Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0E004407.352ON1151035211e-69
YLR200W (YKE2)7.352ON1141003832e-48
KAFR0L014907.352ON1071003803e-48
NCAS0E028607.352ON105993796e-48
ZYRO0F11748g7.352ON1091003796e-48
Suva_10.2957.352ON1141003753e-47
Smik_12.2597.352ON1141003666e-46
Skud_12.2647.352ON1141003622e-45
TDEL0C019607.352ON1071003605e-45
CAGL0A03971g7.352ON1061013519e-44
NDAI0E044607.352ON1061033511e-43
Kpol_530.297.352ON1071003501e-43
TPHA0F029907.352ON1071003492e-43
KNAG0B026107.352ON119973485e-43
Ecym_47217.352ON1071033458e-43
KLTH0H01210g7.352ON1131023459e-43
ACL146C7.352ON1071033432e-42
Kwal_56.246487.352ON1131023381e-41
KLLA0D12298g7.352ON1151033354e-41
SAKL0F11418g7.352ON1151033293e-40
NDAI0I02660na 1ON594103700.39
YGR003W (CUL3)4.138ON74429651.6
TDEL0G024502.315ON34150651.8
Kpol_479.38.604ON79591641.9
TPHA0O003601.468ON74629642.5
KNAG0M02650singletonON57447616.2
KAFR0B038008.809ON795100607.6
NDAI0H027202.427ON23429598.0
Smik_11.3525.690ON90933608.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0E00440
         (115 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0E00440 Chr5 (82880..83227) [348 bp, 115 aa] {ON} Anc_7.352 ...   205   1e-69
YLR200W Chr12 (549012..549356) [345 bp, 114 aa] {ON}  YKE2Subuni...   152   2e-48
KAFR0L01490 Chr12 complement(275355..275678) [324 bp, 107 aa] {O...   150   3e-48
NCAS0E02860 Chr5 (561551..561868) [318 bp, 105 aa] {ON} Anc_7.35...   150   6e-48
ZYRO0F11748g Chr6 complement(960734..961063) [330 bp, 109 aa] {O...   150   6e-48
Suva_10.295 Chr10 (521814..522158) [345 bp, 114 aa] {ON} YLR200W...   149   3e-47
Smik_12.259 Chr12 (496033..496377) [345 bp, 114 aa] {ON} YLR200W...   145   6e-46
Skud_12.264 Chr12 (495654..495998) [345 bp, 114 aa] {ON} YLR200W...   144   2e-45
TDEL0C01960 Chr3 (343261..343584) [324 bp, 107 aa] {ON} Anc_7.35...   143   5e-45
CAGL0A03971g Chr1 complement(400291..400611) [321 bp, 106 aa] {O...   139   9e-44
NDAI0E04460 Chr5 (1005674..1005994) [321 bp, 106 aa] {ON} Anc_7....   139   1e-43
Kpol_530.29 s530 (74361..74684) [324 bp, 107 aa] {ON} (74361..74...   139   1e-43
TPHA0F02990 Chr6 complement(656466..656789) [324 bp, 107 aa] {ON...   139   2e-43
KNAG0B02610 Chr2 (507118..507477) [360 bp, 119 aa] {ON} Anc_7.35...   138   5e-43
Ecym_4721 Chr4 (1413362..1413685) [324 bp, 107 aa] {ON} similar ...   137   8e-43
KLTH0H01210g Chr8 (119243..119584) [342 bp, 113 aa] {ON} similar...   137   9e-43
ACL146C Chr3 complement(93269..93592) [324 bp, 107 aa] {ON} Synt...   136   2e-42
Kwal_56.24648 s56 complement(1088138..1088479) [342 bp, 113 aa] ...   134   1e-41
KLLA0D12298g Chr4 (1048089..1048436) [348 bp, 115 aa] {ON} simil...   133   4e-41
SAKL0F11418g Chr6 complement(887825..888172) [348 bp, 115 aa] {O...   131   3e-40
NDAI0I02660 Chr9 complement(619959..621743) [1785 bp, 594 aa] {O...    32   0.39 
YGR003W Chr7 (500132..502366) [2235 bp, 744 aa] {ON}  CUL3Ubiqui...    30   1.6  
TDEL0G02450 Chr7 (467216..468241) [1026 bp, 341 aa] {ON} Anc_2.3...    30   1.8  
Kpol_479.3 s479 (2938..5325) [2388 bp, 795 aa] {ON} (2938..5325)...    29   1.9  
TPHA0O00360 Chr15 (57394..59634) [2241 bp, 746 aa] {ON} Anc_1.46...    29   2.5  
KNAG0M02650 Chr13 complement(490275..491999) [1725 bp, 574 aa] {...    28   6.2  
KAFR0B03800 Chr2 (788639..791026) [2388 bp, 795 aa] {ON} Anc_8.8...    28   7.6  
NDAI0H02720 Chr8 complement(671139..671843) [705 bp, 234 aa] {ON...    27   8.0  
Smik_11.352 Chr11 complement(595605..598334) [2730 bp, 909 aa] {...    28   8.6  

