Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0E002403.564ON1010101049380.0
NDAI0B062603.564ON1013102222230.0
NCAS0F039503.564ON1012102621850.0
KAFR0J001903.564ON1012102820510.0
Suva_7.203.564ON1008102520360.0
Kpol_380.63.564ON1002101220190.0
TDEL0D063203.564ON1018102520190.0
Smik_7.203.564ON1004101920160.0
TPHA0G036303.564ON1022102919730.0
YGL241W (KAP114)3.564ON1004101719570.0
Skud_7.263.564ON1015101819510.0
KNAG0D029403.564ON1009103318800.0
ZYRO0E09460g3.564ON1009101518670.0
SAKL0F00880g3.564ON1009102218240.0
CAGL0H07777g3.564ON1021102417270.0
Kwal_47.192583.564ON1011102516500.0
Ecym_25943.564ON1019102215890.0
AFR269W3.564ON1017101815570.0
KLTH0G00792g3.564ON1021101815000.0
KLLA0A00803g3.564ON95210177076e-78
TBLA0C070905.11ON1147131940.021
TDEL0B064802.559ON126557840.31
NCAS0A144907.408ON111385810.70
NDAI0E021708.624ON1029142791.2
KLLA0A08316gna 1ON70081762.8
Kwal_47.192473.561ON959206753.8
TPHA0F031608.624ON1031137753.9
Ecym_54545.503ON96464727.0
KLLA0C14157g5.11ON1090140728.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0E00240
         (1010 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0E00240 Chr5 (36791..39823) [3033 bp, 1010 aa] {ON} Anc_3.56...  1906   0.0  
NDAI0B06260 Chr2 complement(1515207..1518248) [3042 bp, 1013 aa]...   860   0.0  
NCAS0F03950 Chr6 complement(791754..794792) [3039 bp, 1012 aa] {...   846   0.0  
KAFR0J00190 Chr10 (30537..33575) [3039 bp, 1012 aa] {ON} Anc_3.5...   794   0.0  
Suva_7.20 Chr7 (40012..43038) [3027 bp, 1008 aa] {ON} YGL241W (R...   788   0.0  
Kpol_380.6 s380 complement(8594..11602) [3009 bp, 1002 aa] {ON} ...   782   0.0  
TDEL0D06320 Chr4 complement(1134120..1137176) [3057 bp, 1018 aa]...   782   0.0  
Smik_7.20 Chr7 (40260..43274) [3015 bp, 1004 aa] {ON} YGL241W (R...   781   0.0  
TPHA0G03630 Chr7 complement(770678..773746) [3069 bp, 1022 aa] {...   764   0.0  
YGL241W Chr7 (45445..48459) [3015 bp, 1004 aa] {ON}  KAP114Karyo...   758   0.0  
Skud_7.26 Chr7 (49585..52632) [3048 bp, 1015 aa] {ON} YGL241W (R...   756   0.0  
KNAG0D02940 Chr4 complement(529102..532131) [3030 bp, 1009 aa] {...   728   0.0  
ZYRO0E09460g Chr5 complement(753030..756059) [3030 bp, 1009 aa] ...   723   0.0  
SAKL0F00880g Chr6 (76850..79879) [3030 bp, 1009 aa] {ON} similar...   707   0.0  
CAGL0H07777g Chr8 (757134..760199) [3066 bp, 1021 aa] {ON} simil...   669   0.0  
Kwal_47.19258 s47 complement(1156969..1160004) [3036 bp, 1011 aa...   640   0.0  
Ecym_2594 Chr2 complement(1155746..1158805) [3060 bp, 1019 aa] {...   616   0.0  
AFR269W Chr6 (916446..919499) [3054 bp, 1017 aa] {ON} Syntenic h...   604   0.0  
KLTH0G00792g Chr7 (53588..56653) [3066 bp, 1021 aa] {ON} similar...   582   0.0  
KLLA0A00803g Chr1 (76350..79208) [2859 bp, 952 aa] {ON} similar ...   276   6e-78
TBLA0C07090 Chr3 complement(1716766..1720209) [3444 bp, 1147 aa]...    41   0.021
TDEL0B06480 Chr2 (1144036..1147833) [3798 bp, 1265 aa] {ON} Anc_...    37   0.31 
NCAS0A14490 Chr1 complement(2852114..2855455) [3342 bp, 1113 aa]...    36   0.70 
NDAI0E02170 Chr5 complement(445219..448308) [3090 bp, 1029 aa] {...    35   1.2  
KLLA0A08316g Chr1 (733200..735302) [2103 bp, 700 aa] {ON} simila...    34   2.8  
Kwal_47.19247 s47 complement(1151230..1154109) [2880 bp, 959 aa]...    33   3.8  
TPHA0F03160 Chr6 complement(690476..693571) [3096 bp, 1031 aa] {...    33   3.9  
Ecym_5454 Chr5 complement(932244..935138) [2895 bp, 964 aa] {ON}...    32   7.0  
KLLA0C14157g Chr3 complement(1223130..1226402) [3273 bp, 1090 aa...    32   8.0  

>TBLA0E00240 Chr5 (36791..39823) [3033 bp, 1010 aa] {ON} Anc_3.564
            YGL241W
          Length = 1010

 Score = 1906 bits (4938), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 957/1010 (94%), Positives = 957/1010 (94%)

Query: 1    MNIDIDSLIKQAQSPETSLREHAENSLLEWCEHDXXXXXXXXXXXXXXXTEILSSRQYSL 60
            MNIDIDSLIKQAQSPETSLREHAENSLLEWCEHD               TEILSSRQYSL
Sbjct: 1    MNIDIDSLIKQAQSPETSLREHAENSLLEWCEHDACSAFAALANVAANNTEILSSRQYSL 60

Query: 61   LALRKLITMYWSPGFESYHLTSNLNETVKAHVRHTILQLALDKNQDSKIRKSGSYCIVQV 120
            LALRKLITMYWSPGFESYHLTSNLNETVKAHVRHTILQLALDKNQDSKIRKSGSYCIVQV
Sbjct: 61   LALRKLITMYWSPGFESYHLTSNLNETVKAHVRHTILQLALDKNQDSKIRKSGSYCIVQV 120

Query: 121  SAVDFPDLWPELLVTLYKSILETHSLEALSILNEIYDDIISEEMFFEEGIGLETMRVIFN 180
            SAVDFPDLWPELLVTLYKSILETHSLEALSILNEIYDDIISEEMFFEEGIGLETMRVIFN
Sbjct: 121  SAVDFPDLWPELLVTLYKSILETHSLEALSILNEIYDDIISEEMFFEEGIGLETMRVIFN 180

Query: 181  ILDDKTAPVETKIAAAKLFYPCLMQMSVVSPTSSLKRMNLVIDSLKEIISKWEQILQFPL 240
            ILDDKTAPVETKIAAAKLFYPCLMQMSVVSPTSSLKRMNLVIDSLKEIISKWEQILQFPL
Sbjct: 181  ILDDKTAPVETKIAAAKLFYPCLMQMSVVSPTSSLKRMNLVIDSLKEIISKWEQILQFPL 240

Query: 241  EDALLISPEEAILEWKFRGSIYEGLAFVHSNFSKKILPMNFLNVFRKCSLQDLTPASTLY 300
            EDALLISPEEAILEWKFRGSIYEGLAFVHSNFSKKILPMNFLNVFRKCSLQDLTPASTLY
Sbjct: 241  EDALLISPEEAILEWKFRGSIYEGLAFVHSNFSKKILPMNFLNVFRKCSLQDLTPASTLY 300

Query: 301  INMISGDNIAFNALNKYIIHIFEYLSNISRANYERXXXXXXXXXXYKLCCLDNLIVETWN 360
            INMISGDNIAFNALNKYIIHIFEYLSNISRANYER          YKLCCLDNLIVETWN
Sbjct: 301  INMISGDNIAFNALNKYIIHIFEYLSNISRANYEREELILILESIYKLCCLDNLIVETWN 360

Query: 361  SNFNEFVSKEFGLMASYSLRDQISDFLISLSSNNFNIIFKEFITNLNNCLIIEDWRQLES 420
            SNFNEFVSKEFGLMASYSLRDQISDFLISLSSNNFNIIFKEFITNLNNCLIIEDWRQLES
Sbjct: 361  SNFNEFVSKEFGLMASYSLRDQISDFLISLSSNNFNIIFKEFITNLNNCLIIEDWRQLES 420

Query: 421  MLYIFQSLLINDEDILNVANLNIENLLSSLAKNFHHYITNTILFSRLILLIPKILEKFMD 480
            MLYIFQSLLINDEDILNVANLNIENLLSSLAKNFHHYITNTILFSRLILLIPKILEKFMD
Sbjct: 421  MLYIFQSLLINDEDILNVANLNIENLLSSLAKNFHHYITNTILFSRLILLIPKILEKFMD 480

Query: 481  DIENIKLITCEFLKQSLAIGLDNYNALIKSSCLLMVNSYCSFAELLTVLGDKTCQEVXXX 540
            DIENIKLITCEFLKQSLAIGLDNYNALIKSSCLLMVNSYCSFAELLTVLGDKTCQEV   
Sbjct: 481  DIENIKLITCEFLKQSLAIGLDNYNALIKSSCLLMVNSYCSFAELLTVLGDKTCQEVQQI 540

Query: 541  XXXXXXXXXDDSEDDTYGMIMEVINNLIDCNLPNDKLGEIPQQEFNLILSITSRDPSNVQ 600
                     DDSEDDTYGMIMEVINNLIDCNLPNDKLGEIPQQEFNLILSITSRDPSNVQ
Sbjct: 541  TLKIILQILDDSEDDTYGMIMEVINNLIDCNLPNDKLGEIPQQEFNLILSITSRDPSNVQ 600

Query: 601  MTVESQECLKKLLEGLNTFEYSHYIEMCFPSMVKVLIGSSVTQYKYSALLSLALEFITIF 660
            MTVESQECLKKLLEGLNTFEYSHYIEMCFPSMVKVLIGSSVTQYKYSALLSLALEFITIF
Sbjct: 601  MTVESQECLKKLLEGLNTFEYSHYIEMCFPSMVKVLIGSSVTQYKYSALLSLALEFITIF 660

Query: 661  MKKKPNDGYLPLEICKFIFNPLKDVLLVSNEDETLQLSSDAFSYLIYNTDPIVMVESLPG 720
            MKKKPNDGYLPLEICKFIFNPLKDVLLVSNEDETLQLSSDAFSYLIYNTDPIVMVESLPG
Sbjct: 661  MKKKPNDGYLPLEICKFIFNPLKDVLLVSNEDETLQLSSDAFSYLIYNTDPIVMVESLPG 720

Query: 721  ILEVMDRLLSLDVTDSAAMNAGSLVVTVFTHFENEIKPYMKQILSGTTKRLIQAKNISTI 780
            ILEVMDRLLSLDVTDSAAMNAGSLVVTVFTHFENEIKPYMKQILSGTTKRLIQAKNISTI
Sbjct: 721  ILEVMDRLLSLDVTDSAAMNAGSLVVTVFTHFENEIKPYMKQILSGTTKRLIQAKNISTI 780

Query: 781  QNLISVICYLICSNTEDTINLLSRLGTEGDILKLVLNKWISNFEIIRGERRIKQNILALN 840
            QNLISVICYLICSNTEDTINLLSRLGTEGDILKLVLNKWISNFEIIRGERRIKQNILALN
Sbjct: 781  QNLISVICYLICSNTEDTINLLSRLGTEGDILKLVLNKWISNFEIIRGERRIKQNILALN 840

Query: 841  KLYCLNNSNIKHIMVDDELIPYDGDRIITRSMAKEMPDRYTQIPVYSKIIKLFIQELSEQ 900
            KLYCLNNSNIKHIMVDDELIPYDGDRIITRSMAKEMPDRYTQIPVYSKIIKLFIQELSEQ
Sbjct: 841  KLYCLNNSNIKHIMVDDELIPYDGDRIITRSMAKEMPDRYTQIPVYSKIIKLFIQELSEQ 900

Query: 901  MKQPEHNLKIEETVETIGDGNXXXXXXXXXXXXXXXXYEKLQEYVDDEDDELHFGEDEDD 960
            MKQPEHNLKIEETVETIGDGN                YEKLQEYVDDEDDELHFGEDEDD
Sbjct: 901  MKQPEHNLKIEETVETIGDGNAAAADDDWEDVEDVLDYEKLQEYVDDEDDELHFGEDEDD 960

Query: 961  ILGTMDIEIDVKELLIRILKENASKNVSDFDKIYTTLSEDEKRILSECLV 1010
            ILGTMDIEIDVKELLIRILKENASKNVSDFDKIYTTLSEDEKRILSECLV
Sbjct: 961  ILGTMDIEIDVKELLIRILKENASKNVSDFDKIYTTLSEDEKRILSECLV 1010

>NDAI0B06260 Chr2 complement(1515207..1518248) [3042 bp, 1013 aa] {ON}
            Anc_3.564 YGL241W
          Length = 1013

 Score =  860 bits (2223), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 469/1022 (45%), Positives = 666/1022 (65%), Gaps = 23/1022 (2%)

Query: 3    IDIDSLIKQAQSPETSLREHAENSLLEWCEHDXXXXXXXXXXXXXXXTEILSSRQYSLLA 62
            +DI+ LI QAQS + ++R+ AE+ LL+ C+ +                  ++SRQ++LL+
Sbjct: 1    MDINQLIVQAQSSDNAVRDAAESQLLQACDTNAAQIFTSLMKGACDGNTDIASRQFALLS 60

Query: 63   LRKLITMYWSPGFESYHLTSNLNETVKAHVRHTILQLALDKNQDSKIRKSGSYCIVQVSA 122
            LRKLITMYWSPGFESY  TS +N+  K ++R ++L + LD  QDSKI KS +YC+VQ+SA
Sbjct: 61   LRKLITMYWSPGFESYRNTSTINDQTKEYIRESLLNICLDDLQDSKITKSAAYCVVQISA 120

Query: 123  VDFPDLWPELLVTLYKSILETHSLEALSILNEIYDDIISEEMFFEEGIGLETMRVIFNIL 182
            VDFPD WP+LLV LY +I ++HSL A+S+LNEIYDD++SEEMFFE  IG+ET+++IF +L
Sbjct: 121  VDFPDQWPQLLVILYDTISQSHSLNAMSLLNEIYDDVVSEEMFFEGQIGMETLQIIFQVL 180

Query: 183  DDKTAPVETKIAAAKLFYPCLMQMSVVSPTSSLKRMNLVIDSLKEIISKWEQILQFPLED 242
             +    +E KIAA KLF  C++QMSV+ P+SSLKR  L  + + + I    Q+L++   D
Sbjct: 181  SNNEGKIEAKIAATKLFNACILQMSVLDPSSSLKRKKLAEECIPKSIQVLGQLLEYYTID 240

Query: 243  ALLISPE-EAILEWKFRGSIYEGLAFVHSNFSKKILPMNFLNVFRKCSLQDLTPASTLY- 300
              + S    +ILE   R  IYE +  + +   K++   N +  F+  +L+DL+ + TLY 
Sbjct: 241  TTVDSKMLTSILE--LRSKIYENVVLIKNELPKRLFQRNLMASFKFQTLKDLSSSCTLYE 298

Query: 301  ------INMISGDNIAFNALNKYIIHIFEYLSNISRANYERXXXXXXXXXXYKLCCLDNL 354
                  I +++ DN+  +AL++  IH+ ++L+      ++             LCCLDN 
Sbjct: 299  TYCLNNIEVVNSDNL-HDALSECSIHMLDFLTATCSLKFDNSEVSTIVQDLTVLCCLDND 357

Query: 355  IVETWNSNFNEFVSKEFGLMASYSLRDQISDFLISLSSNNFNIIFKE----FITNLNNCL 410
              E   ++FN FVSKE GL+ SY++RDQ S+FL SLS  N+  I +     FI+ +N   
Sbjct: 358  SQEELAADFNAFVSKETGLLPSYTIRDQASEFLNSLSDPNYATILQAIINTFISTMNQP- 416

Query: 411  IIEDWRQLESMLYIFQSLLINDEDILNVANLNIENLLSSLAKNFHHYITNTILFSRLILL 470
               + R LES+LY+ QSL+ N++D+ N+ N NI  LL  L+  F +   N  L SRLILL
Sbjct: 417  -SRNDRILESILYLLQSLMTNEDDVTNI-NPNI--LLEPLSSLFDYETENPFLHSRLILL 472

Query: 471  IPKILEKFMDDIENIKLITCEFLKQSLAIGLDNYNALIKSSCLLMVNSYCSFAELLTVLG 530
            IPKILEKFMD+I N+K++T +FL +SL   L   + L K S L+    Y  FAEL +VLG
Sbjct: 473  IPKILEKFMDEIPNVKVVTKDFLTKSLKYSLQMNDGLNKISALIGYTYYAYFAELPSVLG 532

Query: 531  DKTCQEVXXXXXXXXXXXXDDSEDDTYGMIMEVINNLIDCNLPNDKLGEIPQQEFNLILS 590
               C +V             +SE+DT+G+++EV+N++IDCN  +  +  I + EF ++LS
Sbjct: 533  RDVCTQVQENILLLITQVVHESEEDTHGLLVEVLNHVIDCNPEDIAVQGILETEFYMVLS 592

Query: 591  ITSRDPSNVQMTVESQECLKKLLEGLNTFEYSHYIEMCFPSMVKVLIGSSVTQYKYSALL 650
            I+S+DP+N+Q+ + S+ECL+KLLEG+NT  Y+HYI+MC PS + V+ G SVT+YKYS LL
Sbjct: 593  ISSKDPANIQVAIGSEECLEKLLEGVNTRTYTHYIDMCLPSFINVIKGHSVTEYKYSPLL 652

Query: 651  SLALEFITIFMKKKPNDGYLPLEICKFIFNPLKDVLLVSNEDETLQLSSDAFSYLIYNTD 710
            SL LEF+T+FMKKKP DG LP  I + IF PL +VL  S EDETLQL++DAFSYL+YNTD
Sbjct: 653  SLILEFVTVFMKKKPTDGPLPAIIFEHIFQPLLNVLNHSTEDETLQLATDAFSYLLYNTD 712

Query: 711  PIVMVESLPGILEVMDRLLSLDVTDSAAMNAGSLVVTVFTHFENEIKPYMKQILSGTTKR 770
              +M+  L  I+ V+DRLLS++V+D+AAMN G+L+VT+F+ F NE++  +  IL     +
Sbjct: 713  STLMIPHLEEIVAVLDRLLSINVSDTAAMNVGTLIVTIFSKFSNELQSLIPTILRAAVTK 772

