (176), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 43/134 (32%), Positives = 74/134 (55%), Gaps = 5/134 (3%)

Query: 2   SKQFLRSTKNMVKGYSSTQILVRDATANDENTPSIDILDDIAEKTYDSVDFFEIMDMLDK 61
           +K++ R  +N++  Y+  +  VR+AT N+    S  ++  IA+ TY+  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVMLNYTGMEAKVREATNNEPWGASSTLMTQIAQGTYNFREREEILAMILR 74

Query: 62  RLNDK-GKYWKHVAKSLTVLDYLIRFGSENCVFWCKENLYLIKTLKEFRVDDAIDYNTGY 120
           R  +K    W+ + KS+ +L+YL++ GSE  +   + NL LI+ L+ F   D    + G 
Sbjct: 75  RFLEKSANEWRQIYKSMQLLEYLVKHGSERFIDDVRSNLNLIRMLETFHYID----SQGR 130

Query: 121 DQGQIVRVRATELT 134
           DQG  VR R   L 
Sbjct: 131 DQGINVRNRTKALV 144

>TPHA0B00400 Chr2 (83356..84555) [1200 bp, 399 aa] {ON} Anc_4.346
           YJR125C
          Length = 399

 Score = 72.0 bits (175), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 44/134 (32%), Positives = 74/134 (55%), Gaps = 5/134 (3%)

Query: 2   SKQFLRSTKNMVKGYSSTQILVRDATANDENTPSIDILDDIAEKTYDSVDFFEIMDMLDK 61
           +K++ R  +N++  Y+  +  VR+AT N+    S  ++  IA+ TY+  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVMFNYTDMEAKVREATNNEPWGASSTLMKQIAQGTYNIREREEILGMVFR 74

Query: 62  RLNDK-GKYWKHVAKSLTVLDYLIRFGSENCVFWCKENLYLIKTLKEFRVDDAIDYNTGY 120
           R  +K    W+ + KSL + DYLI+ GSE  +   + ++ LIK L+ F   D+     G 
Sbjct: 75  RYTEKTASEWRQIYKSLQLTDYLIKHGSERFIDDVRTSISLIKMLESFHYIDS----QGR 130

Query: 121 DQGQIVRVRATELT 134
           DQG  VR +A  L 
Sbjct: 131 DQGINVRNKAQSLV 144

>SAKL0H25762g Chr8 (2256842..2257630) [789 bp, 262 aa] {ON} some
           similarities with uniprot|Q07872 Saccharomyces
           cerevisiae YLL038C ENT4 Protein of unknown function
           contains an N-terminal epsin-like domain
          Length = 262

 Score = 70.1 bits (170), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 44/137 (32%), Positives = 80/137 (58%), Gaps = 13/137 (9%)

Query: 5   FLRSTKNMVKGYSSTQILVRDATANDENTPSID-ILDDIAEKTYDSVDFFEIMDMLDKRL 63
           F+RS +NM  G S+T++ V+ AT +DE + +   ++++I+  TY +    EI  ++ +RL
Sbjct: 3   FIRSVRNM--GQSTTEVKVKKATDDDEYSGATGALMNEISVLTYSAKTLREITQVIHRRL 60

Query: 64  NDKGKYWK-------HVAKSLTVLDYLIRFGSENCVFWCKENLYLIKTLKEFRVDDAIDY 116
           +  G Y K       H+ K+LT++ YLI  GS + V W ++  YL+ TL+EF V    D 
Sbjct: 61  S--GNYRKSSHRNAVHILKTLTLISYLINNGSNDFVSWIRQYAYLVDTLREFNVSADKDR 118

Query: 117 NTGYDQGQIVRVRATEL 133
               +Q +++ ++ ++L
Sbjct: 119 KMA-EQVRMLSIKLSKL 134

>Ecym_1133 Chr1 (274069..275247) [1179 bp, 392 aa] {ON} similar to
           Ashbya gossypii AER155C
          Length = 392

 Score = 70.5 bits (171), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 44/134 (32%), Positives = 71/134 (52%), Gaps = 5/134 (3%)

Query: 2   SKQFLRSTKNMVKGYSSTQILVRDATANDENTPSIDILDDIAEKTYDSVDFFEIMDMLDK 61
           +K++ R  +N+V  Y+  +  VR+AT N+       ++  IA+ TY+  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTGMEAKVREATNNESWGAPSSLMAQIAQGTYNYRERKEILGMIFR 74

Query: 62  RLNDK-GKYWKHVAKSLTVLDYLIRFGSENCVFWCKENLYLIKTLKEFRVDDAIDYNTGY 120
           R  +K    W+ + KS+ +L+YLI  GSE  +   +  L LIK L+ F   D+     G 
Sbjct: 75  RFVEKTASEWRQIYKSVQLLEYLIYHGSEGFIDDVRSGLNLIKMLESFHYIDS----QGR 130

Query: 121 DQGQIVRVRATELT 134
           DQG  VR R   L 
Sbjct: 131 DQGINVRNRTQALV 144

>Kwal_55.20611 s55 complement(489968..490732) [765 bp, 254 aa] {ON}
           YLL038C (ENT4) - Ent4p [contig 144] FULL
          Length = 254

