Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0E004707.341ON1161165835e-79
TPHA0F029107.341ON1081132312e-25
SAKL0F10956g7.341ON861012153e-23
TDEL0C020607.341ON881022092e-22
KLTH0H01452g7.341ON861012023e-21
Kpol_530.377.341ON881011953e-20
ZYRO0F11528g7.341ON1211111949e-20
Kwal_YGOB_Anc_7.3417.341ON861011901e-19
Ecym_45207.341ON911011842e-18
CAGL0I03432g7.341ON1491011831e-17
ACL158W7.341ON951011754e-17
NCAS0A140807.341ON781031683e-16
KLLA0C16709g7.341ON79971571e-14
Suva_4.847.341ON811021413e-12
NDAI0A019507.341ON1221071392e-11
KNAG0C038107.341ON821031189e-09
Skud_4.957.341ON791011127e-08
YDL160C-A (MHF2)7.341ON80831119e-08
Smik_4.767.341ON80841092e-07
KAFR0B009007.341ON78104840.001
CAGL0J08822g7.332ON44332651.6
TBLA0I026904.212ON68722614.9
TBLA0J009801.183ON59383615.2
SAKL0F14058g7.460ON114449607.7
Skud_2.3606.126ON95473607.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0E00470
         (116 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0E00470 Chr5 (86619..86969) [351 bp, 116 aa] {ON} Anc_7.341 ...   229   5e-79
TPHA0F02910 Chr6 (644434..644760) [327 bp, 108 aa] {ON} Anc_7.34...    94   2e-25
SAKL0F10956g Chr6 complement(858747..859007) [261 bp, 86 aa] {ON...    87   3e-23
TDEL0C02060 Chr3 complement(356665..356931) [267 bp, 88 aa] {ON}...    85   2e-22
KLTH0H01452g Chr8 complement(134324..134584) [261 bp, 86 aa] {ON...    82   3e-21
Kpol_530.37 s530 complement(86462..86728) [267 bp, 88 aa] {ON} c...    80   3e-20
ZYRO0F11528g Chr6 (946636..947001) [366 bp, 121 aa] {ON} some si...    79   9e-20
Kwal_YGOB_Anc_7.341 s56 (1073424..1073684) [261 bp, 86 aa] {ON} ...    78   1e-19
Ecym_4520 Chr4 (1036442..1036717) [276 bp, 91 aa] {ON} similar t...    75   2e-18
CAGL0I03432g Chr9 complement(292162..292611) [450 bp, 149 aa] {O...    75   1e-17
ACL158W Chr3 (78852..79139) [288 bp, 95 aa] {ON} Syntenic homolo...    72   4e-17
NCAS0A14080 Chr1 (2768035..2768271) [237 bp, 78 aa] {ON}               69   3e-16
KLLA0C16709g Chr3 (1463056..1463295) [240 bp, 79 aa] {ON} conser...    65   1e-14
Suva_4.84 Chr4 complement(156977..157219) [243 bp, 81 aa] {ON} Y...    59   3e-12
NDAI0A01950 Chr1 (434811..435179) [369 bp, 122 aa] {ON} Anc_7.34...    58   2e-11
KNAG0C03810 Chr3 complement(748315..748563) [249 bp, 82 aa] {ON}...    50   9e-09
Skud_4.95 Chr4 complement(164983..165219) [237 bp, 79 aa] {ON} Y...    48   7e-08
YDL160C-A Chr4 complement(169366..169608) [243 bp, 80 aa] {ON}  ...    47   9e-08
Smik_4.76 Chr4 complement(146162..146401) [240 bp, 80 aa] {ON} Y...    47   2e-07
KAFR0B00900 Chr2 complement(167674..167910) [237 bp, 78 aa] {ON}...    37   0.001
CAGL0J08822g Chr10 (871867..873198) [1332 bp, 443 aa] {ON} simil...    30   1.6  
TBLA0I02690 Chr9 complement(626113..628176) [2064 bp, 687 aa] {O...    28   4.9  
TBLA0J00980 Chr10 (221751..223532) [1782 bp, 593 aa] {ON} Anc_1....    28   5.2  
SAKL0F14058g Chr6 (1117019..1120453) [3435 bp, 1144 aa] {ON} sim...    28   7.7  
Skud_2.360 Chr2 complement(645116..647980) [2865 bp, 954 aa] {ON...    28   7.7  