>TBLA0E00440 Chr5 (82880..83227) [348 bp, 115 aa] {ON} Anc_7.352
           YLR200W
          Length = 115

 Score =  205 bits (521), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 103/103 (100%), Positives = 103/103 (100%)

Query: 1   MSSNELATKYQTFQNELEGFIVTRQKLETQLQENKIVNDEFEKLKEETKVFKLTGNVLLP 60
           MSSNELATKYQTFQNELEGFIVTRQKLETQLQENKIVNDEFEKLKEETKVFKLTGNVLLP
Sbjct: 1   MSSNELATKYQTFQNELEGFIVTRQKLETQLQENKIVNDEFEKLKEETKVFKLTGNVLLP 60

Query: 61  IEQDEARSNIDKRLEFIQTEIDRCEKNIKAKQAEMEKIRSELM 103
           IEQDEARSNIDKRLEFIQTEIDRCEKNIKAKQAEMEKIRSELM
Sbjct: 61  IEQDEARSNIDKRLEFIQTEIDRCEKNIKAKQAEMEKIRSELM 103

>YLR200W Chr12 (549012..549356) [345 bp, 114 aa] {ON}  YKE2Subunit
           of the heterohexameric Gim/prefoldin protein complex
           involved in the folding of alpha-tubulin, beta-tubulin,
           and actin
          Length = 114

 Score =  152 bits (383), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 74/100 (74%), Positives = 89/100 (89%)

Query: 4   NELATKYQTFQNELEGFIVTRQKLETQLQENKIVNDEFEKLKEETKVFKLTGNVLLPIEQ 63
           +EL  KYQ  QNELE FIV RQKLETQLQENKIVN+EF++L+E+T V+KLTGNVLLP+EQ
Sbjct: 2   SELGAKYQQLQNELEEFIVARQKLETQLQENKIVNEEFDQLEEDTPVYKLTGNVLLPVEQ 61

Query: 64  DEARSNIDKRLEFIQTEIDRCEKNIKAKQAEMEKIRSELM 103
            EAR+N+DKRLEFI+TEI RCEKNI+ KQ E+EK+RSEL+
Sbjct: 62  SEARTNVDKRLEFIETEITRCEKNIRDKQEELEKMRSELI 101

>KAFR0L01490 Chr12 complement(275355..275678) [324 bp, 107 aa] {ON}
           Anc_7.352 YLR200W
          Length = 107

 Score =  150 bits (380), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 75/100 (75%), Positives = 87/100 (87%)

Query: 4   NELATKYQTFQNELEGFIVTRQKLETQLQENKIVNDEFEKLKEETKVFKLTGNVLLPIEQ 63
           +ELA +YQ  Q+ELE  IV RQKLETQLQENKIVNDEF+ LKEET+V+KLTGNVLLPIEQ
Sbjct: 2   SELAAQYQKLQSELEELIVARQKLETQLQENKIVNDEFKSLKEETQVYKLTGNVLLPIEQ 61

Query: 64  DEARSNIDKRLEFIQTEIDRCEKNIKAKQAEMEKIRSELM 103
           DEAR N+DKRLEFI+ EI RCE NIK+KQ E+E IR+EL+
Sbjct: 62  DEARGNVDKRLEFIEKEITRCEGNIKSKQTEIENIRNELV 101