Query: 771  LIQAKNISTIQNLISVICYLICSNTEDTINLLSRLGTEGDILKLVLNKWISNFEIIRGER 830
            L+QAKNIST QNLIS++C+L C++   TI  L  L         V+NKW   FE+IRGE+
Sbjct: 773  LVQAKNISTQQNLISLLCFLTCTDPLQTIEFLYGLDETHSTFAAVMNKWFEAFEVIRGEK 832

Query: 831  RIKQNILALNKLYCLNNSNIKHIMVDDELIPYDGDRIITRSMAKEMPDRYTQIPVYSKII 890
            +IK+NILAL+KLY   +  +  ++V+ +LIPY+GD IITRSMAK MPD+YTQIP Y+KII
Sbjct: 833  KIKENILALSKLYFTCDPRLGSLLVNGDLIPYEGDLIITRSMAKTMPDKYTQIPAYTKII 892

Query: 891  KLFIQELSEQMKQPEHNLKIEETVETIGDGNXXXXXXXXXXXXXXXX-YEKLQEYVDDED 949
            KLF+ ELS Q +Q      +   ++ I                     Y+KL+EYVDDED
Sbjct: 893  KLFVSELSFQTQQTGEPTVLNADLKGIEKEEEEVGDDDEWEDVDDVLDYDKLKEYVDDED 952

Query: 950  DELHFGEDE-DDILGTMDIEIDVKELLIRILKENASKNVSDFDKIYTTLSEDEKRILSEC 1008
                FGED+ D+I G  D++  V ELL+   KE  SK+ ++F  IY TLS++ K+ILSE 
Sbjct: 953  PA-EFGEDDKDEITGLADVKETVTELLLEFFKEVTSKDTNNFHAIYNTLSDNGKKILSEN 1011

Query: 1009 LV 1010
            L+
Sbjct: 1012 LL 1013

>NCAS0F03950 Chr6 complement(791754..794792) [3039 bp, 1012 aa] {ON}
            Anc_3.564 YGL241W
          Length = 1012

 Score =  846 bits (2185), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 455/1026 (44%), Positives = 665/1026 (64%), Gaps = 32/1026 (3%)

Query: 3    IDIDSLIKQAQSPETSLREHAENSLLEWCEHDXXXXXXXXXXXXXXXTEILSSRQYSLLA 62
            +DI  LI QAQS +T  RE AEN L   C+ +                  LS+RQ+SLL 
Sbjct: 1    MDIYQLITQAQSSDTQTREAAENQLSSSCDQNASQIFTSLMSVALDPKSPLSTRQFSLLT 60

Query: 63   LRKLITMYWSPGFESYHLTSNLNETVKAHVRHTILQLALDKNQDSKIRKSGSYCIVQVSA 122
            +RK ITMYWSPGF+SY  TS + E  K ++R+++LQL LD  QD+KI+ S SYCIVQ+SA
Sbjct: 61   IRKFITMYWSPGFQSYRNTSTIQENTKEYIRNSLLQLCLDDAQDTKIKNSASYCIVQISA 120

Query: 123  VDFPDLWPELLVTLYKSILETHSLEALSILNEIYDDIISEEMFFEEGIGLETMRVIFNIL 182
            VDFPD WP+LL T+Y +I + HSL ALS+LNEIYDD+ISEEMFFE  IG+ET+++IF +L
Sbjct: 121  VDFPDQWPQLLSTIYMAIEQNHSLNALSLLNEIYDDVISEEMFFEGQIGMETLQIIFQLL 180

Query: 183  DDKTAPVETKIAAAKLFYPCLMQMSVVSPTSSLKRMNLVIDSLKEIISKWEQILQ-FPLE 241
             +  A ++ KIA  KLF  CL+QMSVV  +S   R   V + + + +    Q+L+ +P+ 
Sbjct: 181  TNNNANLKAKIAGTKLFNACLLQMSVVDSSSKHNRKEFVKECIFKALEVLGQLLELYPVS 240

Query: 242  DALLISPEEAILEWKFRGSIYEGLAFVHSNFSKKILPMNFLNVFRKCSLQDLTPASTLYI 301
            +  LI           R  IYE +  + + FS+K+    F  +++  S +DL   S  + 
Sbjct: 241  NDSLI--------LNLRTKIYENVVLISNEFSRKLFTQAFKGLYKLQSFRDLEACSNQFN 292

Query: 302  ----NMISGDNIAFNALNKYIIHIFEYLSNISRANYERXXXXXXXXXXYKLCCLDNLIVE 357
                N+   DN    ++N+ +IH+ ++L++IS +++              LCCLD+  +E
Sbjct: 293  AFLENLSQADNDILESMNECVIHVLDFLTSISDSDFTMQEINLIVQSLTFLCCLDSDTLE 352

Query: 358  TWNSNFNEFVSKEFGLMASYSLRDQISDFLISLS----SNNFNIIFKEFITNLNNCLIIE 413
             W+ +FN+FVSKE GL+AS+++RDQ ++F+  LS    SN FN I+ + I +L    + +
Sbjct: 353  QWSEDFNDFVSKETGLLASFTIRDQAAEFMSGLSNPNYSNFFNSIYAQVIYSLTGD-VND 411

Query: 414  DWRQLESMLYIFQSLLINDEDILNVANLNIEN--LLSSLAKNFHHYITNTILFSRLILLI 471
            + R  ES+LY+ Q+LL N+ED  N  ++NIE   +L   +  F + +  T L SR+ILL 
Sbjct: 412  NLR--ESLLYLLQTLLTNEED--NDHDINIEPSVILKQFSSVFENGLQKTFLLSRIILLT 467

Query: 472  PKILEKFMDDIENIKLITCEFLKQSLAIGLDNYNALIKSSCLLMVNSYCSFAELLTVLGD 531
            PK+LEKFMD ++++K +T  +L+++L + L+ +N +IKSS ++    Y  FAEL +VLG 
Sbjct: 468  PKLLEKFMDQLQDVKQLTGNYLRRTLDLALETHNEIIKSSSIIAFTYYSYFAELPSVLGP 527

Query: 532  KTCQEVXXXXXXXXXXXXDDSEDDTYGMIMEVINNLIDCNLPNDKLGEIPQQEFNLILSI 591
            + C  V             ++E+DT G++ME +N +I CN+  +   EI Q EFNL+LSI
Sbjct: 528  ELCSIVQENTLKIISELSKEAEEDTNGLLMETLNQIISCNVHENLSPEILQTEFNLVLSI 587

Query: 592  TSRDPSNVQMTVESQECLKKLLEGLNTFEYSHYIEMCFPSMVKVLIGSSVTQYKYSALLS 651
            +S+DP+NVQ+TVE+Q+CL+ LLEG+NT  Y HY+++C PS +  +  S++ QY+Y+ +LS
Sbjct: 588  SSKDPANVQVTVEAQDCLEHLLEGMNTETYLHYVDICLPSFIHTIDASAINQYRYTPVLS 647

Query: 652  LALEFITIFMKKKPNDGYLPLEICKFIFNPLKDVLLVSNEDETLQLSSDAFSYLIYNTDP 711
            L LEF+TIFMKKKP DG+LP  I  F F  L ++L +S EDETLQL++DAFSY++YNT+P
Sbjct: 648  LILEFLTIFMKKKPVDGFLPTSISDFSFKSLCNLLSLSTEDETLQLATDAFSYMVYNTEP 707

Query: 712  IVMVESLPGILEVMDRLLSLDVTDSAAMNAGSLVVTVFTHFENEIKPYMKQILSGTTKRL 771
              MV  L  I+ V+DRLLS++V+D+AAMN G+LVVT+F+ F NEI+P +  IL     RL
Sbjct: 708  SAMVPKLQDIINVLDRLLSINVSDTAAMNVGTLVVTLFSKFSNEIQPLIPTILRAAVGRL 767

Query: 772  IQAKNISTIQNLISVICYLICSNTEDTINLLSRLGTEGDILKLVLNKWISNFEIIRGERR 831
            IQA+NIST QNL+S++C+L CS+ +  I+LL    ++      V+NKW  +FE IRGE++
Sbjct: 768  IQAQNISTQQNLVSLLCFLTCSDPKQVIDLLYNFDSDHSTFTKVMNKWFESFETIRGEKK 827

Query: 832  IKQNILALNKLYCLNNSNIKHIMVDDELIPYDGDRIITRSMAKEMPDRYTQIPVYSKIIK 891
            IK+NI+AL+KLY   +  +  ++V+ +LIPYDGD IITRSMAK+MPD+YTQIP ++KI+K
Sbjct: 828  IKENIVALSKLYFTGDERLGKLIVNGDLIPYDGDLIITRSMAKKMPDKYTQIPAFTKIVK 887

Query: 892  LFIQELSEQMKQPEHNLKIEETVETIGDGNXXXXXXXXXXXXXXXX------YEKLQEYV 945
            LF  EL  Q KQP+  + +E  ++ +   N                      YEKL+E+V
Sbjct: 888  LFTTELGFQNKQPDSKILLESDIKNVDTSNNKTSEEAAGDDDEWEDVDDVLDYEKLREFV 947

Query: 946  DDEDDELHFGE-DEDDILGTMDIEIDVKELLIRILKENASKNVSDFDKIYTTLSEDEKRI 1004
            DDE D   FGE D D+I G   ++  + ELL+   K+ A+++++ F  IY TLSE+EKRI
Sbjct: 948  DDE-DPADFGENDSDEITGLDTLKETIPELLVEFFKDVAARDLNGFHNIYNTLSENEKRI 1006

Query: 1005 LSECLV 1010
            L+E LV
Sbjct: 1007 LTENLV 1012

>KAFR0J00190 Chr10 (30537..33575) [3039 bp, 1012 aa] {ON} Anc_3.564
            YGL241W
          Length = 1012

 Score =  794 bits (2051), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 456/1028 (44%), Positives = 637/1028 (61%), Gaps = 34/1028 (3%)

Query: 1    MNIDIDSLIKQAQSPETSLREHAENSLLEWCEHDXXXXXXXXXXXXXXXTEILSSRQYSL 60
            M+ DI  LI QAQSP+ SLREHAE  LL+ C+ +               +  L++RQ++L
Sbjct: 1    MSSDISQLISQAQSPDNSLREHAEQQLLQSCDSNASLIFQALTDVAINNSNKLAARQFAL 60

Query: 61   LALRKLITMYWSPGFESYHLTSNLNETVKAHVRHTILQLALDKNQDSKIRKSGSYCIVQV 120
            L+LRKLIT YWSPGFESY  TS ++   K+ +R+ ++QLALD NQDSKI+ S SYC+ Q+
Sbjct: 61   LSLRKLITFYWSPGFESYRNTSQIDLDTKSSLRNYLIQLALDDNQDSKIKSSASYCVTQI 120

Query: 121  SAVDFPDLWPELLVTLYKSILETHSLEALSILNEIYDDIISEEMFFEEGIGLETMRVIFN 180
            SAVDFPD WPELL  LY  I + +SL A+ +LNEIYDDI+SEEMFFE  IGLET+ +++ 
Sbjct: 121  SAVDFPDQWPELLSILYGCITQHYSLSAIKLLNEIYDDIVSEEMFFEGNIGLETLSIVYQ 180

Query: 181  ILDDK-TAPVETKIAAAKLFYPCLMQMSVVSPTSSLKRMNLVIDSLKEIISKWEQILQFP 239
            +L+      ++ +IA   L    + QM+ V    + KR  L+ +S+   +     IL+  
Sbjct: 181  LLESGDNVSIQARIALVDLLNATITQMTNVDSNLTEKRKQLLSESIPRALGLLSNILEMS 240

Query: 240  LEDALLISPEEAILEWKFRGSIYEGLAFVHSNFSKKILPMNFLNVFRKCSLQDLTPASTL 299
              D   IS +       F G IYE L  + +   KK       + +++ +L  L+     
Sbjct: 241  HRD---ISTD----SLTFIGKIYEILVLIKNELPKKFFSAQTRDAYKRITLNTLSLLQNK 293

Query: 300  YINMISGDNIAFNALNKYIIHIFEYLSNIS-RANYERXXXXXXXXXXYKLCCLDNLIVET 358
            Y +M         + ++  IH  E+L+++S   N+              LC LD +  ET
Sbjct: 294  YASMTEPAETELESFSECAIHTLEFLTSLSYNTNFTEEERTIILNSLLVLCSLDPVTKET 353

Query: 359  WNSNFNEFVSKEFGLMASYSLRDQISDFLISLSSNNFNI----IFKEFITNLNNCLIIED 414
            W ++FN FVSKE GL+ SY++RDQ  +FL SL   NF +    IF+ F T +++     D
Sbjct: 354  WLADFNHFVSKETGLLPSYTIRDQSFEFLTSLIDQNFQLILKSIFQYFFTLISSSSPSVD 413

Query: 415  WRQLESMLYIFQSLLINDEDILNVANLNIENLLS---SLAKNFHHYITNTILFSRLILLI 471
              QLE+  Y+ QS+L ND+DI NV N  I ++L    SL  N H    ++++ SR+IL +
Sbjct: 414  PSQLETTFYLLQSILSNDDDIENVNNEEITSVLRVLPSLLTNVH----DSLMVSRIILAL 469

Query: 472  PKILEKFMDDIENIKLITCEFLKQSLAIGLD-NYNALIKSSCLLMVNSYCSFAELLTVLG 530
            PKILEKFMDD+ ++K +   FL QS  + L  + + +IKSS L+   SYC FAEL +VLG
Sbjct: 470  PKILEKFMDDLPDVKAMVQTFLVQSTELALRLSGDYIIKSSVLISFTSYCYFAELPSVLG 529

Query: 531  DKTCQEVXXXXXXXXXXXXDDSEDDTYGMIMEVINNLIDCNLPNDKLGEIPQQEFNLILS 590
             + C  +            ++SEDDT G++ EV+NN+I+CN  N    EI Q EF+L+ S
Sbjct: 530  PELCASIQKSILTLMKQVSNESEDDTNGLLTEVLNNIIECNSTNTS-QEILQTEFSLLFS 588

Query: 591  ITSRDPSNVQMTVESQECLKKLLEGLNTFEYSHYIEMCFPSMVKVLIGSSVTQYKYSALL 650
            I+S+DPSNVQ+ VESQE L+KLL  +    Y  YI++  P  + ++  +S T Y+YS LL
Sbjct: 589  ISSKDPSNVQIVVESQESLEKLLTNVTEKVYLEYIQIYLPPFINIIHANSTTSYRYSPLL 648

Query: 651  SLALEFITIFMKKKPNDG-YLPLEICKFIFNPLKDVLLVSNEDETLQLSSDAFSYLIYNT 709
            SL LEFITIFMKKKP+D   LP  I   +F PL D+L  S EDETLQL++DAF+Y+IYNT
Sbjct: 649  SLVLEFITIFMKKKPSDSKILPESIIANLFQPLVDILTTSTEDETLQLTTDAFTYIIYNT 708

Query: 710  DPIVMVESLPGILEVMDRLLSLDVTDSAAMNAGSLVVTVFTHFENEIKPYMKQILSGTTK 769
            D   ++  L  ++ ++DRLLSLDVTD+AAMN G+L+VT+FT F  +I   +  IL+    
Sbjct: 709  DSEKVMPYLETVVNILDRLLSLDVTDTAAMNVGTLIVTIFTKFSAQISSLIPTILNAAVN 768

Query: 770  RLIQAKNISTIQNLISVICYLICSNTEDTINLLSRLGTEGDILKLVLNKWISNFEIIRGE 829
            RLI  KNIST QNL+S++C+L  SNT++T++ L  L  + +I++ VL KW  +FEIIRGE
Sbjct: 769  RLIDCKNISTQQNLVSLLCFLFYSNTQETVDFLFNLP-QQNIVRDVLIKWFESFEIIRGE 827

Query: 830  RRIKQNILALNKLYCLNNSNIKHIMVDDELIPYDGDRIITRSMAKEMPDRYTQIPVYSKI 889
            ++IK+NI+AL KLYCL++  +  I V+ ++IPY+GD IITRS AK +PD+YTQI ++ KI
Sbjct: 828  KKIKENIIALGKLYCLHDEKLFSIKVNGDIIPYEGDLIITRSRAKSLPDKYTQITIFEKI 887

Query: 890  IKLFIQELSEQMKQPE-HNLKIEETVETIGDGNXXXXXXXXXXXXXXXXYEKLQEYVDDE 948
            IKLFI EL  Q KQP   NL   ET   +GD N                Y+KL+EYV+DE
Sbjct: 888  IKLFIAELGFQNKQPAIENLMTNETT-ALGDSN--ENDDEWEDVDDVLDYDKLKEYVNDE 944

Query: 949  D-----DELHFGE-DEDDILGTMDIEIDVKELLIRILKENASKNVSDFDKIYTTLSEDEK 1002
            D     D   +GE DE++I G  D+   V EL+I   K+  SKNV++F  IY TLSE+EK
Sbjct: 945  DELDGEDSREYGEGDEEEITGLGDVSQTVTELIIGFFKDVTSKNVNNFQSIYDTLSENEK 1004

Query: 1003 RILSECLV 1010
             IL++ LV
Sbjct: 1005 MILTQYLV 1012

>Suva_7.20 Chr7 (40012..43038) [3027 bp, 1008 aa] {ON} YGL241W (REAL)
          Length = 1008

 Score =  788 bits (2036), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 448/1025 (43%), Positives = 639/1025 (62%), Gaps = 34/1025 (3%)

Query: 3    IDIDSLIKQAQSPETSLREHAENSLLEWCEHDXXXXXXXXXXXXXXXTEILSSRQYSLLA 62
            +DI  LI  AQS +   RE AE  LL+WC+ D                  L SRQ++LL+
Sbjct: 1    MDISHLITGAQSADNHTREAAEAQLLQWCDSDASQVFTSLASVALHHQTSLQSRQFALLS 60

Query: 63   LRKLITMYWSPGFESYHLTSNLNETVKAHVRHTILQLALDKNQDSKIRKSGSYCIVQVSA 122
            LRKLITMYWSPGFESY  TSN++  VK  +R  +L L L+ N+++KI+   SYCIVQ+SA
Sbjct: 61   LRKLITMYWSPGFESYRSTSNVDLNVKESIREALLNLCLNANENTKIKNGASYCIVQISA 120

Query: 123  VDFPDLWPELLVTLYKSILETHSLEALSILNEIYDDIISEEMFFEEGIGLETMRVIFNIL 182
            VDFPD WP+LL  +Y +I + HS+ A+S+LNEIYDD++SEEMFFE GIGLET+ +IF +L
Sbjct: 121  VDFPDQWPQLLTVIYDAISQHHSINAMSLLNEIYDDVVSEEMFFEGGIGLETVEIIFKVL 180