>TBLA0E00470 Chr5 (86619..86969) [351 bp, 116 aa] {ON} Anc_7.341
           YDL160C-A
          Length = 116

 Score =  229 bits (583), Expect = 5e-79,   Method: Compositional matrix adjust.
 Identities = 116/116 (100%), Positives = 116/116 (100%)

Query: 1   MSNSSNKNTTETDVKLPENTIARILQTSSFVDENTRITKNTVTKLQKYMELFIREAALRS 60
           MSNSSNKNTTETDVKLPENTIARILQTSSFVDENTRITKNTVTKLQKYMELFIREAALRS
Sbjct: 1   MSNSSNKNTTETDVKLPENTIARILQTSSFVDENTRITKNTVTKLQKYMELFIREAALRS 60

Query: 61  LENKEEQISNEKSAVKNEPGLEDTKIFNDNNKLNDNDIELSHEALEAITGLLLLDM 116
           LENKEEQISNEKSAVKNEPGLEDTKIFNDNNKLNDNDIELSHEALEAITGLLLLDM
Sbjct: 61  LENKEEQISNEKSAVKNEPGLEDTKIFNDNNKLNDNDIELSHEALEAITGLLLLDM 116

>TPHA0F02910 Chr6 (644434..644760) [327 bp, 108 aa] {ON} Anc_7.341
           YDL160C-A
          Length = 108

 Score = 93.6 bits (231), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 57/113 (50%), Positives = 74/113 (65%), Gaps = 11/113 (9%)

Query: 8   NTTETDVKLPENTIARILQTSSFVDENTRITKNTVTKLQKYMELFIREAALRSLENKEEQ 67
           N  E D  +P++TIARILQ  SF  E TRI+  +V  LQKYMELF+REA LRS+EN+E++
Sbjct: 2   NEEELDGPIPKDTIARILQLESF-GEETRISAESVGILQKYMELFVREAVLRSIENREQK 60

Query: 68  ISN----EKSAVKNEPGLEDTKIFNDNNKLNDNDIELSHEALEAITGLLLLDM 116
            SN    +K+  K  P  +  + F  +     N IEL+HE LE I+GLLLLDM
Sbjct: 61  QSNIEALKKAPAKANP--DQLQTFQHSF----NGIELTHEDLEEISGLLLLDM 107

>SAKL0F10956g Chr6 complement(858747..859007) [261 bp, 86 aa] {ON}
           similar to uniprot|Q3E829 Saccharomyces cerevisiae
           YDL160C-A Putative protein of unknown function
          Length = 86

 Score = 87.4 bits (215), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 52/101 (51%), Positives = 62/101 (61%), Gaps = 20/101 (19%)

Query: 16  LPENTIARILQTSSFVDENTRITKNTVTKLQKYMELFIREAALRSLENKEEQISNEKSAV 75
           LP++TIARI QT SF  ++TRIT++TV    KY+ELF+REA LRSLENKE          
Sbjct: 6   LPKDTIARIFQTCSFTQDSTRITEDTVALTNKYIELFVREAVLRSLENKE---------- 55

Query: 76  KNEPGLEDTKIFNDNNKLNDNDIELSHEALEAITGLLLLDM 116
           K +P  E            DN   LSHE LE I+GLLLLDM
Sbjct: 56  KVKPETESL----------DNGTVLSHEDLEEISGLLLLDM 86

>TDEL0C02060 Chr3 complement(356665..356931) [267 bp, 88 aa] {ON}
           Anc_7.341 YDL160C-A
          Length = 88

 Score = 85.1 bits (209), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 50/102 (49%), Positives = 61/102 (59%), Gaps = 17/102 (16%)

Query: 15  KLPENTIARILQTSSFVDENTRITKNTVTKLQKYMELFIREAALRSLENKEEQISNEKSA 74
           K+P+ TIAR  Q  +F +E+T IT  TV  +QKYME+F+REA LRS  NK EQI  E S 
Sbjct: 4   KIPKETIARTFQVGAFENESTNITDETVGMMQKYMEVFVREAVLRSSANK-EQIKVEHSG 62