>NCAS0E02860 Chr5 (561551..561868) [318 bp, 105 aa] {ON} Anc_7.352
           YLR200W
          Length = 105

 Score =  150 bits (379), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 71/99 (71%), Positives = 89/99 (89%)

Query: 5   ELATKYQTFQNELEGFIVTRQKLETQLQENKIVNDEFEKLKEETKVFKLTGNVLLPIEQD 64
           +L  +YQ+ Q+ELE FI+ RQKLETQLQENKIV DEFE+L +ETKV+KLTGNVLLP+EQD
Sbjct: 3   DLPAQYQSLQSELESFIIARQKLETQLQENKIVMDEFEQLVDETKVYKLTGNVLLPVEQD 62

Query: 65  EARSNIDKRLEFIQTEIDRCEKNIKAKQAEMEKIRSELM 103
           EARSN++KRLEFIQ+EI +CEKNIK KQ E+EK+R+E++
Sbjct: 63  EARSNVEKRLEFIQSEITKCEKNIKQKQEELEKVRAEII 101

>ZYRO0F11748g Chr6 complement(960734..961063) [330 bp, 109 aa] {ON}
           highly similar to uniprot|P52553 Saccharomyces
           cerevisiae YLR200W YKE2 Yeast nuclear gene
          Length = 109

 Score =  150 bits (379), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 71/100 (71%), Positives = 86/100 (86%)

Query: 4   NELATKYQTFQNELEGFIVTRQKLETQLQENKIVNDEFEKLKEETKVFKLTGNVLLPIEQ 63
           +ELA +YQ  Q ELE FIV RQKLETQLQENKIV+DEF  LK ++KV+KLTGNVLLP+EQ
Sbjct: 2   SELAAQYQKLQGELENFIVARQKLETQLQENKIVDDEFNGLKSDSKVYKLTGNVLLPVEQ 61

Query: 64  DEARSNIDKRLEFIQTEIDRCEKNIKAKQAEMEKIRSELM 103
           D+AR+N+ KRLEFIQTEIDRCE NIK KQ E E++++EL+
Sbjct: 62  DDARTNVSKRLEFIQTEIDRCENNIKGKQEEQERVKAELI 101

>Suva_10.295 Chr10 (521814..522158) [345 bp, 114 aa] {ON} YLR200W
           (REAL)
          Length = 114

 Score =  149 bits (375), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 71/100 (71%), Positives = 88/100 (88%)

Query: 4   NELATKYQTFQNELEGFIVTRQKLETQLQENKIVNDEFEKLKEETKVFKLTGNVLLPIEQ 63
           +EL  KYQ  Q+ELE FIV RQKLETQLQENKIVN+EF++LKE+T V+KLTGNVLLP+EQ
Sbjct: 2   SELGAKYQHLQSELEEFIVARQKLETQLQENKIVNEEFDQLKEDTPVYKLTGNVLLPVEQ 61

Query: 64  DEARSNIDKRLEFIQTEIDRCEKNIKAKQAEMEKIRSELM 103
            EAR N++KRLEFI+TEI RCEKNI+ KQ E+E++R+EL+
Sbjct: 62  SEARGNVEKRLEFIETEIKRCEKNIRGKQEELEQVRNELV 101

>Smik_12.259 Chr12 (496033..496377) [345 bp, 114 aa] {ON} YLR200W
           (REAL)
          Length = 114

 Score =  145 bits (366), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 70/100 (70%), Positives = 86/100 (86%)

Query: 4   NELATKYQTFQNELEGFIVTRQKLETQLQENKIVNDEFEKLKEETKVFKLTGNVLLPIEQ 63
           +EL TKYQ  Q ELE FIV RQKLETQLQENKIVN+EF++L+E T V+KLTGNVLLP++Q
Sbjct: 2   SELGTKYQHLQGELEEFIVARQKLETQLQENKIVNEEFDQLEENTPVYKLTGNVLLPVDQ 61

Query: 64  DEARSNIDKRLEFIQTEIDRCEKNIKAKQAEMEKIRSELM 103
            EAR N+DKRLEFI+ EI RCEKNIK KQ ++EK+R++L+
Sbjct: 62  SEARGNVDKRLEFIEAEITRCEKNIKDKQEQLEKVRNDLI 101