Query: 183  DDKTAPVETKIAAAKLFYPCLMQMSVVSPTSSLKRMNLVIDSLKEIISKWEQILQFPLED 242
              + + +  KIAA KLF  CL QMS     +   R N +   L   +    Q+L   L +
Sbjct: 181  TTEASNLVAKIAALKLFKACLSQMSSHDKHNDESRNNFINQCLSTSLQTLGQLLTLDLVN 240

Query: 243  ALLISPEEAILEWKFRGSIYEGLAFVHSNFSKKILPMNFLNVFRKCSLQDLTPASTLYIN 302
                  E+   + KFR  IYE L F+ +NFSKK  P  F   F+  +++DL   +++ +N
Sbjct: 241  ------EDVTCQSKFRSIIYENLVFIKNNFSKKHFPKEFQVQFKLVAIKDLKNIASMNVN 294

Query: 303  MISGDN-IAFNALNKYIIHIFEYLSNISRANYERXXXXXXXXXXYKLCCLDNLIVETWNS 361
                +N  +   +    ++I E+L+ +    +              LC +D+   + W  
Sbjct: 295  DGPTENEDSLETVQTCSVYIVEFLTTVCSIPFTIEEMKMIIQSLTALCRVDSDTTQLWIG 354

Query: 362  NFNEFVSKEFGLMASYSLRDQISDFLISLSSNN----FNIIFKEFITNLNNCLIIEDWRQ 417
            +FN FVSKE GL ASY++RDQ+S+F  SLS  N    F+I+ ++ + N +N       + 
Sbjct: 355  DFNYFVSKETGLAASYNVRDQVSEFFTSLSDPNLSLMFDIVSQDIVQNTSN------HQT 408

Query: 418  LESMLYIFQSLLIND-----EDILNVANLNIENLLSSLAKNFHHYITNTILFSRLILLIP 472
            LES+LY+ Q +L+ND     ++I+  +   IENL S L  +      N +  +RLIL+IP
Sbjct: 409  LESLLYLLQCILLNDDEITGQNIIQSSQSLIENLRSELVSSE----LNEVTLARLILIIP 464

Query: 473  KILEKFMDDIENIKLITCEFLKQSLAIGLDNYNALIKSSCLLMVNSYCSFAELLTVLGDK 532
            K+L+KF+D + +IK +T  FLK SL + L  +  L++S+ L+    YC FAEL +VLG +
Sbjct: 465  KVLDKFIDVLPDIKSLTSSFLKASLDLALKYHQELVESAVLIAFTYYCYFAELDSVLGPE 524

Query: 533  TCQEVXXXXXXXXXXXXDDSEDDTYGMIMEVINNLIDCNLPNDKLGE-IPQQEFNLILSI 591
             C EV            DD+E+DT G IMEV+N +I CN       E + Q EF+L+ SI
Sbjct: 525  ACTEVQQNIIQIINEISDDAEEDTNGTIMEVLNEVISCNTKGPHHSEEVLQAEFHLVFSI 584

Query: 592  TSRDPSNVQMTVESQECLKKLLEGLNTFEYSHYIEMCFPSMVKVLIGSSVTQYKYSALLS 651
            +S+DP+NVQ+ V+SQECL+KLL+ +    Y  YIE+C PS + VL  +    YKY+ LLS
Sbjct: 585  SSKDPANVQVVVQSQECLEKLLDNITMGNYMSYIELCLPSFINVLEANRPNNYKYTPLLS 644

Query: 652  LALEFITIFMKKKPNDGYLPLEICKFIFNPLKDVLLVSNEDETLQLSSDAFSYLIYNTDP 711
            L LEFIT+F+KKKP+  +LP EI + +F PL  VL  S EDETLQL+++AFSYLI+NTD 
Sbjct: 645  LVLEFITVFLKKKPSSEFLPSEIDQHLFEPLAKVLAYSTEDETLQLATEAFSYLIFNTDT 704

Query: 712  IVMVESLPGILEVMDRLLSLDVTDSAAMNAGSLVVTVFTHFENEIKPYMKQILSGTTKRL 771
             VM   L  I++V++RLLSL+V+DSAAMN GSLVVT+FT F  EI+P +++IL     RL
Sbjct: 705  QVMEPRLMDIMKVLERLLSLEVSDSAAMNVGSLVVTIFTRFSGEIQPLVERILQAVVIRL 764

Query: 772  IQAKNISTIQNLISVICYLICSNTEDTINLLSRLGTEG-DILKLVLNKWISNFEIIRGER 830
            ++A+NIST QNL SV+C+L C++ + T++ L     +  D L LV+ KW+ +FE++RGER
Sbjct: 765  VKAQNISTQQNLFSVLCFLTCNDPKQTVDFLCSFQIDNMDALSLVMPKWMESFEVVRGER 824

Query: 831  RIKQNILALNKLYCLNNSNIKHIMVDDELIPYDGDRIITRSMAKEMPDRYTQIPVYSKII 890
            RIK+NI+AL KL+ L+++ +  +MV+ +LIPYDGD IITRSMAK+MPD+Y Q+P+Y+KII
Sbjct: 825  RIKENIIALIKLFLLDDARLHKLMVNGDLIPYDGDLIITRSMAKKMPDKYVQVPLYTKII 884

Query: 891  KLFIQELSEQMKQPEHNLKIEETVE-----TIGDGNXXXXXXXXXXXXXXXXYEKLQEYV 945
            KLF+ EL  Q KQP     I   +         D +                YEKL++Y+
Sbjct: 885  KLFVSELGFQNKQPNPEQLITTDIAKDAANNDNDDDNDADNDDWEDVDDVLDYEKLKDYI 944

Query: 946  DDEDDELHFGEDEDDILGTMDIEIDVKELLIRILKENASKNVSDFDKIYTTLSEDEKRIL 1005
             D+ D     + E DI G MD++  V ++L+   KE ASK+VS F +IY +LSE+E+++L
Sbjct: 945  GDDVDGGEEDDSE-DITGLMDVKESVVQILVGFFKEVASKDVSGFHRIYESLSENERKVL 1003

Query: 1006 SECLV 1010
            SE L+
Sbjct: 1004 SEALL 1008

>Kpol_380.6 s380 complement(8594..11602) [3009 bp, 1002 aa] {ON}
            complement(8594..11602) [3009 nt, 1003 aa]
          Length = 1002

 Score =  782 bits (2019), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 438/1012 (43%), Positives = 638/1012 (63%), Gaps = 31/1012 (3%)

Query: 4    DIDSLIKQAQSPETSLREHAENSLLEWCEHDXXXXXXXXXXXXXXXTEILSSRQYSLLAL 63
            DI  LI  AQSP+ S+RE AE+ LL  C+ D                E LSSR ++LL L
Sbjct: 3    DIHQLINLAQSPDNSVREKAESELLAACDEDACIVFHSMIQVGSNGFEELSSRLFALLTL 62

Query: 64   RKLITMYWSPGFESYHLTSNLNETVKAHVRHTILQLALDKNQDSKIRKSGSYCIVQVSAV 123
            RKLITMYWSPGFESY L S LNE +K + R ++L++ LD +QD+KI+ + +YC+VQ+SAV
Sbjct: 63   RKLITMYWSPGFESYRLNSTLNEEIKNNFRDSLLKICLDDSQDTKIKNASAYCVVQISAV 122

Query: 124  DFPDLWPELLVTLYKSILETHSLEALSILNEIYDDIISEEMFFEEGIGLETMRVIFNILD 183
            DFPD WP LL  +Y +I+E HSL A+S+LNEIYDD++SEEMFFEEGIG ET+R+IF++L 
Sbjct: 123  DFPDQWPTLLNEVYGAIMERHSLSAISLLNEIYDDVMSEEMFFEEGIGSETIRIIFSVLT 182

Query: 184  DKTAPVETKIAAAKLFYPCLMQMSVVSPTSSLKRMNLVIDSLKEIISKWEQILQFPLEDA 243
            D    +  KIA++KLF+ CL+QMSV+ P S  KR  LV + + +I++ W  +LQ      
Sbjct: 183  DNNTGIAAKIASSKLFHSCLLQMSVLDPQSVHKRKQLVTECISQILTIWSGLLQKQ---- 238

Query: 244  LLISPEEAILEWKFRGSIYEGLAFVHSNFSKKILPMNFLNVFRKCSLQDLTPASTLYINM 303
               +  E   E++ R  IYE LA + S F +K+     + +FR+  + DL  A+  Y N+
Sbjct: 239  ---NVTEMSSEFELRSKIYEDLAMIKSEFPRKLFSKENIEIFRRLVINDLNIAAKCYNNV 295

Query: 304  ISGDN--IAFNALNKYIIHIFEYLSNISRANYERXXXXXXXXXXYKLCCLDNLIVETWNS 361
            +S +N       +N+++IHI E+L+ IS   +              L C+D    E+W +
Sbjct: 296  LSSENSDTEMIHINEFVIHIIEFLTAISDFKFSPEDIGTISKSFVTLSCIDRNTEESWTA 355

Query: 362  NFNEFVSKEFGLMASYSLRDQISDFLISLS----SNNFNIIFKEF--ITNLNNCLIIEDW 415
            +FN F+SKE GL AS+++RDQI+DF+ +++    S  +++I  EF  I N N+     DW
Sbjct: 356  DFNSFISKETGLFASFTIRDQIADFISNVNEGVYSGFYSLILNEFNEIINSNS-----DW 410

Query: 416  RQLESMLYIFQSLLINDEDILNVANLNIENLLSSLAKNFHHYITNTILFSRLILLIPKIL 475
            R  ES+LY+ Q +  ++ +I      N + L++++     +  T + +  R IL IPK+L
Sbjct: 411  RTQESVLYLLQCIATSETEINESLQCNTQILVTAIGNIISNPPTQSFVLMRSILTIPKLL 470

Query: 476  EKFMDDIENIKLITCEFLKQSLAIGLDNYNALIKSSCLLMVNSYCSFAELLTVLGDKTCQ 535
            EKFM+ + ++K  T + L  SL I L + + L++SS L+    Y SFAEL +VLGD  C+
Sbjct: 471  EKFMETLPDVKEYTKQLLSISLDIALSSSDELVQSSGLIAFTYYTSFAELNSVLGDVACR 530

Query: 536  EVXXXXXXXXXXXXDDSEDDTYGMIMEVINNLIDCNLPNDKLGEIPQQEFNLILSITSRD 595
                          +DSE+DT G+++EV+NN+IDCN P      I + EF+ +L+I+ +D
Sbjct: 531  VEQEKVLKLIQNLSNDSEEDTNGVLVEVLNNVIDCNSPQHLDETILEVEFDFLLTISVKD 590

Query: 596  PSNVQMTVESQECLKKLLEGLNTFEYSHYIEMCFPSMVKVLIGSSVTQYKYSALLSLALE 655
            PSN+Q+ VE+QECL+KL+E ++   Y+ Y     P ++ V+   + T Y YS LLSLALE
Sbjct: 591  PSNIQLIVEAQECLEKLIESMDINLYNKYAHKLLPFLINVINECNQTGYSYSPLLSLALE 650

Query: 656  FITIFMKKKPNDGYLPLEICKFIFNPLKDVLLVSNEDETLQLSSDAFSYLIYNTDPIVMV 715
            FI I M+ +P+D  LP  IC+ +F+PL+ +L+VS EDETLQL+++AFS+L++N+   V+ 
Sbjct: 651  FINILMRNRPDDISLPTYICEQLFSPLRHILMVSQEDETLQLATEAFSFLLFNSQTDVIF 710

Query: 716  ESLPGILEVMDRLLSLDVTDSAAMNAGSLVVTVFTHFENEIKPYMKQILSGTTKRLIQAK 775
              L  I+ V+ RLLS+D++D+AAMN GSLVVT+FT F  +++  +  IL  TT + I AK
Sbjct: 711  PYLEEIINVLSRLLSMDISDTAAMNVGSLVVTIFTKFSEQVQELIPGILRATTDKFINAK 770

Query: 776  NISTIQNLISVICYLICSNTEDTINLLSRL--GTEGD-ILKLVLNKWISNFEIIRGERRI 832
            NIST QNL+SV C L+C++   TI+ L  L  GT     L LVL KW+ +FEIIRGE++I
Sbjct: 771  NISTSQNLVSVFCLLVCTDPARTIDFLYNLEIGTPPQSSLPLVLTKWLESFEIIRGEKKI 830

Query: 833  KQNILALNKLYCLNNSNIKHIMVDDELIPYDGDRIITRSMAKEMPDRYTQIPVYSKIIKL 892
            K+NILAL+K+Y L +S +  I V+ ++IPY GD IITRSMAK MPD+YT++ VY KI+KL
Sbjct: 831  KENILALSKIYFLKDSRVSSIEVNGDIIPYTGDLIITRSMAKSMPDKYTRVSVYQKIVKL 890

Query: 893  FIQELSEQMKQP------EHNLKIEETV-ETIGDGNXXXXXXXXXXXXXXXXYEKLQEYV 945
            F+ EL  Q K+       +  LK E  + + +G  +                YEKLQEY+
Sbjct: 891  FVAELGFQTKEQDPSDLVDSKLKQELGIPQQMGAAHGDDDDDDWEDVDDVLDYEKLQEYI 950

Query: 946  DDEDDELHFGEDE-DDILGTMDIEIDVKELLIRILKENASKNVSDFDKIYTT 996
            DD+D+E + G  E  +I G  ++    KELLI   KE ASK+++ F +IY T
Sbjct: 951  DDDDEEEYVGGPESQEITGIEEVTQTTKELLIEFFKEAASKDINSFQEIYNT 1002

>TDEL0D06320 Chr4 complement(1134120..1137176) [3057 bp, 1018 aa] {ON}
            Anc_3.564 YGL241W
          Length = 1018

 Score =  782 bits (2019), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 436/1025 (42%), Positives = 627/1025 (61%), Gaps = 32/1025 (3%)

Query: 4    DIDSLIKQAQSPETSLREHAENSLLEWCEHDXXXXXXXXXXXXXXXTEILSSRQYSLLAL 63
            D   LIK+AQS +  +R  AE  LLE  + D                E+LSSRQ++L++L
Sbjct: 8    DSQQLIKEAQSADDVVRRSAEAQLLELSDRDASLVFLSFMKVASDSQELLSSRQFALVSL 67

Query: 64   RKLITMYWSPGFESYHLTSNLNETVKAHVRHTILQLALDKNQDSKIRKSGSYCIVQVSAV 123
            RKLITMYWSPGFESY   SNL E  K  VR  +L+L L+  + SK+  + +YC+VQ+SAV
Sbjct: 68   RKLITMYWSPGFESYRSCSNLKEEAKETVRDYLLKLCLNDQEISKVISAAAYCVVQISAV 127

Query: 124  DFPDLWPELLVTLYKSILETHSLEALSILNEIYDDIISEEMFFEEGIGLETMRVIFNILD 183
            DFPD WP+LL  LY  IL  HSL A+S+L EIYDD++SEEMFFEEGIGLET+R++F I+ 
Sbjct: 128  DFPDQWPKLLTVLYDGILNKHSLSAMSLLTEIYDDVMSEEMFFEEGIGLETIRIVFQIVR 187

Query: 184  DKTAPVETKIAAAKLFYPCLMQMSVVSPTSSLKRMNLVIDSLKEIISKWEQILQFPLEDA 243
            D    +E K+A   LF+ CL Q+  V   S+ KR  + ++  KE ++ W + LQ      
Sbjct: 188  DPNTNLEAKLAGFNLFHACLQQILTVDLNSAPKRKEMTVECAKEALTVWGEHLQSH---- 243

Query: 244  LLISPEEAILEWKFRGSIYEGLAFVHSNFSKKILPMNFLNVFRKCSLQDLTPASTLYINM 303
               S  E  L+ + +G IYE L+ + +  SKK++P      F++  L DL  A  +Y+++
Sbjct: 244  ---SITEHSLQLQIKGRIYEDLSLMKNELSKKLIPDALYVPFKELVLIDLETAGKVYLSI 300

Query: 304  ISG--DNIAFNALNKYIIHIFEYLSNISRANYERXXXXXXXXXXYKLCCLDNLIVETWNS 361
              G  +    + LN+  IHI E+L+       +            +LCCLDN  V  W  
Sbjct: 301  SQGFVEGYRLDDLNECAIHIIEFLTATCHFTMDSAEVERIITALGELCCLDNDTVTLWLE 360

Query: 362  NFNEFVSKEFGLMASYSLRDQISDFLISLSSNNFNIIFKEF---ITNLNNCLIIEDWRQL 418
            +FN ++S E GL ASYS+RDQ S+ L S+   N++++ +     +++LN     ++W+  
Sbjct: 361  DFNSYISMESGLTASYSVRDQASELLTSMDGRNYSLVCQHILYKVSHLNEWK--QEWKFQ 418

Query: 419  ESMLYIFQSLLINDEDILNVANL--NIENLLSSLAKNFHHYITNTILFSRLILLIPKILE 476
            ES L++ Q+  +N+   L   N    I  +LS L          + + SR+ILL+PKILE
Sbjct: 419  ESFLFLVQAAALNES--LPSGNFINEIREVLSFLGSMLCSEDVVSFVSSRIILLLPKILE 476

Query: 477  KFMDDIENIKLITCEFLKQSLAIGLDNYNALIKSSCLLMVNSYCS-FAELLTVLGDKTCQ 535
            K+MD +++++++T   L +S  + L   + +IK+S L+   +YCS FAEL +VLG + C+
Sbjct: 477  KYMDLLDDVRILTSHLLTKSAELALATNDDIIKASVLIAF-TYCSNFAELSSVLGQEVCE 535

Query: 536  EVXXXXXXXXXXXXDDSEDDTYGMIMEVINNLIDCNLPNDKLGEIPQQEFNLILSITSRD 595
                          +D+EDDT G++MEV+NN+IDCN P     EI Q EF+L+L I+++D
Sbjct: 536  ITQKRVLGLIARISEDAEDDTDGVLMEVLNNVIDCNTPGVPNNEIVQTEFSLVLKISAKD 595

Query: 596  PSNVQMTVESQECLKKLLEGLNTFEYSHYIEMCFPSMVKVLIGSSVTQYKYSALLSLALE 655
            P+N+Q+ VESQECL+KLLE L+   Y +Y+E   PS +K + GS+ T+Y YS LLSL L+
Sbjct: 596  PANIQIVVESQECLEKLLENLDIDHYKNYVETWLPSFMKSIEGSAQTKYAYSPLLSLVLQ 655