Query: 75  VKNEPGLEDTKIFNDNNKLNDNDIELSHEALEAITGLLLLDM 116
            +                 N N+I L+HE LE ITGLLLLDM
Sbjct: 63  AQR----------------NSNEIVLTHEDLENITGLLLLDM 88

>KLTH0H01452g Chr8 complement(134324..134584) [261 bp, 86 aa] {ON}
           weakly similar to uniprot|Q3E829 Saccharomyces
           cerevisiae YDL160c-a
          Length = 86

 Score = 82.4 bits (202), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 45/101 (44%), Positives = 67/101 (66%), Gaps = 19/101 (18%)

Query: 16  LPENTIARILQTSSFVDENTRITKNTVTKLQKYMELFIREAALRSLENKEEQISNEKSAV 75
           +P +TIARI QT SF D++TRIT++T++ +  Y+E+F+REA LRS+ENKE+        V
Sbjct: 5   IPSDTIARIFQTCSFKDDSTRITESTLSLVDAYLEVFVREALLRSIENKEQ--------V 56

Query: 76  KNEPGLEDTKIFNDNNKLNDNDIELSHEALEAITGLLLLDM 116
           K+E            ++L D  + L+H+ LE ++GLLLLDM
Sbjct: 57  KSE----------HQDQLGDQ-VVLTHKDLERVSGLLLLDM 86

>Kpol_530.37 s530 complement(86462..86728) [267 bp, 88 aa] {ON}
           complement(86462..86728) [267 nt, 89 aa]
          Length = 88

 Score = 79.7 bits (195), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 44/101 (43%), Positives = 58/101 (57%), Gaps = 20/101 (19%)

Query: 16  LPENTIARILQTSSFVDENTRITKNTVTKLQKYMELFIREAALRSLENKEEQISNEKSAV 75
           +P+ TIAR+L+TSSF   +TRIT++ V  LQKYMELF+REA +RS+E K +         
Sbjct: 7   IPKETIARLLETSSFEHSSTRITEDVVEGLQKYMELFVREAIMRSIETKAK--------- 57

Query: 76  KNEPGLEDTKIFNDNNKLNDNDIELSHEALEAITGLLLLDM 116
                        + N      +EL+H  LE I GLLLLDM
Sbjct: 58  -----------LEEENSFTGVRVELTHTDLEEIAGLLLLDM 87

>ZYRO0F11528g Chr6 (946636..947001) [366 bp, 121 aa] {ON} some
           similarities with uniprot|Q3E829 Saccharomyces
           cerevisiae YDL160C-A Identified by homology to Ashbya
           gossypii
          Length = 121

 Score = 79.3 bits (194), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 46/111 (41%), Positives = 64/111 (57%), Gaps = 22/111 (19%)

Query: 7   KNTTETDVKL-PENTIARILQTSSFVDENTRITKNTVTKLQKYMELFIREAALRSLENKE 65
           +N    D+ + P+ TI RIL+  +F  E+T IT+ TVT LQKY+E+F+REA  RS+ NK+
Sbjct: 32  QNIGHVDMSMVPKETIVRILKLQAFEHESTTITEETVTMLQKYLEVFVREAVQRSVANKD 91

Query: 66  EQISNEKSAVKNEPGLEDTKIFNDNNKLNDNDIELSHEALEAITGLLLLDM 116
            Q S+                        D +I+L+HE LE ITG+LLLDM
Sbjct: 92  SQGSHGDG---------------------DGEIQLNHEDLEKITGMLLLDM 121

>Kwal_YGOB_Anc_7.341 s56 (1073424..1073684) [261 bp, 86 aa] {ON}
           ANNOTATED BY YGOB -
          Length = 86

 Score = 77.8 bits (190), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 43/101 (42%), Positives = 68/101 (67%), Gaps = 19/101 (18%)

Query: 16  LPENTIARILQTSSFVDENTRITKNTVTKLQKYMELFIREAALRSLENKEEQISNEKSAV 75
           +P++TIARI QT SF +++TRIT+ T+T + +Y+E+F+REA LRS+ENK++        V
Sbjct: 5   VPKDTIARIFQTCSFQNDSTRITETTLTLVDEYLEIFVREAILRSIENKDQ--------V 56