>Skud_12.264 Chr12 (495654..495998) [345 bp, 114 aa] {ON} YLR200W
           (REAL)
          Length = 114

 Score =  144 bits (362), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 68/100 (68%), Positives = 87/100 (87%)

Query: 4   NELATKYQTFQNELEGFIVTRQKLETQLQENKIVNDEFEKLKEETKVFKLTGNVLLPIEQ 63
           +EL  +YQ  Q+ELE FIV RQKLETQLQENKIVN+EF+++ ++T V+KLTGNVLLP+EQ
Sbjct: 2   SELGAEYQHLQSELEEFIVARQKLETQLQENKIVNEEFDQIGDDTPVYKLTGNVLLPVEQ 61

Query: 64  DEARSNIDKRLEFIQTEIDRCEKNIKAKQAEMEKIRSELM 103
            EAR N+DKRLEFI+TEI RCE+NI+ KQ E+EK+R+EL+
Sbjct: 62  SEARGNVDKRLEFIETEIKRCERNIREKQDELEKVRNELI 101

>TDEL0C01960 Chr3 (343261..343584) [324 bp, 107 aa] {ON} Anc_7.352
           YLR200W
          Length = 107

 Score =  143 bits (360), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 68/100 (68%), Positives = 85/100 (85%)

Query: 4   NELATKYQTFQNELEGFIVTRQKLETQLQENKIVNDEFEKLKEETKVFKLTGNVLLPIEQ 63
           ++LA  YQ  Q+ELE  ++ RQKLETQLQENKIV++EF +LKE+T+V+KLTGNVLLP+EQ
Sbjct: 2   SDLAAAYQALQSELEVLVIARQKLETQLQENKIVSEEFSELKEDTQVYKLTGNVLLPVEQ 61

Query: 64  DEARSNIDKRLEFIQTEIDRCEKNIKAKQAEMEKIRSELM 103
            EA SN+ KRLEFIQTEI RCE N+KAKQ E EK+R+EL+
Sbjct: 62  SEANSNVAKRLEFIQTEIGRCENNLKAKQQEQEKLRAELI 101

>CAGL0A03971g Chr1 complement(400291..400611) [321 bp, 106 aa] {ON}
           similar to uniprot|P52553 Saccharomyces cerevisiae
           YLR200w YKE2 Gim complex component
          Length = 106

 Score =  139 bits (351), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 67/101 (66%), Positives = 82/101 (81%)

Query: 3   SNELATKYQTFQNELEGFIVTRQKLETQLQENKIVNDEFEKLKEETKVFKLTGNVLLPIE 62
           S EL  KYQ+ QNELE  +  RQKLETQLQENKIVN+EF  LKE+T V+KLTGNVLLP+E
Sbjct: 2   SAELGAKYQSLQNELEELVTARQKLETQLQENKIVNEEFATLKEDTVVYKLTGNVLLPVE 61

Query: 63  QDEARSNIDKRLEFIQTEIDRCEKNIKAKQAEMEKIRSELM 103
            D+A++N+DKRLEFI  EI RCE NI++KQ E+E IR +L+
Sbjct: 62  HDDAKNNVDKRLEFIGEEIKRCEDNIRSKQQELETIRGQLI 102

>NDAI0E04460 Chr5 (1005674..1005994) [321 bp, 106 aa] {ON} Anc_7.352
           YLR200W
          Length = 106

 Score =  139 bits (351), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 68/103 (66%), Positives = 85/103 (82%), Gaps = 1/103 (0%)

Query: 1   MSSNELATKYQTFQNELEGFIVTRQKLETQLQENKIVNDEFEKLKEETKVFKLTGNVLLP 60
           M+SN L +KYQ  Q ELE  I+ RQKLETQLQENKIV +EF +L  E++V+KLTGNVLLP
Sbjct: 1   MASN-LPSKYQVLQGELEDLIMARQKLETQLQENKIVIEEFNQLPSESQVYKLTGNVLLP 59

Query: 61  IEQDEARSNIDKRLEFIQTEIDRCEKNIKAKQAEMEKIRSELM 103
           ++Q+EA SN+DKRLEFIQTEI RCE NIK KQ E++ +RSE++
Sbjct: 60  VDQEEAHSNVDKRLEFIQTEISRCENNIKNKQQELDNVRSEIL 102