 Score = 65.9 bits (159), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 39/110 (35%), Positives = 64/110 (58%), Gaps = 8/110 (7%)

Query: 5   FLRSTKNMVKGYSSTQILVRDATANDE-NTPSIDILDDIAEKTYDSVDFFEIMDMLDKRL 63
            L++ +N+  G SST++  R+AT +DE N  +  ++++++  TY      EI  ++ KRL
Sbjct: 3   LLKTVRNI--GQSSTEVKTRNATNDDEHNGATGSLMNELSVLTYSPRTLREITQVIRKRL 60

Query: 64  NDKGKYWKH-----VAKSLTVLDYLIRFGSENCVFWCKENLYLIKTLKEF 108
           +   +   H     + K+LT++ YLI  GS+  V W +  LYLI TLKEF
Sbjct: 61  SGNSRMSSHKNAVHLLKTLTLIAYLINNGSDEFVVWIRSYLYLIDTLKEF 110

>TBLA0G00650 Chr7 (140678..141949) [1272 bp, 423 aa] {ON} Anc_4.17
           YLL038C
          Length = 423

 Score = 62.0 bits (149), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 41/131 (31%), Positives = 70/131 (53%), Gaps = 13/131 (9%)

Query: 5   FLRSTKNMVKGYSSTQILVRDATANDENTPSID-ILDDIAEKTYDSVDFFEIMDMLDKRL 63
              S +N V+  S T++ VR AT ++EN+ +   ++++I+  TY +    EI+ +L KRL
Sbjct: 3   IFESVRNFVQ--SPTELKVRTATDDNENSGATGTLMNEISVLTYSTKTNKEIVTVLKKRL 60

Query: 64  NDKGKYWKH-----VAKSLTVLDYLIRFGSENCVFWCKENLYLIKTLKEFRVDDAIDYNT 118
              GK   H     + K+LT++ YL+  GS   + W  EN  L + +K F V D I    
Sbjct: 61  TGYGKKSSHRNCIHIIKTLTLIAYLMNNGSLEFIRWINENQLLFEVMKNFEVSDTI---- 116

Query: 119 GYDQGQIVRVR 129
            +D+   +++R
Sbjct: 117 -HDEKFAIQIR 126

>TDEL0G01740 Chr7 (342371..343144) [774 bp, 257 aa] {ON} Anc_4.17
           YLL038C
          Length = 257

 Score = 60.1 bits (144), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 38/121 (31%), Positives = 67/121 (55%), Gaps = 8/121 (6%)

Query: 5   FLRSTKNMVKGYSSTQILVRDATANDENTPSID-ILDDIAEKTYDSVDFFEIMDMLDKRL 63
            L S + +V+  S+T++ V+ AT  +E++ +   ++++I+  TY      EI+ ++ KRL
Sbjct: 3   LLDSVRTLVQ--STTELKVKQATDENESSGATGTLMNEISVLTYSPKTLKEIVQVVRKRL 60

Query: 64  NDKG-----KYWKHVAKSLTVLDYLIRFGSENCVFWCKENLYLIKTLKEFRVDDAIDYNT 118
              G     K   H+ K+LT++ YL+  GS + + W + N+ L+  LKEF V D  D   
Sbjct: 61  MGHGRRNSHKICIHLVKTLTLVTYLMNNGSNDFIAWVRGNMALVDCLKEFNVQDRNDEKI 120

Query: 119 G 119
           G
Sbjct: 121 G 121

>Ecym_8407 Chr8 (843359..844123) [765 bp, 254 aa] {ON} similar to
           Ashbya gossypii ACL061C
          Length = 254

 Score = 59.3 bits (142), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 41/137 (29%), Positives = 75/137 (54%), Gaps = 13/137 (9%)

Query: 5   FLRSTKNMVKGYSSTQILVRDATANDENTPSI-DILDDIAEKTYDSVDFFEIMDMLDKRL 63
           FL S +++  G SST + V+ AT + E+  +   ++++IA  TY      EI  +L KRL
Sbjct: 3   FLSSVRHL--GSSSTTVKVKKATDDSEHNGAYGSLMNEIAILTYSPNTLREITQVLKKRL 60

Query: 64  NDKGKYWK-------HVAKSLTVLDYLIRFGSENCVFWCKENLYLIKTLKEFRVDDAIDY 116
              G Y K       ++ K+LT++ +L+  GSE C+ W + +L LI++ ++F + D  + 
Sbjct: 61  --VGNYKKTPSKRAVNLLKTLTLIRFLVINGSEECIAWLRRHLVLIRSFQDFTLRDG-EK 117

Query: 117 NTGYDQGQIVRVRATEL 133
               +Q Q++  +  +L
Sbjct: 118 KQMVNQIQLLSCKLCQL 134

>KLTH0E05874g Chr5 complement(530814..531581) [768 bp, 255 aa] {ON}
           similar to uniprot|Q07872 Saccharomyces cerevisiae
           YLL038C ENT4 Protein of unknown function contains an N-
           terminal epsin-like domain
          Length = 255

 Score = 58.5 bits (140), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 39/112 (34%), Positives = 64/112 (57%), Gaps = 8/112 (7%)