Query: 76  KNEPGLEDTKIFNDNNKLNDNDIELSHEALEAITGLLLLDM 116
           K+E            ++L  + + L+H+ LE ++GLLLLDM
Sbjct: 57  KDE----------HQDQLG-SQVVLTHKDLERVSGLLLLDM 86

>Ecym_4520 Chr4 (1036442..1036717) [276 bp, 91 aa] {ON} similar to
           Ashbya gossypii ACL158W
          Length = 91

 Score = 75.5 bits (184), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 44/101 (43%), Positives = 61/101 (60%), Gaps = 18/101 (17%)

Query: 16  LPENTIARILQTSSFVDENTRITKNTVTKLQKYMELFIREAALRSLENKEEQISNEKSAV 75
           +P +TIARI Q  SF  ++TRIT++T+T  +KY++LF+REA LRSLENK++        V
Sbjct: 9   VPSDTIARIFQLCSFTQDSTRITEDTITLTEKYIKLFVREAVLRSLENKDK--------V 60

Query: 76  KNEPGLEDTKIFNDNNKLNDNDIELSHEALEAITGLLLLDM 116
           K E G            L +  + L H  LE I+G+LLLD 
Sbjct: 61  KKEDG---------KGSLIEGPV-LHHTDLEEISGILLLDF 91

>CAGL0I03432g Chr9 complement(292162..292611) [450 bp, 149 aa] {ON}
           some similarities with KLLA0C16709g Kluyveromyces lactis
           and DEHA0G05016g Debaryomyces hansenii and CA5994|IPF677
           Candida albicans
          Length = 149

 Score = 75.1 bits (183), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 40/101 (39%), Positives = 60/101 (59%), Gaps = 21/101 (20%)

Query: 16  LPENTIARILQTSSFVDENTRITKNTVTKLQKYMELFIREAALRSLENKEEQISNEKSAV 75
           +P++TIAR+LQ ++F D+ TRI  + V  LQ+Y+++F REA LRS+E+ +          
Sbjct: 70  VPQDTIARVLQVAAFKDKKTRIESDVVDALQRYIDVFAREAVLRSIEHHD---------- 119

Query: 76  KNEPGLEDTKIFNDNNKLNDNDIELSHEALEAITGLLLLDM 116
            ++ GLE            + D E++H  LE I GLLLLDM
Sbjct: 120 ASQEGLE-----------QEQDKEITHTDLENIAGLLLLDM 149

>ACL158W Chr3 (78852..79139) [288 bp, 95 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YDL161CX; YDL161CX was
           overlooked in Saccharomyces cerevisiae
          Length = 95

 Score = 72.0 bits (175), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 41/101 (40%), Positives = 60/101 (59%), Gaps = 18/101 (17%)

Query: 16  LPENTIARILQTSSFVDENTRITKNTVTKLQKYMELFIREAALRSLENKEEQISNEKSAV 75
           +P +TIAR+  T SF  ++T+IT++ VT +++YM+LFIREA LRSLENKE+        V
Sbjct: 13  IPTDTIARLFHTCSFTQDSTKITEDAVTLVERYMKLFIREAVLRSLENKEK--------V 64

Query: 76  KNEPGLEDTKIFNDNNKLNDNDIELSHEALEAITGLLLLDM 116
           K E            +   +  + L H  LE I+G+L+LD 
Sbjct: 65  KQE---------TRADSFAEGPV-LQHTDLEEISGVLILDF 95

>NCAS0A14080 Chr1 (2768035..2768271) [237 bp, 78 aa] {ON}
          Length = 78

 Score = 69.3 bits (168), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 39/103 (37%), Positives = 59/103 (57%), Gaps = 25/103 (24%)

Query: 14  VKLPENTIARILQTSSFVDENTRITKNTVTKLQKYMELFIREAALRSLENKEEQISNEKS 73
           + +P+ TIA+ILQ  +F + +T++T+ T++ +Q+YMELFIREA  RSL+NKE++      
Sbjct: 1   MAIPKETIAQILQLEAFENADTKMTEETLSMIQRYMELFIREAMCRSLDNKEKE------ 54