>Kpol_530.29 s530 (74361..74684) [324 bp, 107 aa] {ON}
           (74361..74684) [324 nt, 108 aa]
          Length = 107

 Score =  139 bits (350), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 69/100 (69%), Positives = 85/100 (85%)

Query: 4   NELATKYQTFQNELEGFIVTRQKLETQLQENKIVNDEFEKLKEETKVFKLTGNVLLPIEQ 63
           ++LA KYQ  Q ELE  IV R++LETQLQENKIVN+EFE LKE+T+V+KLTGNVLLP+EQ
Sbjct: 2   SDLANKYQKIQGELEEVIVARRQLETQLQENKIVNEEFEGLKEDTQVYKLTGNVLLPVEQ 61

Query: 64  DEARSNIDKRLEFIQTEIDRCEKNIKAKQAEMEKIRSELM 103
            EARSN++KRLEFI+ EI +CE NIK+KQ E+ K+R ELM
Sbjct: 62  FEARSNVEKRLEFIEAEIKKCEDNIKSKQTELNKLRDELM 101

>TPHA0F02990 Chr6 complement(656466..656789) [324 bp, 107 aa] {ON}
           Anc_7.352 YLR200W
          Length = 107

 Score =  139 bits (349), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 67/100 (67%), Positives = 84/100 (84%)

Query: 4   NELATKYQTFQNELEGFIVTRQKLETQLQENKIVNDEFEKLKEETKVFKLTGNVLLPIEQ 63
           +++A KYQ+ Q ELE  I+ RQKLETQLQENKIVNDEF  L E+T ++KLTGNV+LPIEQ
Sbjct: 2   SDVAAKYQSVQGELEELIIARQKLETQLQENKIVNDEFNDLNEDTPIYKLTGNVMLPIEQ 61

Query: 64  DEARSNIDKRLEFIQTEIDRCEKNIKAKQAEMEKIRSELM 103
            EA+SN++KRLEFI+ EI RCE+NIK KQ E++K+R ELM
Sbjct: 62  FEAKSNVEKRLEFIENEIKRCEENIKTKQDELDKLRGELM 101

>KNAG0B02610 Chr2 (507118..507477) [360 bp, 119 aa] {ON} Anc_7.352
           YLR200W
          Length = 119

 Score =  138 bits (348), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 68/97 (70%), Positives = 82/97 (84%)

Query: 7   ATKYQTFQNELEGFIVTRQKLETQLQENKIVNDEFEKLKEETKVFKLTGNVLLPIEQDEA 66
           A KYQ  Q+ LE  IV RQKLETQLQENKIV +EF+ LKE++KV+KLTG+VLLP++QDEA
Sbjct: 5   AAKYQKAQSALEELIVARQKLETQLQENKIVIEEFDALKEDSKVYKLTGSVLLPVDQDEA 64

Query: 67  RSNIDKRLEFIQTEIDRCEKNIKAKQAEMEKIRSELM 103
           R+N+DKRLEFI  EIDRCE+NIK KQ  +E +RSELM
Sbjct: 65  RTNVDKRLEFINGEIDRCEENIKEKQETLEGLRSELM 101

>Ecym_4721 Chr4 (1413362..1413685) [324 bp, 107 aa] {ON} similar to
           Ashbya gossypii ACL146C
          Length = 107

 Score =  137 bits (345), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 68/103 (66%), Positives = 81/103 (78%)

Query: 1   MSSNELATKYQTFQNELEGFIVTRQKLETQLQENKIVNDEFEKLKEETKVFKLTGNVLLP 60
           MS  ++A KY   Q ELE  IVTRQKLETQLQENKIVN+E + LKE+ +V+KLTG VLLP
Sbjct: 1   MSVEQVAAKYTQLQGELEQLIVTRQKLETQLQENKIVNEELQSLKEDKQVYKLTGGVLLP 60

Query: 61  IEQDEARSNIDKRLEFIQTEIDRCEKNIKAKQAEMEKIRSELM 103
           +E +EA SN+ KRLEFIQ EIDRCE NIK KQ E+E+ R EL+
Sbjct: 61  VEHEEANSNVSKRLEFIQGEIDRCEGNIKNKQQELEQARDELI 103