Query: 5   FLRSTKNMVKGYSSTQILVRDATANDENTPSI-DILDDIAEKTYDSVDFFEIMDMLDKRL 63
            LR+ ++   G S T+I  ++AT +DE + +   ++++I+  TY S    EI  ++ KRL
Sbjct: 3   LLRTVRSF--GQSQTEIKTKNATNDDEYSGATGSLMNEISVLTYSSRTLREITAVVRKRL 60

Query: 64  --NDKGKYWK---HVAKSLTVLDYLIRFGSENCVFWCKENLYLIKTLKEFRV 110
             N++    K   H+ K+LT+  YLI  GS   V W +  +YLI +LKEF +
Sbjct: 61  SGNNRKSSHKNAVHILKTLTLTAYLINNGSNEFVAWIRSYVYLIDSLKEFTI 112

>ZYRO0G07876g Chr7 complement(636468..637247) [780 bp, 259 aa] {ON}
           similar to uniprot|Q07872 Saccharomyces cerevisiae
           YLL038C ENT4 Protein of unknown function contains an N-
           terminal epsin-like domain
          Length = 259

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 39/109 (35%), Positives = 57/109 (52%), Gaps = 6/109 (5%)

Query: 13  VKGYSSTQILVRDATANDENTPSID-ILDDIAEKTYDSVDFFEIMDMLDKRLNDKGKYWK 71
           V G SST++ VR AT  DE T +   ++++I+  TY      EI  +L +RL+  G+   
Sbjct: 9   VFGPSSTELKVRKATNEDEKTGATGTLMNEISVLTYSPKTVREITQVLKRRLSSYGRRTS 68

Query: 72  H-----VAKSLTVLDYLIRFGSENCVFWCKENLYLIKTLKEFRVDDAID 115
           H     + K+LT++ YLI  GSE  V W + NL   + LK   V    D
Sbjct: 69  HKNSIHIVKALTLILYLINNGSEEFVAWVRGNLIYFECLKSCEVSQKRD 117

>TPHA0F00230 Chr6 complement(43589..44431) [843 bp, 280 aa] {ON}
           Anc_4.17 YLL038C
          Length = 280

 Score = 56.2 bits (134), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 39/118 (33%), Positives = 63/118 (53%), Gaps = 8/118 (6%)

Query: 8   STKNMVKGYSSTQILVRDATANDENTPSID-ILDDIAEKTYDSVDFFEIMDMLDKRL--- 63
           S +N V+  S T+  VR AT +DE + +   ++++I+  TY      EI+ +L KRL   
Sbjct: 6   SVRNFVQ--SPTESKVRQATDDDETSGATGTLMNEISVLTYSPKTLKEIVQILKKRLTGY 63

Query: 64  --NDKGKYWKHVAKSLTVLDYLIRFGSENCVFWCKENLYLIKTLKEFRVDDAIDYNTG 119
              +  K   H+ K+LT++ YLI  GS + + W + N+ L + LK F V +  D   G
Sbjct: 64  SKKNSHKNCVHILKTLTLITYLINNGSNDFIAWTRSNIMLFEYLKNFEVQNLEDEKMG 121

>TBLA0B06220 Chr2 (1466908..1467927) [1020 bp, 339 aa] {ON}
           Anc_4.346 YJR125C
          Length = 339

 Score = 56.2 bits (134), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 43/132 (32%), Positives = 68/132 (51%), Gaps = 6/132 (4%)

Query: 2   SKQFLRSTKNMVKGYSSTQILVRDATANDENTPSIDILDDIAEKTYDSVDFFEIMDMLDK 61
           +K+F R  +N +   +  +  VR+AT ND    S+ ++  I   T++     +I++ML  
Sbjct: 15  AKKFFRMAENFLFNLTDMESKVREATNNDPWGTSVILMAQINAGTFEINQRADIINMLLN 74

Query: 62  RLNDK-GKYWKHVAKSLTVLDYLIRFGSENCVFWCKENLYLIKTLKEFRVDDAIDYNTGY 120
           R  +K G  W+ + KS+ +L YL+  GS   V   K NL LIK L  F   D    + GY
Sbjct: 75  RFLEKNGSQWRQIYKSVLLLQYLLINGSTEFVSEVKLNLTLIKNLMLFEFID----DQGY 130

Query: 121 DQGQIVRVRATE 132
           +Q   +  +ATE
Sbjct: 131 NQSSKIS-KATE 141

>Kpol_388.5 s388 complement(17825..18631) [807 bp, 268 aa] {ON}
           complement(17825..18631) [807 nt, 269 aa]
          Length = 268

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 33/109 (30%), Positives = 62/109 (56%), Gaps = 8/109 (7%)

Query: 8   STKNMVKGYSSTQILVRDATANDENTPSID-ILDDIAEKTYDSVDFFEIMDMLDKRLNDK 66
           S +N V+  S+T+  V++AT ++E + +   ++++I+  TY      EI+ +L KRL   
Sbjct: 6   SVRNFVQ--SATEAKVKEATDDNETSGATGTLMNEISVLTYSPKTLKEIIQVLKKRLTGS 63

Query: 67  GKY-----WKHVAKSLTVLDYLIRFGSENCVFWCKENLYLIKTLKEFRV 110
            K        H+ K++T++ YLI  GS + + W + N+ + + LK+F V
Sbjct: 64  SKKSSHRNCVHILKTMTLISYLINNGSNDFIAWARSNIMIFEVLKDFEV 112