Query: 74  AVKNEPGLEDTKIFNDNNKLNDNDIELSHEALEAITGLLLLDM 116
                              L   DI +  + LE + GLLLLDM
Sbjct: 55  -------------------LGQTDIVIDEKDLERVVGLLLLDM 78

>KLLA0C16709g Chr3 (1463056..1463295) [240 bp, 79 aa] {ON} conserved
           hypothetical protein
          Length = 79

 Score = 65.1 bits (157), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 52/97 (53%), Gaps = 27/97 (27%)

Query: 20  TIARILQTSSFVDENTRITKNTVTKLQKYMELFIREAALRSLENKEEQISNEKSAVKNEP 79
           TIARILQT  F D NTRIT+  +  L+ Y+ELF+RE  LRSLENK + ++++        
Sbjct: 9   TIARILQTEGFQDSNTRITEECMQLLEPYIELFVREGVLRSLENKADMLADK-------- 60

Query: 80  GLEDTKIFNDNNKLNDNDIELSHEALEAITGLLLLDM 116
               T  F D               LEA+ GLLL+D 
Sbjct: 61  ----TVDFVD---------------LEAVAGLLLMDF 78

>Suva_4.84 Chr4 complement(156977..157219) [243 bp, 81 aa] {ON}
           YDL160C-A (REAL)
          Length = 81

 Score = 58.9 bits (141), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 40/102 (39%), Positives = 54/102 (52%), Gaps = 24/102 (23%)

Query: 16  LPENTIARIL-QTSSFVDENTRITKNTVTKLQKYMELFIREAALRSLENKEEQISNEKSA 74
           LP+  I +IL Q +S  D+N +I    +  +QKY+E+FI EAALRSL++           
Sbjct: 3   LPKEAIIKILSQNNS--DKNIKIDDKVIPMIQKYLEIFIEEAALRSLQSH---------- 50

Query: 75  VKNEPGLEDTKIFNDNNKLNDNDIELSHEALEAITGLLLLDM 116
            K+  G  D           D  +ELSH  LE I GLLL+DM
Sbjct: 51  -KDSSGAHD----------GDGPLELSHLDLERIVGLLLMDM 81

>NDAI0A01950 Chr1 (434811..435179) [369 bp, 122 aa] {ON} Anc_7.341
           YDL160C-A
          Length = 122

 Score = 58.2 bits (139), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 38/107 (35%), Positives = 60/107 (56%), Gaps = 15/107 (14%)

Query: 11  ETDVKLPENTIARILQTSSFVDENTRITKNTVTKLQKYMELFIREAALRSLENK-EEQIS 69
           + D+ +   TI +IL++ SF +++T ITK T+  +Q+YM+LFI+EA +RS ENK   Q+ 
Sbjct: 30  QADMTILLETIEKILRSESFQNKDTTITKETILMIQRYMDLFIKEAVIRSYENKVATQVE 89

Query: 70  NEKSAVKNEPGLEDTKIFNDNNKLNDNDIELSHEALEAITGLLLLDM 116
           +       +                D  IEL+H  LE I GLLL+++
Sbjct: 90  DFDDEEDADE--------------EDKTIELTHLDLERIVGLLLMEL 122

>KNAG0C03810 Chr3 complement(748315..748563) [249 bp, 82 aa] {ON}
           Anc_7.341 YDL160C-A
          Length = 82

 Score = 50.1 bits (118), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 35/103 (33%), Positives = 52/103 (50%), Gaps = 28/103 (27%)

Query: 14  VKLPENTIARILQTSSFVDENTRITKNTVTKLQKYMELFIREAALRSLENKEEQISNEKS 73
           +++   T++RIL T SF +++T I    +T +QKY+E +++E  LRSLENK+        
Sbjct: 7   IQISRETLSRIL-TQSFKNKSTTIDDQALTSVQKYVETYVQEIILRSLENKD-------- 57

Query: 74  AVKNEPGLEDTKIFNDNNKLNDNDIELSHEALEAITGLLLLDM 116
                              L  N  EL+   +E I GLLLLDM
Sbjct: 58  -------------------LGVNPAELTERDIERILGLLLLDM 81