>KLTH0H01210g Chr8 (119243..119584) [342 bp, 113 aa] {ON} similar to
           uniprot|P52553 Saccharomyces cerevisiae YLR200W YKE2
           Yeast nuclear gene
          Length = 113

 Score =  137 bits (345), Expect = 9e-43,   Method: Compositional matrix adjust.
 Identities = 66/102 (64%), Positives = 84/102 (82%)

Query: 2   SSNELATKYQTFQNELEGFIVTRQKLETQLQENKIVNDEFEKLKEETKVFKLTGNVLLPI 61
           S+ +L   Y T Q+ELE  ++ RQKLETQLQENKIV DEF+ L+EET+V+KLTGNVLLP+
Sbjct: 4   SAQDLTMNYNTSQHELEELVIARQKLETQLQENKIVQDEFDGLREETQVYKLTGNVLLPV 63

Query: 62  EQDEARSNIDKRLEFIQTEIDRCEKNIKAKQAEMEKIRSELM 103
           EQ EA+SN+ KRLEFI  EI+RCE+NIK KQ  +EK+R+EL+
Sbjct: 64  EQFEAKSNVSKRLEFITAEINRCEENIKTKQGLLEKLRAELL 105

>ACL146C Chr3 complement(93269..93592) [324 bp, 107 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR200W
           (YKE2)
          Length = 107

 Score =  136 bits (343), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 66/103 (64%), Positives = 82/103 (79%)

Query: 1   MSSNELATKYQTFQNELEGFIVTRQKLETQLQENKIVNDEFEKLKEETKVFKLTGNVLLP 60
           MS+ ++ATKY   Q ELE  +VTRQKLETQLQENKIVN+E + L+ ET+V+KLTG VLLP
Sbjct: 1   MSAEQVATKYTQLQGELEELVVTRQKLETQLQENKIVNEELQALQPETQVYKLTGGVLLP 60

Query: 61  IEQDEARSNIDKRLEFIQTEIDRCEKNIKAKQAEMEKIRSELM 103
           +EQ+EA  N+ KRLEFI+ EI RCE+NIK KQ EME  R+ L+
Sbjct: 61  VEQEEAEGNVSKRLEFIEGEIRRCEQNIKQKQEEMEGARAALV 103

>Kwal_56.24648 s56 complement(1088138..1088479) [342 bp, 113 aa]
           {ON} YLR200W (YKE2) - Polypeptide 6 of a Yeast
           Non-native Actin Binding Complex, homolog of a component
           of the bovine NABC complex [contig 161] FULL
          Length = 113

 Score =  134 bits (338), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 67/102 (65%), Positives = 81/102 (79%)

Query: 2   SSNELATKYQTFQNELEGFIVTRQKLETQLQENKIVNDEFEKLKEETKVFKLTGNVLLPI 61
           S+ EL   Y T Q ELE  +  RQ+LETQLQENKIV DEF+ LKEET+V+KLTG VLLP+
Sbjct: 4   SAQELTMNYTTAQQELEELVTARQRLETQLQENKIVQDEFDSLKEETQVYKLTGKVLLPV 63

Query: 62  EQDEARSNIDKRLEFIQTEIDRCEKNIKAKQAEMEKIRSELM 103
           EQ EA+SN+ KRLEFI TEI RCE NIK KQ+ +EK+R+EL+
Sbjct: 64  EQFEAKSNVSKRLEFINTEIKRCEDNIKNKQSLLEKLRAELL 105

>KLLA0D12298g Chr4 (1048089..1048436) [348 bp, 115 aa] {ON} similar
           to uniprot|P52553 Saccharomyces cerevisiae YLR200W YKE2
           Yeast nuclear gene
          Length = 115

 Score =  133 bits (335), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 67/103 (65%), Positives = 79/103 (76%)

Query: 1   MSSNELATKYQTFQNELEGFIVTRQKLETQLQENKIVNDEFEKLKEETKVFKLTGNVLLP 60
           MS+ E   KY   Q ELE  IV RQKLETQLQENKIV+DEF  LK++  V+KLTG VLLP
Sbjct: 1   MSAEETTQKYTKLQGELEELIVARQKLETQLQENKIVSDEFSSLKDDATVYKLTGGVLLP 60