>Smik_12.19 Chr12 complement(50134..50877) [744 bp, 247 aa] {ON}
           YLL038C (REAL)
          Length = 247

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 35/118 (29%), Positives = 62/118 (52%), Gaps = 7/118 (5%)

Query: 17  SSTQILVRDATANDENTPSID-ILDDIAEKTYDSVDFFEIMDMLDKRL------NDKGKY 69
           S T+  V+ AT  DE + +   ++++I+  TY      EI+ ++ KRL       +  + 
Sbjct: 13  SPTESKVKQATNEDETSGATGTLMNEISILTYSPKTVREIIQVVRKRLLLGQNRRNSHRN 72

Query: 70  WKHVAKSLTVLDYLIRFGSENCVFWCKENLYLIKTLKEFRVDDAIDYNTGYDQGQIVR 127
              V K+LT++ YL+  GS   + W K N+ L++ L++F+V DA D     D  ++ R
Sbjct: 73  CIQVMKTLTLVSYLMNNGSNEFIKWLKSNMILVEILEDFQVQDARDERKAEDIHKLSR 130

>Suva_10.35 Chr10 complement(70188..70931) [744 bp, 247 aa] {ON}
           YLL038C (REAL)
          Length = 247

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 35/118 (29%), Positives = 63/118 (53%), Gaps = 7/118 (5%)

Query: 17  SSTQILVRDATANDENTPSID-ILDDIAEKTYDSVDFFEIMDMLDKRL------NDKGKY 69
           S T+  V+ AT+ DE + +   ++++I+  TY      EI+ ++ KRL       +  + 
Sbjct: 13  SPTESKVKQATSEDETSGATGTLMNEISILTYSPKTVREIIQIVRKRLLLGQNRRNSHRS 72

Query: 70  WKHVAKSLTVLDYLIRFGSENCVFWCKENLYLIKTLKEFRVDDAIDYNTGYDQGQIVR 127
              V K+LT++ YL+  GS   + W K N+ LI+ L++F+  DA D   G +  ++ R
Sbjct: 73  CIQVMKTLTLVSYLMNNGSNEFIKWLKGNMILIEILEDFQAQDARDDRNGEEIRKLSR 130

>YLL038C Chr12 complement(65775..66518) [744 bp, 247 aa] {ON}
           ENT4Protein of unknown function, contains an N-terminal
           epsin-like domain; proposed to be involved in the
           trafficking of Arn1p in the absence of ferrichrome
          Length = 247

 Score = 52.4 bits (124), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 35/118 (29%), Positives = 61/118 (51%), Gaps = 7/118 (5%)

Query: 17  SSTQILVRDATANDENTPSID-ILDDIAEKTYDSVDFFEIMDMLDKRL------NDKGKY 69
           S T+  V+ AT  DE + +   ++++I+  TY      EI+ ++ KRL       +  + 
Sbjct: 13  SPTESKVKQATNEDETSGATGTLMNEISILTYSPKTVREIIQVIRKRLLLGQNRRNSHRN 72

Query: 70  WKHVAKSLTVLDYLIRFGSENCVFWCKENLYLIKTLKEFRVDDAIDYNTGYDQGQIVR 127
              V K+LT++ YL+  GS   + W K N+ LI+ L++F+V D  D     D  ++ R
Sbjct: 73  CIQVMKTLTLVSYLMNNGSNEFIKWLKGNMILIEILEDFQVQDPRDERKAEDIQKLSR 130

>Skud_12.30 Chr12 complement(56967..57710) [744 bp, 247 aa] {ON}
           YLL038C (REAL)
          Length = 247

 Score = 49.7 bits (117), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 32/106 (30%), Positives = 56/106 (52%), Gaps = 7/106 (6%)

Query: 17  SSTQILVRDATANDENTPSID-ILDDIAEKTYDSVDFFEIMDMLDKRL------NDKGKY 69
           S T+  V+ AT+ DE + +   ++++I+  TY      EI+ ++ KRL       +  + 
Sbjct: 13  SPTESKVKQATSEDETSGATGTLMNEISILTYSPKTVREIIQVIRKRLLLGQNRRNSHRN 72

Query: 70  WKHVAKSLTVLDYLIRFGSENCVFWCKENLYLIKTLKEFRVDDAID 115
              V K+LT++ YL+  GS   + W K N+ LI+ L+ F + D  D
Sbjct: 73  CIQVMKTLTLVSYLMNNGSNEFIKWLKGNMILIEILENFHIQDVRD 118

>ACL061C Chr3 complement(256803..257507) [705 bp, 234 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLL038C
           (ENT4)
          Length = 234

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 33/100 (33%), Positives = 51/100 (51%), Gaps = 6/100 (6%)

Query: 15  GYSSTQILVRDATANDENT-PSIDILDDIAEKTYDSVDFFEIMDMLDKRLNDKG-----K 68
           G S T   VR AT ++E    S  ++ +I   TY      ++  +L KRL+        K
Sbjct: 11  GSSPTAAKVRKATDDNEFVGASSALISEITILTYSCKTLLDVTRVLKKRLSGNANKSSHK 70