Query: 656  FITIFMKKKPNDGYLPLEICKFIFNPLKDVLLVSNEDETLQLSSDAFSYLIYNTDPIVMV 715
            F+T F+ KKP D  LP  +C   F PL+ +LL S +DET+QL+++AFSY +YNTDP V+ 
Sbjct: 656  FLTTFL-KKPTDYQLPTVMCNLTFEPLRQILLNSEDDETIQLATEAFSYFLYNTDPTVVA 714

Query: 716  ESLPGILEVMDRLLSLDVTDSAAMNAGSLVVTVFTHFENEIKPYMKQILSGTTKRLIQAK 775
              L  I+ ++DRLLS DV+D+AAM  GSL+VTVFT F  EI+  M  IL     RLIQAK
Sbjct: 715  PHLEAIVAILDRLLSFDVSDAAAMYVGSLIVTVFTRFSTEIENMMPIILRAAANRLIQAK 774

Query: 776  NISTIQNLISVICYLICSNTEDTINLLSRL---GTEGDILKLVLNKWISNFEIIRGERRI 832
            ++ST QNL+SV C+L   +   T++ L  L    TE + L  +++ W+ +FE IRGERR 
Sbjct: 775  HLSTSQNLLSVFCFLTSVDPRQTVDFLFGLHLDNTEHNALYSIVSIWLESFESIRGERRT 834

Query: 833  KQNILALNKLYCLNNSNIKHIMVDDELIPYDGDRIITRSMAKEMPDRYTQIPVYSKIIKL 892
            K+N++AL KLY L++  +  + V+DE+IPY+G++IITRSMAK+MPDRY+Q+ VY+KIIKL
Sbjct: 835  KENVIALIKLYLLHDKRLMEMQVNDEIIPYEGEQIITRSMAKKMPDRYSQVSVYTKIIKL 894

Query: 893  FIQELSEQMKQPEHNLKIEETVETIGDG----NXXXXXXXXXXXXXXXXYEKLQEYVDDE 948
            F+ EL+ Q KQP+    I   +   G+     N                YEKLQEYVD+ 
Sbjct: 895  FVAELNFQDKQPDPERFITSDMAKEGNNGNSDNDTDSDGEWEDVEDVLNYEKLQEYVDES 954

Query: 949  DDELHFGEDEDDILGTMDIE---IDVKELLIRILKENASKNVSDFDKIYTTLSEDEKRIL 1005
            D +   G D DD   +   E     V+++L+   KE A+ N   F  IY +L+E EK+IL
Sbjct: 955  DQDGE-GSDSDDFFASAIDEYSNASVRDILVSFFKEVAANNTGGFRDIYNSLTEVEKKIL 1013

Query: 1006 SECLV 1010
            SE LV
Sbjct: 1014 SENLV 1018

>Smik_7.20 Chr7 (40260..43274) [3015 bp, 1004 aa] {ON} YGL241W (REAL)
          Length = 1004

 Score =  781 bits (2016), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 440/1019 (43%), Positives = 653/1019 (64%), Gaps = 26/1019 (2%)

Query: 3    IDIDSLIKQAQSPETSLREHAENSLLEWCEHDXXXXXXXXXXXXXXXTEILSSRQYSLLA 62
            ++ID L+ +AQS +   RE AE  LL+WC+ +                  L SRQ++LL+
Sbjct: 1    MNIDELVTRAQSADKLTREAAETQLLQWCDSNASQMFTALANVALQHQSPLESRQFALLS 60

Query: 63   LRKLITMYWSPGFESYHLTSNLNETVKAHVRHTILQLALDKNQDSKIRKSGSYCIVQVSA 122
            LRKLITMYWSPGFESY  TS +   VK  +R  +L+L L+ N+++KI    SYCIVQ+SA
Sbjct: 61   LRKLITMYWSPGFESYRSTSVVEVNVKDFIREVLLKLCLNDNENTKIINGASYCIVQISA 120

Query: 123  VDFPDLWPELLVTLYKSILETHSLEALSILNEIYDDIISEEMFFEEGIGLETMRVIFNIL 182
            VDFPD WP+LL  +Y +I   HSL A+S+LNEIYDD++SEEMFFE GIGLET+++IF +L
Sbjct: 121  VDFPDQWPQLLTVIYDAISHQHSLNAMSLLNEIYDDVVSEEMFFEGGIGLETVQIIFKVL 180

Query: 183  DDKTAPVETKIAAAKLFYPCLMQMSVVSPTSSLKRMNLVIDSLKEIISKWEQILQFPLED 242
               T+ +  K AA KLF  CL+QMS  +      R + +   L   + +  Q+L      
Sbjct: 181  ATDTSTLVAKFAALKLFKACLLQMSSHNGYDEESRKSFISQCLSTSLQRLGQLLTMGFHS 240

Query: 243  ALLISPEEAILEWKFRGSIYEGLAFVHSNFSKKILPMNFLNVFRKCSLQDLTPASTLYIN 302
                  E  + + K +  IYE L  + ++FSK    ++    F+  ++QDL   + L  N
Sbjct: 241  ------ENVVSQLKLKSIIYENLVLIKNDFSKNHFSIDLQKQFKIVTVQDLNNIAHLDTN 294

Query: 303  MISGDNIAFNALNKYI----IHIFEYLSNISRANYERXXXXXXXXXXYKLCCLDNLIVET 358
               G++I + ++++ +    I+I E+L+++    +              LC +++ I+E 
Sbjct: 295  ---GNSIEYESISEAVHDGSIYIVEFLTSVCTVPFGSEEVDIIIRSLTTLCQVNSEIMEL 351

Query: 359  WNSNFNEFVSKEFGLMASYSLRDQISDFLISLSSNNFNIIFKEFITNLNNCLIIEDWRQL 418
            W S+FN FVSKE GL ASY++RDQ S+FLISLS+   ++IF     ++       D + L
Sbjct: 352  WISDFNTFVSKETGLAASYNVRDQSSEFLISLSNPLLSLIFSVISKDIERNTY--DNQIL 409

Query: 419  ESMLYIFQSLLINDEDILNVANLNIENLLSSLAKNFHHYITNT----ILFSRLILLIPKI 474
            ES+LY+ QS+L+ND++I    + N++  L +L K F + + +     +  +R IL+IPK+
Sbjct: 410  ESLLYLLQSVLLNDDEI---TDQNLDESLQTLIKTFQNVLVSPEVKELTLARAILVIPKV 466

Query: 475  LEKFMDDIENIKLITCEFLKQSLAIGLDNYNALIKSSCLLMVNSYCSFAELLTVLGDKTC 534
            L+KF+D + +IK +T +FL +SL + L + N LIKS+ L+    YC FAEL +VLG   C
Sbjct: 467  LDKFIDVLPDIKSLTSKFLTKSLDLALKHDNELIKSAALIAFTYYCYFAELDSVLGPDVC 526

Query: 535  QEVXXXXXXXXXXXXDDSEDDTYGMIMEVINNLIDCNLPN-DKLGEIPQQEFNLILSITS 593
             E+             DSE+DT G IMEV++ +I  N    D   EI Q EF+L+ +I+S
Sbjct: 527  SEIQGKVIQIINDINSDSEEDTNGAIMEVLSQVISYNPKGLDSKEEILQAEFHLVFTISS 586

Query: 594  RDPSNVQMTVESQECLKKLLEGLNTFEYSHYIEMCFPSMVKVLIGSSVTQYKYSALLSLA 653
            +DP+NVQ+ V+SQECL+KLL+ +N   Y +YIE+C PS + VL  +SV  Y+YS LLSL 
Sbjct: 587  KDPANVQVVVQSQECLEKLLDEINMDNYKNYIELCLPSFINVLDSNSVNNYRYSPLLSLV 646

Query: 654  LEFITIFMKKKPNDGYLPLEICKFIFNPLKDVLLVSNEDETLQLSSDAFSYLIYNTDPIV 713
            LEFIT+F+KKKP DG+LP EI +++F PL  VL+ S+E+ETLQL++++FSYLI+NTD  V
Sbjct: 647  LEFITVFLKKKPIDGFLPDEITQYLFEPLAKVLVYSSEEETLQLATESFSYLIFNTDTQV 706

Query: 714  MVESLPGILEVMDRLLSLDVTDSAAMNAGSLVVTVFTHFENEIKPYMKQILSGTTKRLIQ 773
            M   L  I++V++RLLSL+V+DSAAMN G LVVT+FT F  +I+P + +IL     RL++
Sbjct: 707  MEPRLMDIMKVLERLLSLEVSDSAAMNVGPLVVTIFTKFSKDIQPLVGRILEAVIVRLVK 766

Query: 774  AKNISTIQNLISVICYLICSNTEDTINLLSRLGT-EGDILKLVLNKWISNFEIIRGERRI 832
            A+NIST QNL+SV+C+L C+++  T+  LS     + + L LV+ KW+  FE+IRGE+RI
Sbjct: 767  AQNISTQQNLLSVLCFLTCNDSRQTVEFLSNFRIDDKNALSLVMQKWMEAFEVIRGEKRI 826

Query: 833  KQNILALNKLYCLNNSNIKHIMVDDELIPYDGDRIITRSMAKEMPDRYTQIPVYSKIIKL 892
            K+NI+AL+ L+ L+++ ++ +MV+ +LIPY+ D IITRSMAK MPDRY Q+P+Y+KIIKL
Sbjct: 827  KENIVALSNLFFLDDARLRKVMVNGDLIPYESDVIITRSMAKRMPDRYVQVPLYTKIIKL 886

Query: 893  FIQELSEQMKQPEHNLKIEETVE-TIGDGNXXXXXXXXXXXXXXXXYEKLQEYVDDEDDE 951
            F+ EL  Q KQP+    I   ++    + N                YEKL+EY++D+ D 
Sbjct: 887  FVSELGFQNKQPDPKQLITSNMQHDAANLNNDEDNDDWEDVDDVLDYEKLKEYINDDVDG 946

Query: 952  LHFGEDEDDILGTMDIEIDVKELLIRILKENASKNVSDFDKIYTTLSEDEKRILSECLV 1010
                +D +DI G MD++  V ++L+R  KE A+K+VS F++IY TLS+ ++++LSE L+
Sbjct: 947  ED-EDDSEDITGLMDVKESVVQILVRFFKEVATKDVSGFNRIYETLSDSDRKVLSEALL 1004

>TPHA0G03630 Chr7 complement(770678..773746) [3069 bp, 1022 aa] {ON}
            Anc_3.564 YGL241W
          Length = 1022

 Score =  764 bits (1973), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 422/1029 (41%), Positives = 643/1029 (62%), Gaps = 31/1029 (3%)

Query: 4    DIDSLIKQAQSPETSLREHAENSLLEWCEHDXXXXXXXXXXXXXXXTEILSSRQYSLLAL 63
            D+  LI  AQS + ++RE+AE+ LL+ C+ +                E LSSRQ+ +L+L
Sbjct: 3    DVHLLIAHAQSADNNVRENAESELLQKCDENASVVFNSLIELANNINEPLSSRQFCILSL 62

Query: 64   RKLITMYWSPGFESYHLTSNLNETVKAHVRHTILQLALDKNQDSKIRKSGSYCIVQVSAV 123
            +KLITMYWSPGF+SY  TSN+ E  K  +R ++L+L L+  QDSKI+ S SYCIVQ+SA+
Sbjct: 63   KKLITMYWSPGFDSYRGTSNVQEETKEFLRDSLLKLCLNTEQDSKIKSSSSYCIVQISAI 122

Query: 124  DFPDLWPELLVTLYKSILETHSLEALSILNEIYDDIISEEMFFEEGIGLETMRVIFNILD 183
            DFPDLWP LLV +Y +IL+ HS+EA+S+LNEIYDD+ISEEMFFE G+G ET++ IF I  
Sbjct: 123  DFPDLWPNLLVVIYNAILKDHSIEAMSLLNEIYDDVISEEMFFEGGVGEETIKTIFAIFT 182

Query: 184  DKTAPVETKIAAAKLFYPCLMQMSVVSPTSSLKRMNLVIDSLKEIISKWEQILQFPLEDA 243
                 ++ K+AA+KL +  ++QMS++  + S KR + V     + I+K   IL   L   
Sbjct: 183  SPETNIKAKVAASKLLHSTVLQMSILDNSMSFKRKDFV----SQCITKLLDILLTILPHL 238

Query: 244  LLISPEEAILEWKFRGSIYEGLAFVHSNFSKKILPMNFLNVFRKCSLQDLTPASTLYINM 303
             +   E+A+   + + + YE L  + + F KK+   + +  F+  SL+DL    + Y+  
Sbjct: 239  DVNQSEDAL---QLKTNFYEELTTIKTEFPKKLFHNSLVTNFKAISLKDLEIIGSSYLQF 295

Query: 304  ISGDNIA--FNALNKYIIHIFEYLSNISRANYERXXXXXXXXXXYKLCCLDNLIVETWNS 361
            I  D        +N+Y +H+ +++S++S   +++            LCCLDN   E+W S
Sbjct: 296  IDSDASGSQLQLINEYGVHLIDFISSLSVQGFDKVDLTRIVSSLVMLCCLDNNTYESWES 355

Query: 362  NFNEFVSKEFGLMASYSLRDQISDFLISLSSNNFNIIFKEFITNLNNCLI-IEDWRQLES 420
            +FN F+SKE GL+A+Y++RDQ   F   L    ++I +   +  LN  +    +W+  ES
Sbjct: 356  DFNTFISKEAGLLANYTIRDQTMQFFSDLEKPTYSIAYGIILEELNKSMENYNNWKLQES 415

Query: 421  MLYIFQSLLINDEDILNVANLNIENLLSSLAKNFHHYITNTILFSRLILLIPKILEKFMD 480
            +LY  QS++ ++E+  +      EN+L+SL K      +N ++ SR +LL PK LEKFM+
Sbjct: 416  LLYTLQSIISSEEEFNSELLGYTENVLNSLGKLLMDPSSNIMVKSRCLLLCPKYLEKFME 475

Query: 481  DIENIKLITCEFLKQSLAIGLDNYNALIKSSCLLMVNSYCSFAELLTVLGDKTCQEVXXX 540
                +K +T E L  SL + L+  + ++KSS L+  + Y S+A+L +VLG   C  +   
Sbjct: 476  SYTAVKPMTKELLSTSLNLSLNTSSEILKSSMLIAFSYYASYADLSSVLGSADCISIQQG 535

Query: 541  XXXXXXXXXDDSEDDTYGMIMEVINNLIDCNLPNDKLGEIPQQEFNLILSITSRDPSNVQ 600
                     +D+E+DTY + +E I+N+ID N       E+   EFN++L I+ +DP N+Q
Sbjct: 536  LLKIIKDIANDAEEDTYAICVETISNVIDNNSSGTGSDEVRDNEFNILLEISFKDPGNIQ 595

Query: 601  MTVESQECLKKLLEGLNTFEYSHYIEMCFPSMVKVLIGSSVTQYKYSALLSLALEFITIF 660
            ++VESQECL+KLL+G++   Y +Y E   P ++K++   + T Y YS LLSL L+F+  F
Sbjct: 596  LSVESQECLEKLLDGMDISLYIYYAEKVIPLLIKIIADHASTNYDYSPLLSLTLDFLMTF 655

Query: 661  MKKKPNDGYLPLEICKFIFNPLKDVLLVSNEDETLQLSSDAFSYLIYNTDPIVMVESLPG 720
            MKKKP D  LP+EI K +FNP+ +VLL SNE+ET+QL+++AFS+L++N+D  +M   L  
Sbjct: 656  MKKKPVDSTLPVEISKLVFNPVCEVLLSSNEEETIQLATEAFSFLVFNSDVSLMQTVLEN 715

Query: 721  ILEVMDRLLSLDVTDSAAMNAGSLVVTVFTHFENEIKPYMKQILSGTTKRLIQAKNISTI 780
            I+ V+ +LLSL+++D+AAMN G+L++T+F+ F  +I+  +  IL  TT++ + AKNI T 
Sbjct: 716  IVNVLSKLLSLNISDTAAMNVGTLIITIFSKFSQQIQELLPAILQATTQKFVNAKNIITS 775

Query: 781  QNLISVICYLICSNTEDTINLLSRLGTEG----DILKLVLNKWISNFEIIRGERRIKQNI 836
            QNL+ V C+LICS+ + T++ L  L  E     + L LVL KW+  F+IIRGE+RIK+NI
Sbjct: 776  QNLLMVFCFLICSDPQQTVDFLYNLSLEDQQEENTLTLVLKKWLELFDIIRGEKRIKENI 835

Query: 837  LALNKLYCLNNSNIKHIMVDDELIPYDGDRIITRSMAKEMPDRYTQIPVYSKIIKLFIQE 896
            +AL+K+Y L +  I+ ++V+ ++IPY GD+IITRSMAK +PD++TQ+P+Y KI+KLF+ E
Sbjct: 836  IALSKIYLLLDKRIELVIVNGDIIPYSGDKIITRSMAKSIPDQFTQMPIYEKIVKLFLGE 895

Query: 897  LSEQMKQPE----HNLKIEETVET----IGDGNXXXXXXXXXXXXXXXXYEKLQEYVDDE 948
            L+ Q K       H++ I++        +                    YEKLQEYVDD+
Sbjct: 896  LASQSKNISDANLHSIDIQKLARAEENQVEQKLDSSEDDDWEDVEDVLDYEKLQEYVDDD 955

Query: 949  DDEL-HFGEDEDD------ILGTMDIEIDVKELLIRILKENASKNVSDFDKIYTTLSEDE 1001
            DDEL ++  DED+      I+G  DI   V EL+I   KE  SKN++ F  IY++LSEDE
Sbjct: 956  DDELANYTSDEDNDTPTGQIIG--DINQSVSELIINFFKEVTSKNINSFQDIYSSLSEDE 1013

Query: 1002 KRILSECLV 1010
            K++L+  LV
Sbjct: 1014 KKLLANALV 1022

>YGL241W Chr7 (45445..48459) [3015 bp, 1004 aa] {ON}
            KAP114Karyopherin, responsible for nuclear import of
            specific proteins; cargoes include Spt15p, Sua7p,
            histones H2A and H2B, and Nap1p; amino terminus shows
            similarity to those of other importins, particularly
            Cse1p; localization is primarily nuclear; function is
            regulated by sumoylation
          Length = 1004

 Score =  758 bits (1957), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 443/1017 (43%), Positives = 639/1017 (62%), Gaps = 22/1017 (2%)