>Skud_4.95 Chr4 complement(164983..165219) [237 bp, 79 aa] {ON}
           YDL160C-A (REAL)
          Length = 79

 Score = 47.8 bits (112), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 30/101 (29%), Positives = 52/101 (51%), Gaps = 23/101 (22%)

Query: 16  LPENTIARILQTSSFVDENTRITKNTVTKLQKYMELFIREAALRSLENKEEQISNEKSAV 75
           L ++ + +IL  ++F  ++ +I    +  +Q Y+++FI EAALRSL+++++     +   
Sbjct: 2   LSKDALIKILSQNNF-RKDIKIDDKVLPMIQNYLDIFIEEAALRSLQSQKDASGGHR--- 57

Query: 76  KNEPGLEDTKIFNDNNKLNDNDIELSHEALEAITGLLLLDM 116
                              D  +ELSH  LE I GLLL+DM
Sbjct: 58  -------------------DGPLELSHLDLERIVGLLLMDM 79

>YDL160C-A Chr4 complement(169366..169608) [243 bp, 80 aa] {ON}
           MHF2Protein of unknown function; ortholog of human MHF2,
           and component of the heterotetrameric MHF histone-fold
           complex that in humans interacts with both DNA and Mph1p
           ortholog FANCM to stabilize and remodel blocked
           replication forks and repair damaged DNA; mhf2 srs2
           double mutants are MMS hypersensitive
          Length = 80

 Score = 47.4 bits (111), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 28/83 (33%), Positives = 45/83 (54%), Gaps = 21/83 (25%)

Query: 34  NTRITKNTVTKLQKYMELFIREAALRSLENKEEQISNEKSAVKNEPGLEDTKIFNDNNKL 93
           + +I    V  +QKY+++FI EA LRSL++ ++ I+ E+                     
Sbjct: 19  DMKIADEVVPMIQKYLDIFIDEAVLRSLQSHKD-INGERG-------------------- 57

Query: 94  NDNDIELSHEALEAITGLLLLDM 116
           + + +ELSH+ LE I GLLL+DM
Sbjct: 58  DKSPLELSHQDLERIVGLLLMDM 80

>Smik_4.76 Chr4 complement(146162..146401) [240 bp, 80 aa] {ON}
           YDL160C-A (REAL)
          Length = 80

 Score = 46.6 bits (109), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 47/84 (55%), Gaps = 21/84 (25%)

Query: 33  ENTRITKNTVTKLQKYMELFIREAALRSLENKEEQISNEKSAVKNEPGLEDTKIFNDNNK 92
           ++  I+   +  +QKY+++FI EAALRSL++ ++ I+ E    K +P             
Sbjct: 18  KDIEISDEVIPMIQKYLDIFIEEAALRSLQSHKD-INKEHD--KKDP------------- 61

Query: 93  LNDNDIELSHEALEAITGLLLLDM 116
                +ELSH+ LE + G+LL+DM
Sbjct: 62  -----LELSHQDLERVVGVLLMDM 80

>KAFR0B00900 Chr2 complement(167674..167910) [237 bp, 78 aa] {ON}
           Anc_7.341 YDL160C-A
          Length = 78

 Score = 37.0 bits (84), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 35/104 (33%), Positives = 47/104 (45%), Gaps = 27/104 (25%)

Query: 14  VKLPENTIARILQTS-SFVDENTRITKNTVTKLQKYMELFIREAALRSLENKEEQISNEK 72
           + +P+ TI+RIL    +   EN  I   TV  + KY ++ I E  LRSLENKE       
Sbjct: 1   MSIPKETISRILLNKLNENGENFSINTETVESVTKYTDVLIEEMVLRSLENKE------- 53

Query: 73  SAVKNEPGLEDTKIFNDNNKLNDNDIELSHEALEAITGLLLLDM 116
           +  +  P L+                    + LE I GLLLLDM
Sbjct: 54  NIAEATPTLD-------------------VDDLEKIIGLLLLDM 78

>CAGL0J08822g Chr10 (871867..873198) [1332 bp, 443 aa] {ON} similar
           to uniprot|P24871 Saccharomyces cerevisiae YLR210w CLB4
           cyclin or uniprot|P24870 Saccharomyces cerevisiae
           YDL155w CLB3 cyclin
          Length = 443