Query: 69  YWKHVAKSLTVLDYLIRFGSENCVFWCKENLYLIKTLKEF 108
              H+ K+LT+ +YLI  GSE+ V W +    L++ LK+F
Sbjct: 71  NAVHILKALTLTNYLIANGSEDFVQWLQGCAVLLRRLKDF 110

>KLLA0D03949g Chr4 (333566..334243) [678 bp, 225 aa] {ON} similar to
           uniprot|Q07872 Saccharomyces cerevisiae YLL038C ENT4
           Protein of unknown function contains an N- terminal
           epsin- like domain
          Length = 225

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 31/102 (30%), Positives = 58/102 (56%), Gaps = 8/102 (7%)

Query: 15  GYSSTQILVRDATANDENTPSID-ILDDIAEKTYDSVDFFEIMDMLDKRLNDKGKYWK-- 71
           G S+TQ+ V+ AT ++E+  +   ++++++  TY      EI +++ KRL +     K  
Sbjct: 11  GQSTTQLKVKQATDSNESYGATGTLMNELSVLTYSEKSANEIYEVIRKRLMNGSSRLKNS 70

Query: 72  -----HVAKSLTVLDYLIRFGSENCVFWCKENLYLIKTLKEF 108
                 V K+LT+++YL+  GSE  V W + +L  I+ LK++
Sbjct: 71  HDSVVQVLKTLTLIEYLLYNGSEEFVLWMRRHLAYIEALKDY 112

>CAGL0E03806g Chr5 (356594..357376) [783 bp, 260 aa] {ON} similar to
           uniprot|Q07872 Saccharomyces cerevisiae YLL038c ENT4
          Length = 260

 Score = 46.6 bits (109), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 31/110 (28%), Positives = 60/110 (54%), Gaps = 8/110 (7%)

Query: 14  KGY--SSTQILVRDATANDENTPSID-ILDDIAEKTYDSVDFFEIMDMLDKRLN-----D 65
           KG+  S T++ VR AT ++E   +   ++++I+  TY      +++ ++ KRL+     +
Sbjct: 8   KGFLLSPTELKVRQATDDNELAGATGTLMNEISVLTYSKKTLKDVIQVIRKRLSGVNKRN 67

Query: 66  KGKYWKHVAKSLTVLDYLIRFGSENCVFWCKENLYLIKTLKEFRVDDAID 115
             +   HV K+LT++ YL+  GS + + W K + Y+I+ L  F    + D
Sbjct: 68  SHRTCLHVLKTLTLVSYLLNNGSNDFIAWLKSSKYVIEYLSSFEAQSSSD 117

>YHR161C Chr8 complement(420373..422286) [1914 bp, 637 aa] {ON}
          YAP1801Protein involved in clathrin cage assembly;
          binds Pan1p and clathrin; homologous to Yap1802p,
          member of the AP180 protein family
          Length = 637

 Score = 47.4 bits (111), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 28/72 (38%), Positives = 37/72 (51%), Gaps = 2/72 (2%)

Query: 22 LVRDATANDENTPSIDILDDIAEKTYDSVDFFEIMDMLDKRLNDKGKYWKHVAKSLTVLD 81
          LV+ AT      P    LD I   T +  DF+EI+  LD R+ND    W  V KSL V+ 
Sbjct: 7  LVKGATKIKSAPPKQKYLDPILLGTSNEEDFYEIVKGLDSRINDTA--WTIVYKSLLVVH 64

Query: 82 YLIRFGSENCVF 93
           +IR GS++   
Sbjct: 65 LMIREGSKDVAL 76

>SAKL0H02530g Chr8 (250148..252157) [2010 bp, 669 aa] {ON} weakly
           similar to uniprot|P53309 Saccharomyces cerevisiae
           YGR241C YAP1802 Yeast Assembly Polypeptide, member of
           AP180 protein family, binds Pan1p and clathrin; member
           of clathrin assembly polypeptide AP180 family and weakly
           similar to uniprot|P38856 Saccharomyces cerevisiae
           YHR161C YAP1801 Yeast Assembly Polypeptide member of
           AP180 protein family binds Pan1p and clathrin clathrin
           assembly protein
          Length = 669

 Score = 47.4 bits (111), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 31/93 (33%), Positives = 43/93 (46%), Gaps = 7/93 (7%)

Query: 22  LVRDATANDENTPSIDILDDIAEKTYDSVDFFEIMDMLDKRLNDKGKYWKHVAKSLTVLD 81
           LV+ AT      P    +D I   T DS +F EIM  L+ R+ND    W  V KSL V+ 
Sbjct: 7   LVKGATKIKMAPPKQKYIDPILLGTSDSSEFMEIMKALESRINDTA--WTIVYKSLIVIH 64

Query: 82  YLIRFGSENCVFWCKENLYLIKTLKEFRVDDAI 114
            ++R G  +         YL   L+ F++ D  
Sbjct: 65  LMMRDGDRDVTIK-----YLSHHLEFFQLRDVF 92

>Skud_8.225 Chr8 complement(391820..393685) [1866 bp, 621 aa] {ON}
          YHR161C (REAL)
          Length = 621

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 30/87 (34%), Positives = 40/87 (45%), Gaps = 11/87 (12%)