Query: 3    IDIDSLIKQAQSPETSLREHAENSLLEWCEHDXXXXXXXXXXXXXXXTEILSSRQYSLLA 62
            +DI+ LI  AQS +   RE AE  LL+WC+ D                  L SRQ++LL+
Sbjct: 1    MDINELIIGAQSADKHTREVAETQLLQWCDSDASQVFKALANVALQHEASLESRQFALLS 60

Query: 63   LRKLITMYWSPGFESYHLTSNLNETVKAHVRHTILQLALDKNQDSKIRKSGSYCIVQVSA 122
            LRKLITMYWSPGFESY  TSN+   VK  +R  +L+L L+ N+++KI+   SYCIVQ+SA
Sbjct: 61   LRKLITMYWSPGFESYRSTSNVEIDVKDFIREVLLKLCLNDNENTKIKNGASYCIVQISA 120

Query: 123  VDFPDLWPELLVTLYKSILETHSLEALSILNEIYDDIISEEMFFEEGIGLETMRVIFNIL 182
            VDFPD WP+LL  +Y +I   HSL A+S+LNEIYDD++SEEMFFE GIGL TM ++F +L
Sbjct: 121  VDFPDQWPQLLTVIYDAISHQHSLNAMSLLNEIYDDVVSEEMFFEGGIGLATMEIVFKVL 180

Query: 183  DDKTAPVETKIAAAKLFYPCLMQMSVVSPTSSLKRMNLVIDSLKEIISKWEQILQFPLED 242
            + +T+ +  KIAA KL   CL+QMS  +      R + V   L   +    Q+L     +
Sbjct: 181  NTETSTLIAKIAALKLLKACLLQMSSHNEYDEASRKSFVSQCLATSLQILGQLLTLNFGN 240

Query: 243  ALLISPEEAILEWKFRGSIYEGLAFVHSNFSKKILPMNFLNVFRKCSLQDLTPASTLYIN 302
              +IS      + KF+  IYE L F+ ++FS+K         F+  ++QDL   + +  N
Sbjct: 241  VDVIS------QLKFKSIIYENLVFIKNDFSRKHFSSELQKQFKIMAIQDLENVTHINAN 294

Query: 303  MISGDNIAF-NALNKYIIHIFEYLSNISRANYERXXXXXXXXXXYKLCCLDNLIVETWNS 361
            + + ++      ++   I+I E+L+++    +              LC L +   E W S
Sbjct: 295  VETTESEPLLETVHDCSIYIVEFLTSVCTLQFSVEEMNKIITSLTILCQLSSETREIWTS 354

Query: 362  NFNEFVSKEFGLMASYSLRDQISDFLISLSSNNFNIIFKEFITNLNNCLIIEDWRQLESM 421
            +FN FVSKE GL ASY++RDQ ++F  SL +   ++IFK    ++ +     ++  LES+
Sbjct: 355  DFNTFVSKETGLAASYNVRDQANEFFTSLPNPQLSLIFKVVSNDIEHSTC--NYSTLESL 412

Query: 422  LYIFQSLLINDEDILNVANLNIENLLSSLAKNFHHYITNT----ILFSRLILLIPKILEK 477
            LY+ Q +L+ND++I      NI+  L  L K   + + +     ++ +R IL IP++L+K
Sbjct: 413  LYLLQCILLNDDEI---TGENIDQSLQILIKTLENILVSQEIPELILARAILTIPRVLDK 469

Query: 478  FMDDIENIKLITCEFLKQSLAIGLDNYNALIKSSCLLMVNSYCSFAELLTVLGDKTCQEV 537
            F+D + +IK +T  FL +SL + L +   LIKS+ L+    YC FAEL +VLG + C E 
Sbjct: 470  FIDALPDIKPLTSAFLAKSLNLALKSDKELIKSATLIAFTYYCYFAELDSVLGPEVCSET 529

Query: 538  XXXXXXXXXXXXDDSEDDTYGMIMEVINNLIDCNL--PNDKLGEIPQQEFNLILSITSRD 595
                         D+E+DT G +MEV++ +I  N   P+ +  EI Q EF+L+ +I+S D
Sbjct: 530  QEKVIRIINQVSSDAEEDTNGALMEVLSQVISYNPKEPHSR-KEILQAEFHLVFTISSED 588

Query: 596  PSNVQMTVESQECLKKLLEGLNTFEYSHYIEMCFPSMVKVLIGSSVTQYKYSALLSLALE 655
            P+NVQ+ V+SQECL+KLL+ +N   Y +YIE+C PS + VL  ++   Y+YS LLSL LE
Sbjct: 589  PANVQVVVQSQECLEKLLDNINMDNYKNYIELCLPSFINVLDSNNANNYRYSPLLSLVLE 648

Query: 656  FITIFMKKKPNDGYLPLEICKFIFNPLKDVLLVSNEDETLQLSSDAFSYLIYNTDPIVMV 715
            FIT+F+KKKPNDG+LP EI +++F PL  VL  S EDETLQL+++AFSYLI+NTD   M 
Sbjct: 649  FITVFLKKKPNDGFLPDEINQYLFEPLAKVLAFSTEDETLQLATEAFSYLIFNTDTRAME 708

Query: 716  ESLPGILEVMDRLLSLDVTDSAAMNAGSLVVTVFTHFENEIKPYMKQILSGTTKRLIQAK 775
              L  I++V++RLLSL+V+DSAAMN G LVV +FT F  EI+P + +IL     RLI+ +
Sbjct: 709  PRLMDIMKVLERLLSLEVSDSAAMNVGPLVVAIFTRFSKEIQPLIGRILEAVVVRLIKTQ 768

Query: 776  NISTIQNLISVICYLICSNTEDTINLLSRLGTEG-DILKLVLNKWISNFEIIRGERRIKQ 834
            NIST QNL+SV+C+L C++ + T++ LS    +  D L LV+ KWI  FE+IRGE+RIK+
Sbjct: 769  NISTEQNLLSVLCFLTCNDPKQTVDFLSSFQIDNTDALTLVMRKWIEAFEVIRGEKRIKE 828

Query: 835  NILALNKLYCLNNSNIKHIMVDDELIPYDGDRIITRSMAKEMPDRYTQIPVYSKIIKLFI 894
            NI+AL+ L+ LN+  ++ ++V+  LIPY+GD IITRSMAK+MPDRY Q+P+Y+KIIKLF+
Sbjct: 829  NIVALSNLFFLNDKRLQKVVVNGNLIPYEGDLIITRSMAKKMPDRYVQVPLYTKIIKLFV 888

Query: 895  QELSEQMKQPE-HNLKIEETVETIGDGNXXXXXXXXXXXXXXXXYEKLQEYVDDEDDELH 953
             ELS Q KQP    L   +  + + + N                Y+KL+EY+DD+ DE  
Sbjct: 889  SELSFQSKQPNPEQLITSDIKQEVVNANKDDDNDDWEDVDDVLDYDKLKEYIDDDVDEEA 948

Query: 954  FGEDEDDILGTMDIEIDVKELLIRILKENASKNVSDFDKIYTTLSEDEKRILSECLV 1010
              +D DDI G MD++  V +LL+R  KE ASK+VS F  IY TLS+ E+++LSE L+
Sbjct: 949  -DDDSDDITGLMDVKESVVQLLVRFFKEVASKDVSGFHCIYETLSDSERKVLSEALL 1004

>Skud_7.26 Chr7 (49585..52632) [3048 bp, 1015 aa] {ON} YGL241W (REAL)
          Length = 1015

 Score =  756 bits (1951), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 438/1018 (43%), Positives = 642/1018 (63%), Gaps = 21/1018 (2%)

Query: 2    NIDIDSLIKQAQSPETSLREHAENSLLEWCEHDXXXXXXXXXXXXXXXTEILSSRQYSLL 61
            ++DI+ LI QAQS +   RE AE  LL+WC+ D                  L SRQ++LL
Sbjct: 10   DMDINQLIIQAQSADNHTREVAEAQLLQWCDSDASQMFTALVNAALQQQSALQSRQFALL 69

Query: 62   ALRKLITMYWSPGFESYHLTSNLNETVKAHVRHTILQLALDKNQDSKIRKSGSYCIVQVS 121
            +LRKLITMYWSPGFESY  TSN++  VK  +R  +L+L L+ N++++I+   SYCIVQ+S
Sbjct: 70   SLRKLITMYWSPGFESYRSTSNVDVKVKEFIREALLKLCLNDNENTRIKNGASYCIVQIS 129

Query: 122  AVDFPDLWPELLVTLYKSILETHSLEALSILNEIYDDIISEEMFFEEGIGLETMRVIFNI 181
            AVDFPD WP+LL  +Y  I   HSL A+ +LNEIYDD++SEEMFFE GIGLET  +IF +
Sbjct: 130  AVDFPDQWPQLLSVIYDGISRQHSLNAMFLLNEIYDDVVSEEMFFEGGIGLETAEIIFKV 189

Query: 182  LDDKTAPVETKIAAAKLFYPCLMQMSVVSPTSSLKRMNLVIDSLKEIISKWEQILQFPLE 241
            L  +T+ +  KIAA KL   CL+QMS  +      R + V   +   + +  Q+L    +
Sbjct: 190  LVAETSSLVAKIAALKLLKACLLQMSSHNGHYEESRKDFVSQCISTSLQRLGQLLTLNFD 249

Query: 242  DALLISPEEAILEWKFRGSIYEGLAFVHSNFSKKILPMNFLNVFRKCSLQDLTPASTLYI 301
            +      E+ I + K +  IYE L F+ ++FSKK       + F+  +++DL   S +  
Sbjct: 250  N------EDVISQLKLKSIIYENLVFIKNDFSKKHFAEKLQDHFKLVAIRDLKNISLIDT 303

Query: 302  NMISGDNIAFNALNKYI----IHIFEYLSNISRANYERXXXXXXXXXXYKLCCLDNLIVE 357
            N   GD        K +    ++I E+L+++   ++              LC + +   E
Sbjct: 304  ND-DGDYPESENFVKTVHDCSVYIVEFLTSVCTISFTIEEISVIIGALTTLCKVGSDASE 362

Query: 358  TWNSNFNEFVSKEFGLMASYSLRDQISDFLISLSSNNFNIIFKEFITNLNNCLIIEDWRQ 417
             W S+FNEFVSKE GL ASY++RDQ  +F  SLS+   ++IF     N++  L   + + 
Sbjct: 363  LWISDFNEFVSKETGLAASYNIRDQACEFFTSLSNPQLSLIFGVVSKNID--LNTSNHQT 420

Query: 418  LESMLYIFQSLLINDEDILNVANLN--IENLLSSLAKNFHHYITNTILFSRLILLIPKIL 475
             ES+LY+ Q +L+ND++I +  N+N  ++NLL  L         + +  +R+IL+IPK+L
Sbjct: 421  FESLLYLLQCILLNDDEI-SSQNINQSLQNLLGILQNALTSSEIHELTLARVILVIPKLL 479

Query: 476  EKFMDDIENIKLITCEFLKQSLAIGLDNYNALIKSSCLLMVNSYCSFAELLTVLGDKTCQ 535
            +KF+D + +IK +T  FL +SL + L     LIKS+ L+    YC FAEL +VLG + C 
Sbjct: 480  DKFIDVLPDIKSVTSRFLAKSLDLALKCDQELIKSAALIAFPYYCYFAELDSVLGPQLCT 539

Query: 536  EVXXXXXXXXXXXXDDSEDDTYGMIMEVINNLIDCNL--PNDKLGEIPQQEFNLILSITS 593
            E+            +D+E+DT G IMEV+N +I  N   P  K  E+ Q E +L+ +I+S
Sbjct: 540  ELQEKVIQIINEISNDAEEDTNGTIMEVLNQVISYNSKGPYSK-KEVLQAEVHLVFTISS 598

Query: 594  RDPSNVQMTVESQECLKKLLEGLNTFEYSHYIEMCFPSMVKVLIGSSVTQYKYSALLSLA 653
            +DP+NVQ+ V+SQECL+KLL+ +N   Y +YIE+C PS + VL  +    YKYS LLSL 
Sbjct: 599  KDPANVQVVVQSQECLEKLLDDINMDNYKNYIELCLPSFINVLNANDENNYKYSPLLSLV 658

Query: 654  LEFITIFMKKKPNDGYLPLEICKFIFNPLKDVLLVSNEDETLQLSSDAFSYLIYNTDPIV 713
            LEFI +F+KK+PNDGYLP EI +++F PL  VL+ S EDETLQL+++AFSYLI+NTD   
Sbjct: 659  LEFIAVFLKKRPNDGYLPDEINQYLFEPLAKVLVYSTEDETLQLATEAFSYLIFNTDTQT 718

Query: 714  MVESLPGILEVMDRLLSLDVTDSAAMNAGSLVVTVFTHFENEIKPYMKQILSGTTKRLIQ 773
            M   L  I+++++RLLSL+V+DSAAMN GSLVV +FT F  E++P + +IL     RL++
Sbjct: 719  MQTRLMDIMKILERLLSLEVSDSAAMNVGSLVVAIFTRFSKEVQPLVGRILQAVVVRLVK 778

Query: 774  AKNISTIQNLISVICYLICSNTEDTINLLSRLGTEG-DILKLVLNKWISNFEIIRGERRI 832
            A+NIST QNL+SV+C+L C++T+ T++ LS    +  + L LV++KW+  FE+IRGER+I
Sbjct: 779  AQNISTQQNLLSVLCFLTCNDTKQTVDFLSSFRIDDKEALSLVMSKWMEAFEVIRGERKI 838

Query: 833  KQNILALNKLYCLNNSNIKHIMVDDELIPYDGDRIITRSMAKEMPDRYTQIPVYSKIIKL 892
            K++I+AL+K + LN+  +  +MV+ ++IPY+GD IITRSMAK+MPD+Y Q+P+Y+KIIKL
Sbjct: 839  KESIVALSKFFFLNDPRLHKLMVNGDMIPYEGDLIITRSMAKKMPDKYVQVPLYTKIIKL 898

Query: 893  FIQELSEQMKQPEHNLKIEETVETIGDGNXXXXXXXXXXXXXXXXYEKLQEYVDDEDDEL 952
            FI EL  Q KQ +    +  +++   + N                YEKL+EY+ D+D + 
Sbjct: 899  FISELGFQAKQLDPEQLVASSIQESANANNDDETGDWEDVDDVLDYEKLKEYI-DDDVDG 957

Query: 953  HFGEDEDDILGTMDIEIDVKELLIRILKENASKNVSDFDKIYTTLSEDEKRILSECLV 1010
               +D DDI G  D++  V ++L+   +E A+KNVSDF  IY TLS+ E++ LSE L+
Sbjct: 958  EEEDDRDDITGLTDVKESVVQILVSFFREVATKNVSDFHLIYETLSDSERKTLSEALL 1015

>KNAG0D02940 Chr4 complement(529102..532131) [3030 bp, 1009 aa] {ON}
            Anc_3.564 YGL241W
          Length = 1009

 Score =  728 bits (1880), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 418/1033 (40%), Positives = 629/1033 (60%), Gaps = 49/1033 (4%)

Query: 3    IDIDSLIKQAQSPETSLREHAENSLLEWCEHDXXXXXXXXXXXXXXXTE-ILSSRQYSLL 61
            +++D LI   QSP+ S+R  AE++L+   + D                E  L+ RQ++LL
Sbjct: 1    MNMDELIALLQSPDNSVRTQAESNLMTVSDEDASHVLQSLINVALNSAEKPLTERQFALL 60

Query: 62   ALRKLITMYWSPGFESYHLTSNLNETVKAHVRHTILQLALDKNQDSKIRKSGSYCIVQVS 121
            ++RKLIT YWSP FESY  T+ L+   K +VR ++LQL+L+ +QD+KI+KS SYCIVQ+S
Sbjct: 61   SMRKLITFYWSPAFESYRNTATLDLLTKQYVRDSLLQLSLNDSQDTKIKKSASYCIVQIS 120

Query: 122  AVDFPDLWPELLVTLYKSILETHSLEALSILNEIYDDIISEEMFFEEGIGLETMRVIFNI 181
            AVDFPD WP+LL  LY +I   HSL A+S+LNEIYDD+ISEEMFFE GIGLET+++IF +
Sbjct: 121  AVDFPDEWPKLLEELYGAITNFHSLSAISLLNEIYDDVISEEMFFEGGIGLETLQIIFQL 180

Query: 182  LDDKTAPVETKIAAAKLFYPCLMQMSVV-SPTSSLKRMNLV-------IDSLKEIISKWE 233
            L    + +E K+AA  LF+  L+QMS V S T+  KR  +V       +D+L+ ++    
Sbjct: 181  LSSDASTIEAKLAAINLFHATLLQMSTVDSHTTQEKRKEMVRNCVPICLDTLRTLLEGLA 240

Query: 234  QILQFPLEDALLISPEEAILEWKFRGSIYEGLAFVHSNFSKKILPMNFLNVFRKCSLQDL 293
             I               + L  + +GSIY+ L F+ + F  ++ P  F+  F+  +++DL
Sbjct: 241  DI--------------NSALPLQLKGSIYKSLEFIKNKFPTQLFPSQFVEYFKIQAVRDL 286

Query: 294  TPASTLYINMIS-GDNIAFNALNKYIIHIFEYLSNISRANYERXXXXXXXXXXYKLCCLD 352
                 L IN  S  D+    A N+  IH+ E +S+I    Y              L  LD
Sbjct: 287  V---ALQINQDSFADDTVVEAFNECAIHVIELISSIEITEYGTEDQHAILKALLSLSRLD 343

Query: 353  NLIVETWNSNFNEFVSKEFGLMASYSLRDQISDFLISLSSNNFNIIFKEFITNLNNCLII 412
                E+W ++FN+FVSKE GL AS+++RDQ++D+L + +      +F+  +  +++ L  
Sbjct: 344  ANTKESWTTDFNDFVSKETGLAASFTIRDQVADYLGTPTGAQSQTMFENILQLVSDILSS 403

Query: 413  -EDWRQLESMLYIFQSLLINDEDILNVANLNIENLLSSLAK----NFHHYITNTILFSRL 467
              D   +ES L++ QS+L  D D    +   +  L+S+L      N H+   ++IL SR+
Sbjct: 404  NADPTTIESSLFLLQSVLAEDTDFSVSSPQTLVQLISALIGPQTINTHN---DSILRSRI 460

Query: 468  ILLIPKILEKFMDDIENIKLITCEFLKQSLAIGLDNYNALIKSSCLLMVNSYCSFAELLT 527
            IL IPKIL+ FMD + NIK +T + L ++L   L + + LI  S L+    Y  FAEL +
Sbjct: 461  ILTIPKILDVFMDSLPNIKQLTKDLLLKTLQDALSSTDELIFCSTLIAFTYYVYFAELPS 520