 Score = 29.6 bits (65), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 15/32 (46%), Positives = 21/32 (65%)

Query: 67  QISNEKSAVKNEPGLEDTKIFNDNNKLNDNDI 98
           QI++  + V+NEPG E   IF D + L+D DI
Sbjct: 88  QINSGYANVENEPGKETDHIFIDQDDLSDLDI 119

>TBLA0I02690 Chr9 complement(626113..628176) [2064 bp, 687 aa]
          {ON} Anc_4.212 YGR065C
          Length = 687

 Score = 28.1 bits (61), Expect = 4.9,   Method: Composition-based stats.
 Identities = 13/22 (59%), Positives = 16/22 (72%)

Query: 76 KNEPGLEDTKIFNDNNKLNDND 97
          KNE  L DTKI + +NKLN N+
Sbjct: 62 KNEYELHDTKITSTSNKLNSNN 83

>TBLA0J00980 Chr10 (221751..223532) [1782 bp, 593 aa] {ON} Anc_1.183
           YJL163C
          Length = 593

 Score = 28.1 bits (61), Expect = 5.2,   Method: Composition-based stats.
 Identities = 21/83 (25%), Positives = 42/83 (50%), Gaps = 2/83 (2%)

Query: 19  NTIARILQTSSFVDENTRITKNTVTKLQKYMELFIREAALRSLENKEEQISNEKSAVKNE 78
           N + +   +S+ + EN++ + +     + + EL I      SLE  ++ I N+ S+    
Sbjct: 3   NPLTKFSNSSTMLLENSKTSDDKQNNYRSH-ELSIDTTMKNSLEESDD-IMNDPSSNIII 60

Query: 79  PGLEDTKIFNDNNKLNDNDIELS 101
            GL DT+  +  NK+N  ++E +
Sbjct: 61  AGLSDTQTSSVWNKINQEELEYT 83

>SAKL0F14058g Chr6 (1117019..1120453) [3435 bp, 1144 aa] {ON} similar
            to uniprot|Q755W9 Ashbya gossypii AER399C AER399Cp and
            some similarites with YJR089W uniprot|P47134
            Saccharomyces cerevisiae YJR089W BIR1 Protein involved in
            cell cycle regulation and chromosome segregation contains
            BIR (Baculovirus Inhibitor of apoptosis Repeat) domain
          Length = 1144

 Score = 27.7 bits (60), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 29/49 (59%), Gaps = 7/49 (14%)

Query: 1    MSNSSNKNTTETDVKLPENTIARILQTSSFVDENTRITKNTVTKLQKYM 49
            +++ +NK  TET   LP+ T AR+       DEN +I ++ + +L +Y+
Sbjct: 1016 LTSVTNKKLTETWSILPKGTFARM-------DENKKIVRDYLHELLQYI 1057

>Skud_2.360 Chr2 complement(645116..647980) [2865 bp, 954 aa] {ON}
           YBR229C (REAL)
          Length = 954

 Score = 27.7 bits (60), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 17/73 (23%), Positives = 33/73 (45%), Gaps = 3/73 (4%)

Query: 7   KNTTETDVKLPENTIARILQTSSFVDENTRITKNTVTKLQKYMELFIREAALRSLENKEE 66
            N +ET++  P           SFV++   + K  ++     + LFI    + +++NK  
Sbjct: 756 PNQSETEMIFPPGIFYEFSSLDSFVNDGINLMKRNISAPLDKIPLFIEGGHIITMKNKYR 815

Query: 67  QISNEKSAVKNEP 79
           + S     +KN+P
Sbjct: 816 RSSK---LMKNDP 825

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.305    0.124    0.313 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 13,149,461
Number of extensions: 574272
Number of successful extensions: 3274
Number of sequences better than 10.0: 226
Number of HSP's gapped: 3247
Number of HSP's successfully gapped: 227
Length of query: 116
Length of database: 53,481,399
Length adjustment: 86
Effective length of query: 30
Effective length of database: 43,620,123
Effective search space: 1308603690
Effective search space used: 1308603690
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 43 (22.0 bits)
S2: 59 (27.3 bits)