Query: 22 LVRDATANDENTPSIDILDDIAEKTYDSVDFFEIMDMLDKRLNDKGKYWKHVAKSLTVLD 81
          LV+ AT      P    LD I   T    DF+EI+  LD R+ND    W  V K+L V+ 
Sbjct: 7  LVKGATKIKSAPPKQKYLDPILLATGSEEDFYEIVKALDSRVNDTA--WTIVYKTLLVVH 64

Query: 82 YLIRFG---------SENCVFWCKENL 99
           ++R G         S N  F+  EN+
Sbjct: 65 LMMREGKKDVALRYYSRNLEFFSIENI 91

>NCAS0C05840 Chr3 (1202292..1203095) [804 bp, 267 aa] {ON} Anc_4.17
           YLL038C
          Length = 267

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 37/129 (28%), Positives = 62/129 (48%), Gaps = 12/129 (9%)

Query: 13  VKGY--SSTQILVRDATANDENTPSID-ILDDIAEKTYDSVDFFEIMDMLDKRLNDKGKY 69
           VK +  S T+  V+ AT  DE   +   ++++I+  TY      EI+ +L KRL+   + 
Sbjct: 7   VKSFVQSPTESKVKQATNEDETMGATGTLMNEISVLTYSPKTLKEIVQVLKKRLSGYSRK 66

Query: 70  WKH-----VAKSLTVLDYLIRFGSENCVFWCKENLYLIKTLKEFRVDDAIDYNTGYDQGQ 124
             H     + K+LT++ YLI  GS   V W + N  LI  L    + + ++Y      G 
Sbjct: 67  TSHKNCIFIIKTLTLMAYLINNGSNEFVAWIRNNSSLISNL----ISEKVEYPKDDKMGP 122

Query: 125 IVRVRATEL 133
            ++  A +L
Sbjct: 123 EIKSIAADL 131

>KAFR0I01460 Chr9 (304865..305692) [828 bp, 275 aa] {ON} Anc_4.17
           YLL038C
          Length = 275

 Score = 43.5 bits (101), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 54/106 (50%), Gaps = 14/106 (13%)

Query: 5   FLRSTKNMVKGYSSTQILVRDATANDENTPSI-DILDDIAEKTYDSVDFFEIMDMLDKRL 63
           F  S +N+V  YS T++ VR AT  +E   S   ++++I+  TY +    EI+ +L K+L
Sbjct: 3   FFNSVRNLV--YSQTELKVRQATDENEIIRSTGTLMNEISVLTYSAKTLKEIIGILKKKL 60

Query: 64  -------NDKG----KYWKHVAKSLTVLDYLIRFGSENCVFWCKEN 98
                  N  G    K    V K+ T++ YL+  GS + + W K N
Sbjct: 61  SLLYGLKNGNGIISHKVCVQVLKTFTLISYLLNNGSNDFINWLKLN 106

>Smik_8.245 Chr8 complement(397342..399225) [1884 bp, 627 aa] {ON}
          YHR161C (REAL)
          Length = 627

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 36/72 (50%), Gaps = 2/72 (2%)

Query: 22 LVRDATANDENTPSIDILDDIAEKTYDSVDFFEIMDMLDKRLNDKGKYWKHVAKSLTVLD 81
          LV+ AT      P    LD I   T    DF+EI+  L+ R+ND    W  V KSL V+ 
Sbjct: 7  LVKGATKIKSAPPKQKYLDPILLGTSSEEDFYEIVKGLNFRINDTA--WTIVYKSLLVVH 64

Query: 82 YLIRFGSENCVF 93
           +IR G+++   
Sbjct: 65 LMIREGAKDVAL 76

>ZYRO0F13508g Chr6 complement(1114200..1116263) [2064 bp, 687 aa]
          {ON} weakly similar to uniprot|P53309 Saccharomyces
          cerevisiae YGR241C YAP1802 Yeast Assembly Polypeptide,
          member of AP180 protein family, binds Pan1p and
          clathrin; member of clathrin assembly polypeptide AP180
          family and weakly similar to uniprot|P38856
          Saccharomyces cerevisiae YHR161C YAP1801 Yeast Assembly
          Polypeptide member of AP180 protein family binds Pan1p
          and clathrin clathrin assembly protein
          Length = 687

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 35/72 (48%), Gaps = 2/72 (2%)

Query: 22 LVRDATANDENTPSIDILDDIAEKTYDSVDFFEIMDMLDKRLNDKGKYWKHVAKSLTVLD 81
          LV+ AT      P    ++ I   T D  DF EI   LD+R++D    W  V KSL +L 
Sbjct: 7  LVKGATKIKMAPPKQKYVEPILLGTTDPHDFSEIAKALDERISDTA--WTIVYKSLMLLH 64

Query: 82 YLIRFGSENCVF 93
           +IR G +N   
Sbjct: 65 LMIREGEKNVAL 76

>NDAI0H00280 Chr8 complement(48177..49109) [933 bp, 310 aa] {ON}
           Anc_4.17 YLL038C
          Length = 310

 Score = 40.8 bits (94), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 27/96 (28%), Positives = 51/96 (53%), Gaps = 9/96 (9%)