Query: 528  VLGDKTCQEVXXXXXXXXXXXXDDSEDDTYGMIMEVINNLIDCNLPNDKLGEIPQQEFNL 587
            VLG ++C+E+             ++E+DT G+++EV+N++I CN+ +    ++ Q+E   
Sbjct: 521  VLGSESCRELQEAVLGIVNHVASEAEEDTNGLLIEVLNHVISCNVASTDF-KLLQKELTA 579

Query: 588  ILSITSRDPSNVQMTVESQECLKKLLEGLNTFEYSHYIEMCFPSMVKVLIGSSVTQYKYS 647
            +LSI+S+DPSN++++VESQECL+KLL+ +NT  Y+ +I +C PS V ++ G+   +YKY+
Sbjct: 580  MLSISSKDPSNIEVSVESQECLEKLLDNINTERYNKFISICLPSFVNIIKGNQPLKYKYN 639

Query: 648  ALLSLALEFITIFMKKKPNDGYLPLEICKFIFNPLKDVLLVSNEDETLQLSSDAFSYLIY 707
             LLSL LEF+ IFMKKKP +G LP    + I   L D+L  S EDETLQL++ AFS+L+ 
Sbjct: 640  PLLSLILEFVRIFMKKKPTNGMLPRNFSEGIIALLVDILERSEEDETLQLATAAFSHLLN 699

Query: 708  NTDPIVMVESLPGILEVMDRLLSLDVTDSAAMNAGSLVVTVFTHFENEIKPYMKQILSGT 767
            NTDP ++++ L  +++V+ RLLS+ V+D+AA N G+L+VT+F  +  E+   +  IL   
Sbjct: 700  NTDPTIVIQHLTVVIKVLKRLLSMFVSDTAAQNVGTLIVTLFNKYSKELTNLIPDILESA 759

Query: 768  TKRLIQAKNISTIQNLISVICYLICSNTEDTINLLSRL--GTEGDILKLVLNKWISNFEI 825
              RLI AKN++T +NLIS+ICY+ C +    +N L +       DI  L+ NKW   FEI
Sbjct: 760  IYRLIDAKNVTTQENLISLICYVTCCDPLQMVNFLFKFSESERRDIPSLMFNKWFETFEI 819

Query: 826  IRGERRIKQNILALNKLYCLNNSNIKHIMVDDELIPYDGDRIITRSMAKEMPDRYTQIPV 885
            +RGER+IK NI+AL+K++ L++  + ++ V+ +L+PY+GDRIITRSMAKEMPDRYTQI V
Sbjct: 820  VRGERKIKDNIIALSKIFFLSDFRLTYVKVNGDLLPYEGDRIITRSMAKEMPDRYTQIDV 879

Query: 886  YSKIIKLFIQELSEQMKQPEHNLKIEETVE-----TIGDGNXXXXXXXXXXXXXXXXYEK 940
            YSKI+K+F+ EL  + KQP+    I   ++        +GN                YEK
Sbjct: 880  YSKIVKVFVTELQFRNKQPDAERLITSDIKHSDELAAAEGN---DDDGWEDVDDVLDYEK 936

Query: 941  LQEYV---DDEDDELHFGEDEDDILGTMDIEIDVKELLIRILKENASKNVSDFDKIYTTL 997
            L+E+V   DD +D +  G D D+I G   +     +LL    KE  + NV+ F ++Y  L
Sbjct: 937  LKEFVDDDDDREDSVGLGNDADEITGIDAVPQSATQLLTAFFKEAMTNNVNGFQEMYNAL 996

Query: 998  SEDEKRILSECLV 1010
            SE E+ ILS+CL+
Sbjct: 997  SESERTILSQCLL 1009

>ZYRO0E09460g Chr5 complement(753030..756059) [3030 bp, 1009 aa] {ON}
            similar to uniprot|P53067 Saccharomyces cerevisiae
            YGL241W
          Length = 1009

 Score =  723 bits (1867), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 410/1015 (40%), Positives = 617/1015 (60%), Gaps = 16/1015 (1%)

Query: 4    DIDSLIKQAQSPETSLREHAENSLLEWCEHDXXXXXXXXXXXXXXXTEILSSRQYSLLAL 63
            D  SLI +AQSP  ++R+ +E  LL+ C+ D                + L SRQ++LL L
Sbjct: 3    DAPSLILEAQSPLDNVRKSSEERLLQMCDEDSSQVFVQFVQVAADTQQELPSRQFALLTL 62

Query: 64   RKLITMYWSPGFESYHLTSNLNETVKAHVRHTILQLALDKNQDSKIRKSGSYCIVQVSAV 123
            RKL+TMYW+PGFES+  TS +    +  +R  +LQL LD++Q SKIR   SY +VQ+SAV
Sbjct: 63   RKLVTMYWTPGFESFRGTSTVKLEARGMIRDVLLQLCLDEHQPSKIRNGASYAVVQISAV 122

Query: 124  DFPDLWPELLVTLYKSILETHSLEALSILNEIYDDIISEEMFFEEGIGLETMRVIFNILD 183
            DFPD WPELL  +Y +I+++HSL A+ +LNEIYDD+ISEEMFFEEGIG ET++++F++++
Sbjct: 123  DFPDQWPELLNIVYNAIMKSHSLAAMKLLNEIYDDVISEEMFFEEGIGFETLKIVFHVMN 182

Query: 184  DKTAPVETKIAAAKLFYPCLMQMSVVSPTSSLKRMNLVIDSLKEIISKWEQILQFPLEDA 243
               A  E K+AA  L + C++QMS V+ +S+ KR  L +++ KEI+  W   + F     
Sbjct: 183  SYDANWEAKVAALNLLHCCILQMSTVNGSSTTKRKELTVEACKEILQMW---VNFLTTQN 239

Query: 244  LLISPEEAILEWKFRGSIYEGLAFVHSNFSKKILPMNFLNVFRKCSLQDLTPASTLYINM 303
              IS     L+      IY+GL  + + FSKKI+  +  + FR   ++DL  AS +Y+ M
Sbjct: 240  KTIS---ETLQLMAGAKIYQGLTLLKNEFSKKIVAPDMYHQFRTIVMRDLENASQIYMQM 296

Query: 304  I-SGDNIAFNALNKYIIHIFEYLSNISRANYERXXXXXXXXXXYKLCCLDNLIVETWNSN 362
            + +      +A+N+Y ++I E+LS++    +             +LCCL+   V++W ++
Sbjct: 297  VENSSQDQLDAINEYAVNILEFLSSLCDVRFTEEELQTVLRCLSRLCCLNQDTVDSWQTD 356

Query: 363  FNEFVSKEFGLMASYSLRDQISDFLISLSSNNFNIIFKEFITNLNNCLIIED-WRQLESM 421
            FN FVSKE GL+AS+++RDQ ++ L S  S ++  +    +  ++      D W   ES+
Sbjct: 357  FNSFVSKETGLVASFTIRDQAAELLSSFDSQDYATVLVLLVHEISQISDFSDGWIFNESL 416

Query: 422  LYIFQSLLINDEDILNVANLNIENLLSSLAKNFHHYITNTILFSRLILLIPKILEKFMDD 481
            LY+ QSLL+N+ + L   +  +  + + L       ++   +  R+ILLIPK+LEK MD 
Sbjct: 417  LYLLQSLLLNEANSLEFMDA-VTRIFTKLQSILEKSLSCVFVNCRIILLIPKLLEKIMDS 475

Query: 482  IENIKLITCEFLKQSLAIGLDNYNALIKSSCLLMVNSYCSFAELLTVLGDKTCQEVXXXX 541
              N++ +   FL  SL   L   N LIKS+ L+    Y  FAEL +VLG   C +V    
Sbjct: 476  FPNVRDLVQNFLFLSLDFALSQDNELIKSATLISFTYYSYFAELPSVLGPDNCIQVQQKT 535

Query: 542  XXXXXXXXDDSEDDTYGMIMEVINNLIDCNLPN-DKLGEIPQQEFNLILSITSRDPSNVQ 600
                     ++EDDT G++MEV++N+IDCN  N D    I Q EF+L+ +I+S+DPSN+Q
Sbjct: 536  LKLIAQLYPEAEDDTDGVLMEVLDNVIDCNSENVDDTSSIIQTEFHLVFTISSKDPSNIQ 595

Query: 601  MTVESQECLKKLLEGLNTFEYSHYIEMCFPSMVKVLIGSSVTQYKYSALLSLALEFITIF 660
             T+E QECL KLL+ ++   +  + E+CFP MV V+IGS+ + ++YS LLSL L+ + + 
Sbjct: 596  TTIELQECLGKLLKNVDVKTFITFWEICFPPMVNVMIGSAHSSFEYSPLLSLTLQVLGVL 655

Query: 661  MKKKPNDGYLPLEICKFIFNPLKDVLLVSNEDETLQLSSDAFSYLIYNTDPIVMVESLPG 720
            MK+KP D  L + IC  +F PL+++L  S ++E LQ +++A  YLIYNT+  V++  L  
Sbjct: 656  MKRKPLDPTLSITICNDVFEPLQNILNQSKDEEILQYATEALGYLIYNTEAEVILPHLKS 715

Query: 721  ILEVMDRLLSLDVTDSAAMNAGSLVVTVFTHFENEIKPYMKQILSGTTKRLIQAKNISTI 780
            I+ ++D LLS  V D AA + GSL VT+F+ F NEI+  +  IL     RL QA NI+T 
Sbjct: 716  IVNILDALLSPGVPDQAATHVGSLTVTIFSKFSNEIQNLIPMILQAAAARLGQATNITTT 775

Query: 781  QNLISVICYLICSNTEDTINLLSRLG-TEGDILKLVLNKWISNFEIIRGERRIKQNILAL 839
            QNL+SV C++  ++ + T++ L     +  + L LV++KW+ +F+++RGE+R K+NI+ L
Sbjct: 776  QNLLSVFCFVTSADAQQTVDFLFNTTISNQNGLNLVMSKWLESFDVVRGEKRTKENIITL 835

Query: 840  NKLYCLNNSNIKHIMVDDELIPYDGDRIITRSMAKEMPDRYTQIPVYSKIIKLFIQELSE 899
            +KL+ LN+  +  + V+ +LIPY+ D IITRSMAKEMPDRYTQ+ VY KIIKLF  EL  
Sbjct: 836  SKLFFLNDQRLNSMQVNGDLIPYESDIIITRSMAKEMPDRYTQVSVYHKIIKLFTSELEF 895

Query: 900  QMKQPEHNLKIEET--VET-IGDGNXXXXXXXXXXXXXXXXYEKLQEYV-DDEDDELHFG 955
            Q K  +  L +  T  +ET   +                  YE+LQ YV +DE D+    
Sbjct: 896  QGKHQDPQLLMAGTYGIETNTEENQDDDDNDDWEDVEGPLEYERLQHYVEEDETDDRGEE 955

Query: 956  EDEDDILGTMDIEIDVKELLIRILKENASKNVSDFDKIYTTLSEDEKRILSECLV 1010
             DE  +   +D    V +LL+   KE A+KN+S F  IY  LS++EK+ILSE L+
Sbjct: 956  LDEQCLADNLDSR-SVHQLLVDFFKEVAAKNISGFQSIYEQLSDNEKQILSENLL 1009

>SAKL0F00880g Chr6 (76850..79879) [3030 bp, 1009 aa] {ON} similar to
            uniprot|P53067 Saccharomyces cerevisiae YGL241W
          Length = 1009

 Score =  707 bits (1824), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 408/1022 (39%), Positives = 632/1022 (61%), Gaps = 25/1022 (2%)

Query: 1    MNIDIDSLIKQAQSPETSLREHAENSLLEWCEHDXXXXXXXXXXXXXXXTEILSSRQYSL 60
            M+ ++  L+ QAQS +   RE AE+SLL++   +                  L+SRQ+SL
Sbjct: 1    MDRNVAQLVIQAQSADKKEREAAESSLLQFSAQEPESMFLSLIDIACNSYP-LTSRQFSL 59

Query: 61   LALRKLITMYWSPGFESYHLTSNLNETVKAHVRHTILQLALDKNQDSKIRKSGSYCIVQV 120
            L LR+L+TMYWS GFESY     +    K+ VR ++L+L+LD +QD K + S SYC+VQ+
Sbjct: 60   LFLRRLVTMYWSAGFESYVGPPGVGSRGKSIVRESLLRLSLDDSQDIKTKNSSSYCVVQI 119

Query: 121  SAVDFPDLWPELLVTLYKSILETHSLEALSILNEIYDDIISEEMFFEEGIGLETMRVIFN 180
            SAVDFPD WP+LL+ +Y++I+E +SL A+S+L EI+DD++SEEMFF+ GIG +T++++  
Sbjct: 120  SAVDFPDEWPDLLIRIYEAIVEHYSLSAMSLLTEIFDDVVSEEMFFQGGIGWQTIQIVSQ 179

Query: 181  ILDDKTAPVETKIAAAKLFYPCLMQMSVVSPTSSLKRMNLVIDSLKEIISKWEQILQFPL 240
            +L   T+ VE+K AA  L++ C++Q+     TS+++R + + + +K+++  + Q+LQF  
Sbjct: 180  VLTSSTSSVESKSAALDLYHACVLQLQSPQATSTIERKHAIAEHIKQMLGLFIQLLQFYQ 239

Query: 241  EDALLISPEEAILEWKFRGSIYEGLAFVHSNFSKKILPMNFLNVFRKCSLQDLTPASTLY 300
                 I P   +L  K + SIYE L  + SNFSK+  P    N+ +   L+DL   S +Y
Sbjct: 240  SSQDEIQP--TLL--KLKASIYENLGMLKSNFSKQFFPEEEKNILKGLVLKDLNAISNIY 295

Query: 301  INMISG-DNIAFNALNKYIIHIFEYLSNISRANYERXXXXXXXXXXYKLCCLDNLIVETW 359
               ++  D+   ++L++  IHI  +LS++    +             K+CCL +     W
Sbjct: 296  YRSLNNTDDKDIDSLDECAIHIIVFLSSLHELVFSPTETPVLLDSLTKVCCLTDTQTSDW 355

Query: 360  NSNFNEFVSKEFGLMASYSLRDQISDFLISLSSNNFNIIFKEFITNLNNCLIIEDWRQLE 419
            ++ FN FV+KE GL ASYS RD+   F  +L+  N+  +   F+T   +   IEDW+  E
Sbjct: 356  DNYFNIFVTKETGLAASYSARDESFQFFSNLTGTNYTNLLA-FLTQNVHASGIEDWKYQE 414

Query: 420  SMLYIFQSLLINDEDILNVANLNIENLLSSLAKNFHHYITNTILFSRLILLIPKILEKFM 479
            S++Y+ ++ + NDE+I N     ++ L  + ++      TN  +  R+IL++PKILEKFM
Sbjct: 415  SLMYLMEAAVNNDEEITNDFQPVLQTL-DAFSELLASCETNEFVKVRVILILPKILEKFM 473

Query: 480  DDIENIKLITCEFLKQSLAIGLDNYNALIKSSCLLMVNSYCSFAELLTVLGDKTCQEVXX 539
            D +E+IKL+  +FL Q+  +       ++K + L+    Y SFAEL +VLG +T Q++  
Sbjct: 474  DSLEDIKLLVKKFLFQTFTLVSAPTKDILKVASLISFTYYSSFAELDSVLGTETYQQLKE 533

Query: 540  XXXXXXXXXXDDSEDDTYGMIMEVINNLIDCNLPNDKLGEIPQQEFNLILSITSRDPSNV 599
                      +D+EDDT  +++E +N +I      + +  +   E  LIL I+++DPSN+
Sbjct: 534  AVLKIINEIYEDAEDDTPALLLETLNQIIGSTSNAEVIASVRFDELQLILKISAKDPSNI 593

Query: 600  QMTVESQECLKKLLEGLNTFEYSHYIEMCFPSMVKVLIGSSVTQYKYSALLSLALEFITI 659
            Q+ +E+QECL+ LL+ ++   Y  Y EM  PS V VL GS+ + ++YS +LSL+LE +T+
Sbjct: 594  QVVLEAQECLQNLLKNISLEIYLKYAEMAIPSFVNVLEGSNSSGFEYSPILSLSLELLTV 653

Query: 660  FMKKKPNDGYLPLEICKFIFNPLKDVLLVSNEDETLQLSSDAFSYLIYNTDPIVMVESLP 719
            FMKKKP +G LP  I  F+F PL + L+ S +DE LQL++D +S+LI N++   +   L 
Sbjct: 654  FMKKKPTNGTLPPRITDFVFQPLSETLVGSQDDEVLQLTTDIYSFLINNSENSQIAPHLN 713

Query: 720  GILEVMDRLLSLDVTDSAAMNAGSLVVTVFTHFENEIKPYMKQILSGTTKRLIQAKNIST 779
             IL V+++LLS++ +DSAAMN GSL++ +F    ++++  +  IL    KRL+Q  NI+T
Sbjct: 714  TILSVLEKLLSINTSDSAAMNVGSLIIAIFCKLSDQLQETIPTILEAAAKRLVQVHNIAT 773

Query: 780  IQNLISVICYLICSNTEDTINLLSR--LGTEGD-ILKLVLNKWISNFEIIRGERRIKQNI 836
             +NLI V CYL  +N   T++ LS   L +EG+  LKL+L KW+ +FEIIRGE+RIK+NI
Sbjct: 774  AENLIFVFCYLTSTNPNQTVDFLSSLVLDSEGNSALKLILPKWLESFEIIRGEKRIKENI 833

Query: 837  LALNKLYCLNNSNIKHIMVDDELIPYDGDRIITRSMAKEMPDRYTQIPVYSKIIKLFIQE 896
            LAL+KL+ LN+  I  I+V+ + IPYDGD +ITRSM+K MP++YTQI  Y KI+KLF+ E
Sbjct: 834  LALSKLFFLNDERISSIIVNGDSIPYDGDLVITRSMSKIMPEKYTQISAYEKIVKLFVAE 893

Query: 897  LSEQMKQP------EHNLKI--EETVETIGDGNXXXXXXXXXXXXXXXXYEKLQEYVDDE 948
            LS Q  QP       H+LK   ++ ++   D N                YEKLQEYVDDE
Sbjct: 894  LSFQGNQPGLEKYIPHDLKKYDDQAIKAANDAN----DDDWEDVDDVLEYEKLQEYVDDE 949

Query: 949  DDELHFGEDEDDILGTMDIEIDVKELLIRILKENASKNVSDFDKIYTTLSEDEKRILSEC 1008
             D     ++E D++G  ++    +ELLI+  +E A+KNVS F +IY  L+++EKR+L+E 
Sbjct: 950  SDLED--DEEGDVIGVQELHQSTRELLIQFFREAAAKNVSGFQEIYNHLNDNEKRVLTEN 1007