Query: 61  IEQDEARSNIDKRLEFIQTEIDRCEKNIKAKQAEMEKIRSELM 103
           +EQ EA+ N++KRLEFI+ EI RCE NIK+KQ E+E  RSELM
Sbjct: 61  VEQFEAKGNVEKRLEFIEIEIKRCETNIKSKQQELEVARSELM 103

>SAKL0F11418g Chr6 complement(887825..888172) [348 bp, 115 aa] {ON}
           similar to uniprot|P52553 Saccharomyces cerevisiae
           YLR200W YKE2 Yeast nuclear gene
          Length = 115

 Score =  131 bits (329), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 59/103 (57%), Positives = 88/103 (85%)

Query: 1   MSSNELATKYQTFQNELEGFIVTRQKLETQLQENKIVNDEFEKLKEETKVFKLTGNVLLP 60
           +++ +L+ +Y T Q+ELE  ++ RQKLETQLQENKIV DEF+ L++E++V+KLTG VLLP
Sbjct: 4   LNAQKLSMQYTTMQSELEDLVIARQKLETQLQENKIVQDEFDTLRDESQVYKLTGGVLLP 63

Query: 61  IEQDEARSNIDKRLEFIQTEIDRCEKNIKAKQAEMEKIRSELM 103
           +EQ+EA+ N++KRL+FI+ EI RCE+NIK KQ ++E++R+EL+
Sbjct: 64  VEQEEAKGNVEKRLQFIKNEITRCEENIKEKQTQLERLRNELV 106

>NDAI0I02660 Chr9 complement(619959..621743) [1785 bp, 594 aa] {ON} 
          Length = 594

 Score = 31.6 bits (70), Expect = 0.39,   Method: Composition-based stats.
 Identities = 26/103 (25%), Positives = 47/103 (45%), Gaps = 23/103 (22%)

Query: 1   MSSNELATKYQTFQNELEGFIVTRQKLETQLQENKIVNDEFEKLKEETKVFKLTGNVLLP 60
           + SN  + +Y+ +  +L      +++ +  +QE +++ND+ E+            N+   
Sbjct: 6   IPSNSTSDQYEEYFEQL-----PKKEFKLPIQEEELINDDLER------------NISSA 48

Query: 61  IEQDEARS-NIDKRLEFIQTEIDRCEKNIKAKQAEMEKIRSEL 102
             QDE  S NID +     TE  R +K +KA+   M  I   L
Sbjct: 49  SSQDENDSYNIDGK-----TEGTRLKKALKARHVSMIAIGGSL 86

>YGR003W Chr7 (500132..502366) [2235 bp, 744 aa] {ON}
           CUL3Ubiquitin-protein ligase, forms a complex with Elc1p
           that polyubiquitylates monoubiquitylated RNA polymerase
           II to trigger its proteolysis; cullin family member with
           similarity to Cdc53p and human CUL3
          Length = 744

 Score = 29.6 bits (65), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 19/29 (65%)

Query: 75  EFIQTEIDRCEKNIKAKQAEMEKIRSELM 103
           E++ T +D C K  K K AE+ KI+ +L+
Sbjct: 386 EYLSTYVDHCMKRTKEKDAEIVKIKQDLL 414

>TDEL0G02450 Chr7 (467216..468241) [1026 bp, 341 aa] {ON} Anc_2.315
           YGL153W
          Length = 341

 Score = 29.6 bits (65), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 31/50 (62%)

Query: 50  VFKLTGNVLLPIEQDEARSNIDKRLEFIQTEIDRCEKNIKAKQAEMEKIR 99
           V++LT   ++P    EA+S +++  E IQ+  D+ +K + A + E EK+R
Sbjct: 109 VYELTRRYVVPNILPEAKSKLEQDKEEIQSYFDKVDKVLNAIEQEQEKVR 158

>Kpol_479.3 s479 (2938..5325) [2388 bp, 795 aa] {ON} (2938..5325)
           [2388 nt, 796 aa]
          Length = 795

 Score = 29.3 bits (64), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 24/91 (26%), Positives = 45/91 (49%), Gaps = 9/91 (9%)