Query: 19  TQILVRDATANDENTPSI-DILDDIAEKTYDSVDFFEIMDMLDKRLND---KGKYWKH-- 72
           T+  V+ AT ++E T +   ++++I+  TY      +I+ ++ KRL+      K   H  
Sbjct: 15  TESKVKQATDDNETTGATGTLMNEISVLTYSPKTLKDIIQVIKKRLSSATSSNKKLSHKT 74

Query: 73  ---VAKSLTVLDYLIRFGSENCVFWCKENLYLIKTL 105
              + K+LT++ YLI  GS   + W + N YL++ +
Sbjct: 75  SVYIIKTLTLISYLINNGSNEFIEWLRLNFYLVENI 110

>TBLA0H01210 Chr8 (269471..270946) [1476 bp, 491 aa] {ON} Anc_8.335
           YDR153C
          Length = 491

 Score = 37.0 bits (84), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 30/97 (30%), Positives = 41/97 (42%), Gaps = 20/97 (20%)

Query: 7   RSTKNMVKGYSSTQILVRDATANDENTPSIDILDDIAEKTYDSVDFFEIMDMLDKRLNDK 66
           R  +NM+  Y   QI +R AT  D   P+   LD I     + V   +I+D + KRL D 
Sbjct: 21  RYAQNMIIAYEPYQIDIRQATNTDSWGPTKKHLDQIL-LDRNKVPLRKIVDYIMKRLMDH 79

Query: 67  -------------------GKYWKHVAKSLTVLDYLI 84
                              G  W+ V KSL VL +L+
Sbjct: 80  INTRPRNLYDRARKDYVNYGTEWRVVFKSLIVLKFLL 116

>KNAG0J02870 Chr10 (549107..550096) [990 bp, 329 aa] {ON} Anc_4.17
           YLL038C
          Length = 329

 Score = 36.2 bits (82), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 33/124 (26%), Positives = 58/124 (46%), Gaps = 17/124 (13%)

Query: 8   STKNMVKGYSSTQILVRDATANDE--NTPSIDILDDIAEKTYDSVDFFEIMDMLDKRLND 65
           S +N V   S+T++ V+ AT + E  ++ +  ++++I+  TY      EI  +L KR + 
Sbjct: 6   SVRNFVN--STTELKVKQATDDSEVLSSSTGTVMNEISVLTYSPKTLKEIQSVLRKRFHL 63

Query: 66  KGKYWKHVA--------KSLTVLDYLIRFGSENCVFWCKENLYLIKTLK-----EFRVDD 112
                + V         K+LT++ +L+  GS   V W K N+   + L+     EF   D
Sbjct: 64  MSTLPRKVLHRSCLIVLKTLTLILFLLNNGSNAFVSWIKSNVGAFEPLQNVPITEFSFTD 123

Query: 113 AIDY 116
             D 
Sbjct: 124 KADL 127

>Kpol_344.8 s344 complement(20765..21919) [1155 bp, 384 aa] {ON}
           complement(20765..21919) [1155 nt, 385 aa]
          Length = 384

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 36/115 (31%), Positives = 49/115 (42%), Gaps = 24/115 (20%)

Query: 7   RSTKNMVKGYSSTQILVRDATANDENTPSIDILDDIAEKTYDSVDFF--------EIMDM 58
           R  +NM+  Y   QI +R AT  D   P+   L  +    Y SV  +         I+D 
Sbjct: 21  RFMQNMIVQYEPYQIDIRRATNTDAWGPTTKHLQKVIRNKY-SVPLYLMTEYVLKRIVDH 79

Query: 59  LDKR---LNDK--------GKYWKHVAKSLTVLDYLIRFGSE----NCVFWCKEN 98
           L KR   L +K        G  W+ + K L V++YL+   SE    N V  C EN
Sbjct: 80  LAKRPKNLYEKARKEYVNYGSEWRIILKCLIVIEYLLLNVSEPEELNQVKSCLEN 134

>ZYRO0F13684g Chr6 complement(1125731..1126954) [1224 bp, 407 aa]
           {ON} highly similar to uniprot|Q6Q5U2 Saccharomyces
           cerevisiae YDR153C ENT5 Protein containing an N-terminal
           epsin-like domain involved in clathrin recruitment and
           traffic between the Golgi and endosomes associates with
           the clathrin adaptor Gga2p clathrin adaptor complex AP-1
           and clathrin
          Length = 407

 Score = 33.9 bits (76), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 40/97 (41%), Gaps = 20/97 (20%)

Query: 7   RSTKNMVKGYSSTQILVRDATANDENTPSIDILDDIAEKTYDSVDFFEIMDMLDKRLNDK 66
           R  +NM+  Y   Q+ VR AT  D   P+   L+ +    Y  V  + I +   KRL D 
Sbjct: 21  RFAQNMIVQYEPYQVDVRRATNTDSWGPTPKHLEKVLRNRY-QVPMYLITEYTLKRLIDH 79

Query: 67  -------------------GKYWKHVAKSLTVLDYLI 84
                              G  W+ V K LTV++YL+
Sbjct: 80  IATRPKNFYEKARKEYVNYGSEWRVVLKCLTVVEYLL 116