Query: 1009 LV 1010
            LV
Sbjct: 1008 LV 1009

>CAGL0H07777g Chr8 (757134..760199) [3066 bp, 1021 aa] {ON} similar to
            uniprot|P53067 Saccharomyces cerevisiae YGL241w KAP114
          Length = 1021

 Score =  669 bits (1727), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 396/1024 (38%), Positives = 609/1024 (59%), Gaps = 32/1024 (3%)

Query: 8    LIKQAQSPETSLREHAENSLLEWCEHDXXXXXXXXXXXXXXXTEILSSRQYSLLALRKLI 67
            LI+QAQSP+ ++RE AE  LL  C+ +                  L+SR +SLL+LRK I
Sbjct: 9    LIEQAQSPDNAVREGAETQLLNACDTNADEVFQSLIELGENNQTPLASRLFSLLSLRKFI 68

Query: 68   TMYWSPGFESYHLTSNLNETVKAHVRHTILQLALDKNQDSKIRKSGSYCIVQVSAVDFPD 127
            TMYWSPGFESY  TSN+    K  +R  +L+L+LD  Q +K+R S SYC+VQ+SAVDFPD
Sbjct: 69   TMYWSPGFESYRGTSNVQLGTKERIRDVLLKLSLDDQQSNKVRNSSSYCVVQISAVDFPD 128

Query: 128  LWPELLVTLYKSILETHSLEALSILNEIYDDIISEEMFFEEGIGLETMRVIFNILDDKTA 187
             WP+LL TLY +I + HSL A+S+LNEIYDD+ISEEMFFE GIG ET+++IF +L +   
Sbjct: 129  EWPQLLSTLYNAITQNHSLNAMSLLNEIYDDVISEEMFFEGGIGYETLQIIFTLLTNAQV 188

Query: 188  PVETKIAAAKLFYPCLMQMSVVSPTSSLKRMNLVIDSLKEIISKWEQILQFPLEDALLIS 247
             + +K +A KLF  C+ QMSV+   SS KR  LV + L + +    Q ++  LE   +I 
Sbjct: 189  RLASKTSALKLFGACISQMSVLDNNSSQKRKLLVSECLGQAL----QTIKLLLEQCEIIQ 244

Query: 248  PEEAILE--WKFRGSIYEGLAFVHSNFSKKILPMNFLNVFRKCSLQDLTPASTLYINMIS 305
             +   +    +F+ ++Y+ +  +  NF +K  P +        +++DL   + LY     
Sbjct: 245  SDLTSINETLEFKDNLYDDINSIKENFPRKFFPEDVNLYVTNIAVRDLDQLAGLYQESFK 304

Query: 306  G--DNIAFNALNKYIIHIFEYLSN-ISRANYERXXXXXXXXXXYKLCCLDNLIVETWNSN 362
               D  + +     +IH+ ++L+N IS  N E             LC    L  ++W S+
Sbjct: 305  DNFDEQSMSIFENCVIHLLDFLANPISPLNNE--LISNILTASITLCEQSALTKDSWESD 362

Query: 363  FNEFVSKEFGLMASYSLRDQISDFLISLSSNNFNIIFKEFITNLNNCLIIEDWRQLESML 422
            FNEF SKE GL AS+++RD++++ + +         F+  +  L+N        ++ES L
Sbjct: 363  FNEFASKETGLSASFTIRDEVAELVNAFEIPQLETSFELIVGYLSNNSSHLSADKIESAL 422

Query: 423  YIFQSLLINDEDILNVANLN--IENLLSSLAKNFHHYITNTILFSRLILLIPKILEKFMD 480
            Y+ Q L+  ++D  N + +   IE + S L++  +    + I   RL+LLIPK L KFMD
Sbjct: 423  YLLQCLMNVEDDFSNTSLVPSLIEFIKSMLSQQNNLDQMSQI---RLLLLIPKTLAKFMD 479

Query: 481  DIENIKLITCEFLKQSLAIGLDNYNALIKSSCLLMVNSYCSFAELLTVLGDKTCQEVXXX 540
             + N+K +T E L + L++  ++ + LI  S L+    + S+AE+L+VLG+     V   
Sbjct: 480  ILPNVKQLTAETLNEILSMATNSNSHLIIISALISFTYFASYAEILSVLGNDQTLLVQNK 539

Query: 541  XXXXXXXXXDDSEDDTYGMIMEVINNLIDCNLPNDKLGEIPQQEFNLILSITSRDPSNVQ 600
                     ++S +DT G++MEV+N +IDCN  N    E+ + EF LIL I+ +DP+N+Q
Sbjct: 540  TLHLIQEISEESTEDTNGLLMEVLNCVIDCNDKNVANMELFKFEFKLILVISGKDPANIQ 599

Query: 601  MTVESQECLKKLLEGLNTFEYSHYIEMCFPSMVKVLIGSSVTQYKYSALLSLALEFITIF 660
            +++ESQECL+KLL  +NT +Y  ++++C PS + ++  S VT Y YS LLSL LEFIT+F
Sbjct: 600  VSIESQECLEKLLLNVNTNDYLSFVDICIPSFINIIKSSEVTNYSYSPLLSLVLEFITVF 659

Query: 661  MKKKPNDGYLPLEICKFIFNPLKDVLLVSNEDETLQLSSDAFSYLIYNTDPIVMVESLPG 720
            MK KP +  LP  + +++F+PL   LL S E+E LQ++++AFSY+I+N+   V+   L  
Sbjct: 660  MKNKPQEALLPSSVSEYVFDPLVSCLLKSTEEELLQIATEAFSYMIHNSSKDVITPKLET 719

Query: 721  ILEVMDRLLSLDVTDSAAMNAGSLVVTVFTHFENEIKPYMKQILSGTTKRLIQAKNISTI 780
            I+ ++DRLLS +++DSAAMN G+L++ + T +   + P +  I+S   ++L+ + NI+T 
Sbjct: 720  IVNILDRLLSSNISDSAAMNVGTLILALITEYSEPMNPLLPSIISAAVRKLVVSNNITTQ 779

Query: 781  QNLISVICYLICSNTEDTINLLSRLGTEGD-----ILKLVLNKWISNFEIIRGERRIKQN 835
            QNL++++C+L+C + + T++ L  L  + D      L +++ KW+  F ++RGE RIK+N
Sbjct: 780  QNLVTLLCFLVCHDPKQTVDFLCELTIKNDKGEQVALPVIIQKWLDTFAVVRGENRIKEN 839

Query: 836  ILALNKLYCLNNSNIKHIMVDDELIPYDGDRIITRSMAKEMPDRYTQIPVYSKIIKLFIQ 895
            I+AL++L+ L +  +  + V+ E+IPYDGD IITRSMAK MPDRYT +    KI+K+F+ 
Sbjct: 840  IVALSQLFLLGDDRVNEVKVNGEIIPYDGDLIITRSMAKSMPDRYTTVSAPEKIVKMFLG 899

Query: 896  ELSEQM--KQPEHNLKIEETVETIG-----DGNXXXXXXXXXXXXXXXXYEKLQEYVDDE 948
            EL  Q   K PE  L  ++ ++ +G       N                YEKLQEY+DDE
Sbjct: 900  ELGFQGRNKNPEELLTTDD-MKGMGLKPNQQSNNDEGDDDWEDVDDVVDYEKLQEYIDDE 958

Query: 949  DDEL--HFGEDEDDILGTMDIEIDVKELLIRILKENASKNVSDFDKIYTTLSEDEKRILS 1006
            DD      GE E  I G   I   + ELL       A KNV+ F +IY  LSE+E++ +S
Sbjct: 959  DDLDDNSVGELE-TITGQQHIPQSIPELLKDFFNTAAQKNVAGFQEIYNNLSEEERKCIS 1017

Query: 1007 ECLV 1010
            E ++
Sbjct: 1018 ELIL 1021

>Kwal_47.19258 s47 complement(1156969..1160004) [3036 bp, 1011 aa]
            {ON} YGL241W (KAP114) - Kap114p [contig 344] FULL
          Length = 1011

 Score =  640 bits (1650), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/1025 (36%), Positives = 580/1025 (56%), Gaps = 29/1025 (2%)

Query: 1    MNIDIDSLIKQAQSPETSLREHAENSLLEWCEHDXXXXXXXXXXXXXXXTEILSSRQYSL 60
            M+  ++  I  AQSP+   RE  E  + + C  D                  + +R +SL
Sbjct: 1    MSAQLEEAIASAQSPDKQTREQGEACIWKLCSEDPSFSCACLVQLACRQDYRIENRLFSL 60

Query: 61   LALRKLITMYWSPGFESYHLTSNLNETVKAHVRHTILQLALDKNQDSKIRKSGSYCIVQV 120
            L+LRKLITMYWS GFESY     +NE  K  +R+++L+L LD  QD++I+K  SYCIVQ+
Sbjct: 61   LSLRKLITMYWSAGFESYRGPPGVNEDCKELIRNSLLELGLDDAQDTRIQKGSSYCIVQI 120

Query: 121  SAVDFPDLWPELLVTLYKSILETHSLEALSILNEIYDDIISEEMFFEEGIGLETMRVIFN 180
            +AVDFPD WP L+  +Y +IL +HS+ AL +LNEI+DD++SEEMFF +G+G +T+++I N
Sbjct: 121  AAVDFPDEWPGLIEIVYNAILRSHSVSALYVLNEIFDDVVSEEMFFNQGVGWQTIQLISN 180

Query: 181  ILDDKTAPVETKIAAAKLFYPCLMQMSVVSPTSSLKRMNLVIDSLKEIISKWEQILQFPL 240
            IL+D    +  K +AAKL+  CL+Q+   + +S+ +  + + + ++E       +LQ   
Sbjct: 181  ILNDPGCSILAKHSAAKLYQACLLQLQSPAASSTPELRSALTNHIQESTKMLLNLLQ--- 237

Query: 241  EDALLISPEEAILEWKFRGSIYEGLAFVHSNFSKKILPMNFLNVFRKCSLQDLTPASTLY 300
              A     +EAI   +   ++ + L  + + F KK+             +++ T  + L 
Sbjct: 238  --AYSNIQDEAIDLLRLHQTVLKCLTTIRTGFPKKLSSDTIGRELTTVLIENFTRVAAL- 294

Query: 301  INMISGDNI---AFNALNKYIIHIFEYLSNISRANYERXXXXXXXXXXYKLCCLDNLIVE 357
                S DN      + +N+  I +   L+ I                     CL     E
Sbjct: 295  ----SNDNTEEEKSSEINEVGIQMVSLLATIPDRYLGGPALSKVVEDFVLASCLGTEEEE 350

Query: 358  TWNSNFNEFVSKEFGLMASYSLRDQISDFLISLSSNNFNIIFKEFITNLNNCLIIEDWRQ 417
             W S+FN FVSKE GL +SY +RD+ S FL  +S   +  IF+  ++ L+    +E WR 
Sbjct: 351  AWESDFNHFVSKEVGLASSYYIRDECSQFLQEISGARYQSIFEILVSALSKVDPLE-WRL 409

Query: 418  LESMLYIFQSLLINDEDILNVANLNIENLLSSLAKNFHHYITNTILFSRLILLIPKILEK 477
             E++ Y+ QSL IN++++    N  + +LL+ L +N         + +R IL +PK++EK
Sbjct: 410  KEAVFYLIQSLCINEDEVTVFNNNEVFDLLNELRQNMEGQNLQLHVRTRAILALPKVVEK 469

Query: 478  FMDDIENIKLITCEFLKQSLAIGLDNYNALIKSSCLLMVNSYCSFAELLTVLGDKTCQEV 537
            FMD +EN+K I  E L  +L    ++ +  +K+S L+  +SY SFAEL +VLG +  QE 
Sbjct: 470  FMDRLENVKDIVKELLFATLNGACEDNDPTLKASALIAFSSYASFAELDSVLGLEAFQEA 529

Query: 538  XXXXXXXXXXXXDDSEDDTYGMIMEVINNLI--DCNLPNDKLGEIPQQEFNLILSITSRD 595
                        +DSEDDT  +++E +N  +    N   D L    QQ  NL+L I+++D
Sbjct: 530  RCLVLNLIQDVLEDSEDDTPAVLLEALNPALAKQSNTTKDTL--FYQQALNLVLKISAKD 587

Query: 596  PSNVQMTVESQECLKKLLEGLNTFEYSHYIEMCFPSMVKVLIGSSVTQYKYSALLSLALE 655
            PSN+Q+ +E+Q+C+  LL G +T  Y    + C P  V +L       Y Y+ ++SL+LE
Sbjct: 588  PSNLQVVLEAQDCISALLSGESTESYVELSKSCIPLFVNILGTMKANNYIYAPIVSLSLE 647

Query: 656  FITIFMKKKPNDGYLPLEICKFIFNPLKDVLLVSNEDETLQLSSDAFSYLIYNTDPIVMV 715
             +T+FMKKKP+DG+LP  I  ++F PL D+L+ S++DE LQ++SDA +YL+ N+    + 
Sbjct: 648  LLTVFMKKKPSDGFLPSNISSYVFEPLSDILINSSDDEILQVASDALTYLMSNSQASDLE 707

Query: 716  ESLPGILEVMDRLLSLDVTDSAAMNAGSLVVTVFTHFENEIKPYMKQILSGTTKRLIQAK 775
              LP +L ++++LLS++ +DS AMN GSLVV     +  +++    +IL   TKR + AK
Sbjct: 708  PLLPTVLSILEKLLSVNTSDSGAMNVGSLVVITLEKYSYQLQEVYPKILEAATKRFVSAK 767

Query: 776  NISTIQNLISVICYLICSNTEDTINLLSRLG---TEGDILKLVLNKWISNFEIIRGERRI 832
            N++T +NL+ V CYL   N  + IN LS       EG+ L  VL KW+ +FE++RGERRI
Sbjct: 768  NVATTENLVFVFCYLTSINPAEAINFLSSFTINEKEGNSLNYVLPKWLESFEVLRGERRI 827

Query: 833  KQNILALNKLYCLNNSNIKHIMVDDELIPYDGDRIITRSMAKEMPDRYTQIPVYSKIIKL 892
            K+NI+AL+K++  ++  +  ++V+ + +PY GD I+TRSMAK+MP  YT+I  + KI+KL
Sbjct: 828  KENIVALSKIFFQSDPRVGSVIVNGDPLPYKGDIIVTRSMAKKMPIEYTRITAHEKIVKL 887

Query: 893  FIQELSEQMKQPE-------HNLKIEETVETIGDGNXXXXXXXXXXXXXXXXYEKLQEYV 945
            F+ EL  Q  QP        +  K + +     +                  Y++LQ++V
Sbjct: 888  FVAELEFQSSQPSLDKFLPVNARKFDTSSSFNNNAEDEQDDGEWEDVDDVLEYDQLQQFV 947

Query: 946  DDEDDELHFGEDEDDILGTMDIEIDVKELLIRILKENASKNVSDFDKIYTTLSEDEKRIL 1005
              ED E +  +DED +    DI+   KELLI   KE A+KN+++   +Y  LSE EK+IL
Sbjct: 948  -VEDGERNDSDDEDSLANIQDIQQSTKELLIDFFKEAAAKNINNLRDLYENLSEHEKKIL 1006

Query: 1006 SECLV 1010
            SE L+
Sbjct: 1007 SENLM 1011

>Ecym_2594 Chr2 complement(1155746..1158805) [3060 bp, 1019 aa] {ON}
            similar to Ashbya gossypii AFR269W
          Length = 1019

 Score =  616 bits (1589), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 362/1022 (35%), Positives = 583/1022 (57%), Gaps = 37/1022 (3%)

Query: 3    IDIDSLIKQAQSPETSLREHAENSLLEWCEHDXXXXXXXXXXXXXXXTEILSSRQYSLLA 62
            +D+  LI  AQSP    RE AE +LL  C  D               +  ++S+Q+ L++
Sbjct: 13   MDLSELILHAQSPVKDQRESAETALLSLCSSDPGSVFVSLINIASDPSAEVASKQFCLVS 72

Query: 63   LRKLITMYWSPGFESYHLTSNLNETVKAHVRHTILQLALDKNQDSKIRKSGSYCIVQVSA 122
            +RKLITMYW+ GFESY     +NE  K  VR  +L+L L  +Q+SKI  + SYCIVQ++A
Sbjct: 73   IRKLITMYWNAGFESYCGPPGVNEGAKEVVRENLLKLVLGDSQNSKIVSASSYCIVQIAA 132

Query: 123  VDFPDLWPELLVTLYKSILETHSLEALSILNEIYDDIISEEMFFEEGIGLETMRVIFNIL 182
            VDFPD WP LL T+Y +I   +S  ALS+L+EI+DD++SEEMFF+ GIG +T++++F++L
Sbjct: 133  VDFPDEWPSLLDTVYDAITYDYSANALSLLHEIFDDVVSEEMFFQGGIGWKTVQIVFSLL 192

Query: 183  DDKTAPVETKIAAAKLFYPCLMQMSVVSPTSSLKRMNLVIDSLKEIISKWEQILQFPLED 242
             + ++    K AA KL++ CL+Q+       S +  + +   + E +  + Q+L     +
Sbjct: 193  SNTSSSFGIKDAAMKLYHSCLLQLLSPHALESDENRSQIAQHVNETLHIFLQLLG----N 248

Query: 243  ALLISPEEAILEWKFRGSIYEGLAFVHSNFSKKILPMNFLNVFRKCSLQDLTPASTLYIN 302
              L  P   +L+ K     YE L  + + F KK+ P +    F+  +L+DL      Y  
Sbjct: 249  HNLADPSNELLDLK--AHTYENLTLLKTQFPKKLFPDDLKGSFKTVALKDLDTLGKYYSQ 306

Query: 303  MISG-DNIAFNALNKYIIHIFEYLSNISRANYERXXXXXXXXXXYKLCCLDNLIVETWNS 361
            +++  D     ++++  I+I  +LS++     E            +LC L     +   +
Sbjct: 307  ILASVDEALLQSVDESAINIIGFLSSLHECELEGPEVNNLLESLVQLCSLPMHQADDLTN 366

Query: 362  NFNEFVSKEFGLMASYSLRDQISDFLISLSSNNFNIIFKEFITNLNNCLIIEDWRQLESM 421
            + N FVSKE G+   Y++RD++  FL  +   N+  IF+  +    + + + DW + ESM
Sbjct: 367  DLNSFVSKETGVSGVYTIRDEVFQFLSDMIGTNYRNIFQTLLEQAGSVMHL-DWEKQESM 425