Query: 16  ELEGFIVTRQKLETQLQE----NKIVNDEFEKLKEETKVFKLTGNVLLPIEQDEARSNID 71
           E  GFI+  ++ E  + +    NK +N+   K +     +KL     L  E ++A+ N +
Sbjct: 272 EHNGFILVSRRNEELIDQLHMMNKRLNNYLSKYENSNYQYKL-----LRAEHEKAKDNFE 326

Query: 72  KRLEFIQTEIDRCEKNIKAKQAEMEKIRSEL 102
           K+L   Q E+D+  ++    +   EKI+ +L
Sbjct: 327 KQLNLAQAEVDQSTEDANKHKERFEKIKKKL 357

>TPHA0O00360 Chr15 (57394..59634) [2241 bp, 746 aa] {ON} Anc_1.468
           YJR042W
          Length = 746

 Score = 29.3 bits (64), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 11/29 (37%), Positives = 23/29 (79%)

Query: 75  EFIQTEIDRCEKNIKAKQAEMEKIRSELM 103
           + I + I+RC++ +KA+ AE++K+ SE++
Sbjct: 683 DVILSVIERCDEMLKAEDAELQKVYSEII 711

>KNAG0M02650 Chr13 complement(490275..491999) [1725 bp, 574 aa]
          {ON} 
          Length = 574

 Score = 28.1 bits (61), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 25/47 (53%), Gaps = 5/47 (10%)

Query: 29 TQLQENKIVNDEFEKLKEETK-----VFKLTGNVLLPIEQDEARSNI 70
          T L+ NK V+ E+   K +T        +LTG +  P+E  + RSN+
Sbjct: 2  TDLEVNKTVDGEYGYKKYDTHEGILFCIELTGTLFEPVESLQGRSNL 48

>KAFR0B03800 Chr2 (788639..791026) [2388 bp, 795 aa] {ON} Anc_8.809
           YMR257C
          Length = 795

 Score = 27.7 bits (60), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 32/100 (32%), Positives = 52/100 (52%), Gaps = 9/100 (9%)

Query: 4   NELATKY-QTFQNELEGFIVTRQKLETQLQENKIVNDEFEKLKEE-TKVFKLTGNVLLPI 61
           N LAT   Q    +++GF+    + + QL ++  V D  E++ EE + + K  G +    
Sbjct: 699 NPLATYIEQDSIRQIKGFMKYLSRKKYQLDQHMQV-DILEQIDEEISHIKKRYGGI---- 753

Query: 62  EQDEARSNIDKRLEFIQTEI-DRCEKNIKAKQAEMEKIRS 100
            + E   N+ K  +F+Q  I DR  + IK  +AE EK+RS
Sbjct: 754 -KIEGLDNMKKLAQFLQPWIKDRLRERIKNAEAEREKLRS 792

>NDAI0H02720 Chr8 complement(671139..671843) [705 bp, 234 aa] {ON}
          Anc_2.427 YMR117C
          Length = 234

 Score = 27.3 bits (59), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 20/29 (68%)

Query: 24 RQKLETQLQENKIVNDEFEKLKEETKVFK 52
          R  LE+Q ++ +I+ND   K KEE+K FK
Sbjct: 60 RNNLESQGEKIQILNDNLNKTKEESKNFK 88

>Smik_11.352 Chr11 complement(595605..598334) [2730 bp, 909 aa] {ON}
           YKR089C (REAL)
          Length = 909

 Score = 27.7 bits (60), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 12/33 (36%), Positives = 22/33 (66%)

Query: 15  NELEGFIVTRQKLETQLQENKIVNDEFEKLKEE 47
           ++L G I  +QKLE+ L + K++ D   +++EE
Sbjct: 169 DDLTGKIAWKQKLESPLYDYKLIKDLTSRMREE 201

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.311    0.128    0.327 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 10,374,235
Number of extensions: 437324
Number of successful extensions: 2783
Number of sequences better than 10.0: 290
Number of HSP's gapped: 2771
Number of HSP's successfully gapped: 329
Length of query: 115
Length of database: 53,481,399
Length adjustment: 85
Effective length of query: 30
Effective length of database: 43,734,789
Effective search space: 1312043670
Effective search space used: 1312043670
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 59 (27.3 bits)