>NDAI0A02830 Chr1 (636619..638040) [1422 bp, 473 aa] {ON} Anc_5.84
          YGR241C
          Length = 473

 Score = 32.7 bits (73), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 37/77 (48%), Gaps = 1/77 (1%)

Query: 17 SSTQILVRDATANDENTPSIDILDDIAEKTYDSVDFFEIMDMLDKRLNDKGKYWKHVAKS 76
          +S + LV+ AT      P    +D I   T ++++F +I+  L  R+N+    W  + K+
Sbjct: 2  TSYKKLVKGATKIKMAPPKQKYVDPILLGTSNNIEFQQIVSELTSRINN-CNIWSVIYKT 60

Query: 77 LTVLDYLIRFGSENCVF 93
          L V+  +I  G  N   
Sbjct: 61 LIVVHLMISIGEPNVTL 77

>NDAI0A01470 Chr1 (326531..327634) [1104 bp, 367 aa] {ON} Anc_7.419
           YER118C
          Length = 367

 Score = 32.3 bits (72), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 20/33 (60%)

Query: 100 YLIKTLKEFRVDDAIDYNTGYDQGQIVRVRATE 132
           Y +K L  ++ DDA  Y   +DQG+I++V   E
Sbjct: 309 YTVKALYSYQADDADAYEISFDQGEILKVSDIE 341

>KAFR0B05800 Chr2 complement(1200666..1201814) [1149 bp, 382 aa]
           {ON} Anc_8.335 YDR153C
          Length = 382

 Score = 32.0 bits (71), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 26/97 (26%), Positives = 41/97 (42%), Gaps = 20/97 (20%)

Query: 7   RSTKNMVKGYSSTQILVRDATANDENTPSIDILDDIAEKTYDSVDFFEIMDMLDKRLNDK 66
           R  +N++  Y   QI VR AT  D   P+   L+ +    +  V  + + + + KRL D 
Sbjct: 21  RFAQNVIVQYEPYQIDVRRATNTDAWGPTTKHLEKVMRNRF-QVPMYLVTEYILKRLIDH 79

Query: 67  -------------------GKYWKHVAKSLTVLDYLI 84
                              G  W+ V K LTV++YL+
Sbjct: 80  IATKPKNLYEKARKEYVNYGSEWRVVLKCLTVIEYLL 116

>Kpol_1050.73 s1050
           complement(162665..164488,164492..164527,164531..164686)
           [2016 bp, 671 aa] {ON}
           complement(162665..164488,164492..164527,164531..164686)
           [2016 nt, 672 aa]
          Length = 671

 Score = 32.0 bits (71), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 30/56 (53%), Gaps = 6/56 (10%)

Query: 505 IPAQHTATGTFINSQGTGYKQYINDPKNNPFMSNQYTGLPSTN--VVPSYTGYGFG 558
           +  QHT+     + Q TG+   I      P ++NQ TG  S+N  V PS+TG GFG
Sbjct: 497 LTGQHTSL-QMQHPQNTGF---IQQSATVPNLTNQQTGFFSSNTQVTPSFTGAGFG 548

>TBLA0F02620 Chr6 complement(634992..636440) [1449 bp, 482 aa] {ON}
           Anc_7.471 YPR045C
          Length = 482

 Score = 31.6 bits (70), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 27/52 (51%), Gaps = 6/52 (11%)

Query: 517 NSQGTGYKQYIND----PKNNPFMSNQYTGLPST-NVVPSYTGYGFGNQPQP 563
           N Q T  K + N+    P   PF++  Y G+PS  N+ P+  G G G  PQP
Sbjct: 23  NDQATNQKSHENNQIINPSTTPFLNAGYPGIPSLPNIPPTLMG-GVGMVPQP 73

>TDEL0G01080 Chr7 (220997..222544) [1548 bp, 515 aa] {ON} Anc_5.84
           YGR241C
          Length = 515

 Score = 31.6 bits (70), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 24/42 (57%), Gaps = 6/42 (14%)

Query: 523 YKQYINDPKNNPFMS-----NQYTGLPSTN-VVPSYTGYGFG 558
           ++Q +  P  NPF++      Q TG  S N + P++TG GFG
Sbjct: 331 FEQQVPQPTGNPFLTMNDLPQQQTGFYSANQITPAFTGAGFG 372

>Ecym_4433 Chr4 complement(893223..894923) [1701 bp, 566 aa] {ON}
          similar to Ashbya gossypii AAR102C
          Length = 566

 Score = 31.2 bits (69), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 30/51 (58%)

Query: 23 VRDATANDENTPSIDILDDIAEKTYDSVDFFEIMDMLDKRLNDKGKYWKHV 73
          + D ++NDEN  S++ +DD  E+T DS + F   +  DKR     +Y +++
Sbjct: 28 ITDVSSNDENEFSVEEMDDGHEETLDSDEEFSAENPADKRRRLAKQYLENI 78

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.131    0.387 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 38,438,774
Number of extensions: 1540051
Number of successful extensions: 4758
Number of sequences better than 10.0: 104
Number of HSP's gapped: 4856
Number of HSP's successfully gapped: 139
Length of query: 599
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 484
Effective length of database: 40,294,809
Effective search space: 19502687556
Effective search space used: 19502687556
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 69 (31.2 bits)