Query: 422  LYIFQSLLINDEDI-LNVANL-----NIENLLSSLAKNFHHYITNTILFSRLILLIPKIL 475
            LY+ QS   N E+  +N   L      ++N+L S  +N H      +++SRL + I KIL
Sbjct: 426  LYLLQSCQGNTEEFEVNSQGLVELLLRLQNILES--QNIH-----CLVWSRLSITIAKIL 478

Query: 476  EKFMDDIENIKLITCEFLKQSLAIGLDNYNALIKSSCLLMVNSYCSFAELLTVLGDKTCQ 535
            EKF+  +ENIKLI  EF+ ++L I   + N+ +K+  L+    Y SF  L +VLG + C+
Sbjct: 479  EKFVCKLENIKLIVKEFIFKTLTIASSSPNSTMKAGSLISYKCYSSFVALGSVLGVEDCE 538

Query: 536  EVXXXXXXXXXXXXDDSEDDTYGMIMEVINNLIDCNLPNDKLGEIPQQEFNLILSITSRD 595
            ++             + +DDT G ++EV++ +I  N P      +   E   +L +++ D
Sbjct: 539  KLERQVLDIINDIYAEVDDDTPGFLLEVLSGVIASN-PESTNKSLKASELEFVLKLSTSD 597

Query: 596  PSNVQMTVESQECLKKLLEGLNTFEYSHYIEMCFPSMVKVLIGSSVTQYKYSALLSLALE 655
            P +VQ+ VE+Q+CL  LL+ + + +Y +Y E+C PS V VL       + Y+ L+SL+LE
Sbjct: 598  PYSVQVVVEAQDCLSSLLQKVRSDDYIYYAELCIPSFVSVLRADGTHGFAYTPLVSLSLE 657

Query: 656  FITIFMKKKPNDGYLPLEICKFIFNPLKDVLLVSNEDETLQLSSDAFSYLIYNTDPIVMV 715
             +T+F+KK P+DG+LP  + +++F PL  +++ S +DE LQLS++AF++L+ N+    + 
Sbjct: 658  LLTVFLKKNPSDGFLPQSVVEYVFEPLTSLIMSSEDDELLQLSTEAFAFLLANSKKDDIS 717

Query: 716  ESLPGILEVMDRLLSLDVTDSAAMNAGSLVVTVFTHFENEIKPYMKQILSGTTKRLIQAK 775
              L   + +++RLL+ D + SA+   GSL+++V T F ++I+  M ++L    +RL+Q  
Sbjct: 718  SHLQTAIMILERLLASDTSYSASSKVGSLLLSVLTKFADQIQDIMPKLLEAAARRLVQVN 777

Query: 776  NISTIQNLISVICYLICSNTEDTINLLSRLGTEGD---ILKLVLNKWISNFEIIRGERRI 832
            NI T++NLI V C+L   + + T++ LS L  + D    L+L++ KW+ +FEIIRGE++I
Sbjct: 778  NIHTVENLILVFCHLTSVDVKQTVDFLSSLILDSDGHSALQLIIPKWLDSFEIIRGEKKI 837

Query: 833  KQNILALNKLYCLNNSNIKHIMVDDELIPYDGDRIITRSMAKEMPDRYTQIPVYSKIIKL 892
            K+NI+AL+KL+ LN+S + +I+V+ +LIPYDGD IITRSMAK +PD+YT+I  Y KIIKL
Sbjct: 838  KENIVALSKLFFLNDSRVANILVNGDLIPYDGDLIITRSMAKSLPDKYTRISAYEKIIKL 897

Query: 893  FIQELSEQMKQPEHNLKIEETVETIGDGNX--------XXXXXXXXXXXXXXXYEKLQEY 944
             + EL  Q  QP+ +  +    E +   N                        YEKLQEY
Sbjct: 898  MVTELMFQYNQPDPDKYMSSQSEKLTKTNQDNKSNSGNADHDDDWEDIDDVLEYEKLQEY 957

Query: 945  VDDEDDELHFGEDEDDILGTMDIEIDVKELLIRILKENASKNVSDFDKIYTTLSEDEKRI 1004
            ++  D +    +    +L   +I+    ELL +  KE   K++S F  IYT L+E EKR 
Sbjct: 958  IEGSDIDDDDDD----LLIMNNIQETTSELLSQFFKEAVIKDISGFKDIYTRLNEQEKRC 1013

Query: 1005 LS 1006
            LS
Sbjct: 1014 LS 1015

>AFR269W Chr6 (916446..919499) [3054 bp, 1017 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YGL241W (KAP114)
          Length = 1017

 Score =  604 bits (1557), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 364/1018 (35%), Positives = 561/1018 (55%), Gaps = 27/1018 (2%)

Query: 2    NIDIDSLIKQAQSPETSLREHAENSLLEWCEHDXXXXXXXXXXXXXXXTEILSSRQYSLL 61
             +D+  L+  AQS     RE AE SLLE C  D                  L+SRQ+ L 
Sbjct: 18   KMDLRQLVLAAQSAGKIERESAEQSLLEACRADPAAVCVGLVKMATQENTELASRQFCLY 77

Query: 62   ALRKLITMYWSPGFESYHLTSNLNETVKAHVRHTILQLALDKNQDSKIRKSGSYCIVQVS 121
             LRKLITMYW+ GFESY     + E  K  VR  +L++A+ + QDSKI  + +YC+VQ++
Sbjct: 78   TLRKLITMYWNAGFESYCGPPGVREDAKETVRDALLRMAVSRTQDSKIISASAYCVVQIA 137

Query: 122  AVDFPDLWPELLVTLYKSILETHSLEALSILNEIYDDIISEEMFFEEGIGLETMRVIFNI 181
            A DFPD WP LL ++Y+SI    SL AL +L+EI+DD++SEEMFF+ G+G +T+R+IF +
Sbjct: 138  AFDFPDEWPGLLKSVYESITGERSLAALGLLHEIFDDVVSEEMFFQGGVGWQTIRIIFEL 197

Query: 182  LDDKTAPVETKIAAAKLFYPCLMQMSVVSPTSSLKRMNLVIDSLKEIISKWEQILQFPLE 241
            L D   PV  K AA KL++ CL+Q++             V   + E +  + Q+L    E
Sbjct: 198  LGDD-GPVALKDAAMKLYHSCLLQLAAPQALEEADTRAAVGAHVHEALELFAQLL----E 252

Query: 242  DALLISPEEAILEWKFRGSIYEGLAFVHSNFSKKILPMNFLNVFRKCSLQDLTPASTLY- 300
                + P   +L+  F+   YE L  + +   K+  P           L+DL      Y 
Sbjct: 253  HCRSLEPHADLLQ--FQAHTYENLVLIKTQLPKRFFPGALREALLDAVLRDLVLLGAYYE 310

Query: 301  INMISGDNIAFNALNKYIIHIFEYLSNISRANYERXXXXXXXXXXYKLCCLDNLIVETWN 360
             ++  GD     A+ +  IH+  +LS++                  +L CL  +  E W+
Sbjct: 311  QHLAEGDEELLKAVAESAIHMVIFLSSVHECKLNTERMCMLLGSLARLSCLSAIQTEAWD 370

Query: 361  SNFNEFVSKEFGLMASYSLRDQISDFLISLSSNNFNIIFKEFITNL-NNCLIIED--WRQ 417
             ++N F+SKE GL +SY+ RD+I  +L  L  +N+    +EF+  L    L +E   WR 
Sbjct: 371  VDYNSFISKETGLTSSYTPRDEIFQYLSDLGGHNY----REFLRVLFEQLLQVESMAWRS 426

Query: 418  LESMLYIFQSLLINDEDILNVANLNIENLLSSLAKNFHHYITNTILFSRLILLIPKILEK 477
             ES+L++ QS  +N E         +  LL    +       + ++  R+ + +P++LEK
Sbjct: 427  QESLLFLLQSCQLNSEGP-QFDEQTVAGLLEKSQRLLRSGDVHPLVRCRVAMTVPRLLEK 485

Query: 478  FMDDIENIKLITCEFLKQSLAIGLDNYNALIKSSCLLMVNSYCSFAELLTVLGDKTCQEV 537
            +MD + N+K +  EF+  +    + + N L+ +S L+    Y SF +  +VLG +T +E+
Sbjct: 486  YMDSLPNVKDLVREFVFLTFNTTVTSENQLLSASALIAFTYYSSFVDFGSVLGVQTAEEL 545

Query: 538  XXXXXXXXXXXXDDSEDDTYGMIMEVINNLIDCNLPNDKLGEIPQQEFNLILSITSRDPS 597
                        D  ++DT G ++EV++ +  CN    +  E+   E  L+ ++ + DPS
Sbjct: 546  EKLVLSTIKNILDGIDEDTPGFLLEVLSGVTGCN-KESRNRELKLYELQLVQNVATADPS 604

Query: 598  NVQMTVESQECLKKLLEGLNTFEYSHYIEMCFPSMVKVLIGSSVTQYKYSALLSLALEFI 657
            N+Q+ VE+QECLK LL+  +   Y  Y E+C PS ++VL   S   Y Y+ L+SL+LE +
Sbjct: 605  NIQVVVEAQECLKNLLQ-YDPENYLQYAELCIPSFLEVLRADSSHGYAYTPLVSLSLELL 663

Query: 658  TIFMKKKPNDGYLPLEICKFIFNPLKDVLLVSNEDETLQLSSDAFSYLIYNTDPIVMVES 717
             +FM+KKP D  LP  +  +IF+PL  +LL + +DE LQLS++AF+ L+ ++    ++  
Sbjct: 664  VVFMRKKPVDSALPRSMVDYIFDPLSSMLLNAEDDELLQLSTEAFTALLASSLTDDLLGR 723

Query: 718  LPGILEVMDRLLSLDVTDSAAMNAGSLVVTVFTHFENEIKPYMKQILSGTTKRLIQAKNI 777
            +P I+ ++++LLS   + SAA+NAG+L++ V T F N+I+  M +IL    KRL+Q KN+
Sbjct: 724  IPVIITILEKLLSARTSHSAAINAGTLLIAVLTKFANQIQDIMPKILEAAAKRLVQIKNL 783

Query: 778  STIQNLISVICYLICSNTEDTINLLSR-LGTEGD--ILKLVLNKWISNFEIIRGERRIKQ 834
             T +NL+ V CYL   +   T++ LS  +  EG    L+ ++ +W+  FE++RGE +IK+
Sbjct: 784  HTAENLLFVFCYLTSIDARQTVDFLSSTIIDEGGRTALQAIVPRWLEAFEVLRGEHKIKE 843

Query: 835  NILALNKLYCLNNSNIKHIMVDDELIPYDGDRIITRSMAKEMPDRYTQIPVYSKIIKLFI 894
            NIL+L+KL+ L +  I  I V+ +LIP+DGD IITRSMAK+MPD+YTQI    KI+KLF+
Sbjct: 844  NILSLSKLFFLEDPRIAGITVNGDLIPHDGDIIITRSMAKKMPDKYTQISAAEKIVKLFV 903

Query: 895  QELSEQMKQPEHNL--KIEETVETIGDGNXXXXXXXXXXXXXXXXYEKLQEYVDDEDDEL 952
             EL+ Q  QP+     K         D                  YEKLQEY DD D + 
Sbjct: 904  AELAFQQNQPDPGRYPKDGSGPADPHDSEGDSADEDWEDVDDILDYEKLQEYADDSDIDD 963

Query: 953  HFGEDEDDILGTMDIEIDVKELLIRILKENASKNVSDFDKIYTTLSEDEKRILSECLV 1010
                  D +L T +IE D   LL +  KE  ++N S F +IY+ L+E EK+ LS C+V
Sbjct: 964  T----GDSLLFTSNIEEDATTLLTQFFKEAVARNASGFQEIYSRLTEQEKKSLSACMV 1017

>KLTH0G00792g Chr7 (53588..56653) [3066 bp, 1021 aa] {ON} similar to
            uniprot|P53067 Saccharomyces cerevisiae YGL241W
          Length = 1021

 Score =  582 bits (1500), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/1018 (34%), Positives = 564/1018 (55%), Gaps = 32/1018 (3%)

Query: 9    IKQAQSPETSLREHAENSLLEWCEHDXXXXXXXXXXXXXXXTEILSSRQYSLLALRKLIT 68
            I  AQS    +RE++EN+L   C  +                  +  R +SLL+LRKLIT
Sbjct: 20   IVGAQSTNGQVRENSENALWSLCSENPSATCTSLMQLACGIENAVEDRIFSLLSLRKLIT 79

Query: 69   MYWSPGFESYHLTSNLNETVKAHVRHTILQLALDKNQDSKIRKSGSYCIVQVSAVDFPDL 128
            MYWS GFESY     + +  K  +R ++L L LD +QD++++   SYCIVQ++AVDFPD 
Sbjct: 80   MYWSAGFESYRGPPGIGDEGKRMIRESLLNLGLDDSQDTRLKNCSSYCIVQIAAVDFPDE 139

Query: 129  WPELLVTLYKSILETHSLEALSILNEIYDDIISEEMFFEEGIGLETMRVIFNILDDKTAP 188
            WP L+ +++ +IL+  SL AL +LNEI+DD++SEEMFF  GIG +T+++IF IL +  + 
Sbjct: 140  WPTLVDSIFDAILQRQSLSALYVLNEIFDDVVSEEMFFHRGIGWQTIQLIFRILSNSDSS 199

Query: 189  VETKIAAAKLFYPCLMQMSVVSPTSSLKRMNLVIDSLKEIISKWEQILQFPLEDALLISP 248
             + K A+AKL+  CL+Q+     TS+      + + ++E +    ++L+   E  +    
Sbjct: 200  TQAKTASAKLYQACLLQLQSPMATSTQDYKYALSNHIQESVLLLIKVLK---EHHIAKGI 256

Query: 249  EEAILEWKFRGSIYEGLAFVHSNFSKKILPMNFLNVFRKCSLQDLTPASTLYINM-ISGD 307
              + L    +  +   L  + + FSKK+  +       +   ++    + L I++ I  D
Sbjct: 257  NTSAL--NLQQVLLSCLNTIKTGFSKKLFTIESAQELIEFLFENFRKIAELCIDVTIDPD 314

Query: 308  -NIAFNALNKYIIHIFEYLSNISRANYERXXXXXXXXXXYKLCCLDNLIVETWNSNFNEF 366
              +A N +   ++ +F  L +    N               +   D    E W+++FN F
Sbjct: 315  MKLAANEVGIQMVSLFATLMDTLTENQNWNFIVESFVIAGMISDED---AECWDNDFNVF 371

Query: 367  VSKEFGLMASYSLRDQISDFLISLSSNNFNIIFKEFITNLNNCLIIED---WRQLESMLY 423
             SKE GL  S+++RD+   F+  LS   +N +F      L + LI  +   W+  ES+L+
Sbjct: 372  ASKETGLSTSFTVRDECEQFMQGLSGFAYNSVFNA----LTSALIYNESPNWKVQESILF 427

Query: 424  IFQSLLINDEDILNVANLNIENLLSSLAKNFHHYITNTILFSRLILLIPKILEKFMDDIE 483
              Q+L  N++D ++      ++LL++L +      ++ ++ +R ++ +PK++E+FM+ +E
Sbjct: 428  FIQALCGNEDDEVSFNFEKTQSLLNTLRQILELEDSHILVKTRSLIALPKVIERFMETLE 487

Query: 484  NIKLITCEFLKQSLAIGLDNYNALIKSSCLLMVNSYCSFAELLTVLGDKTCQEVXXXXXX 543
            ++K +  + L  S ++     +  +K  CL+    Y SFAEL +VLG     E       
Sbjct: 488  SVKALVKDSLFHSFSLARQTPSYTVKIGCLISFTYYASFAELDSVLGPGFYGEAQRSVSA 547

Query: 544  XXXXXXDDSEDDTYGMIMEVINNLIDCNLPNDKLGEIPQQEFNLILSITSRDPSNVQMTV 603
                  +++E+DT  +++E +   +  N    +     Q    LIL I+S+ PSN+Q+ +
Sbjct: 548  IIQELLEEAEEDTPSILLEALAPTLSSNHKTTETISFYQLALQLILKISSKHPSNIQVGL 607

Query: 604  ESQECLKKLLEGLNTFEYSHYIEMCFPSMVKVLIGSSVTQYKYSALLSLALEFITIFMKK 663
            E+Q+CL  LL+  +T EY  Y + C P    VL G    ++ Y+ ++ L+LE +T+F+K+
Sbjct: 608  EAQDCLSNLLKSTSTEEYVTYSKTCIPLFANVLNGMIENKFAYAPIVCLSLEMLTVFIKR 667

Query: 664  KPNDGYLPLEICKFIFNPLKDVLLVSNEDETLQLSSDAFSYLIYNTDPIVMVESLPGILE 723
            KP DG LP +I  ++FNPL D+L+ S++DE +QL+SDA  YLI N++P  +   L  +L 
Sbjct: 668  KPRDGCLPSDITSYVFNPLSDILINSSDDEIMQLTSDALVYLISNSEPHQLFPHLNVVLC 727

Query: 724  VMDRLLSLDVTDSAAMNAGSLVVTVFTHFENEIKPYMKQILSGTTKRLIQAKNISTIQNL 783
             +++LLS + +DS A++ G+LVV V   F  +++    +IL   TK+ + A N+ T +NL
Sbjct: 728  DLEKLLSAETSDSGAIHVGNLVVVVLEKFSKQLQEIYPRILEAATKKFLGAHNVFTTENL 787

Query: 784  ISVICYLICSNTEDTINLLSRLG---TEGDILKLVLNKWISNFEIIRGERRIKQNILALN 840
             +V CYL+  N  + IN LS       E  +L  VL+KW+ +FE++RGE+RIK+NI+AL+
Sbjct: 788  ANVFCYLVSLNPAEVINFLSSFSIDQQEQSVLCPVLSKWLESFEVLRGEKRIKENIMALS 847

Query: 841  KLYCLNNSNIKHIMVDDELIPYDGDRIITRSMAKEMPDRYTQIPVYSKIIKLFIQELSEQ 900
            KL+   +S I  I V+ + IPY GD IITRSMAK MP++YT+I  Y KI+KLF+ EL  Q
Sbjct: 848  KLFFQADSRIDKIYVNGDPIPYSGDMIITRSMAKSMPEKYTRITAYQKIVKLFVAELDFQ 907

Query: 901  MKQ-------PEHNLKIEETVETIGDGNXXXXXXXXXXXXXXXXYEKLQEYVDDEDDELH 953
              Q       P    K E    TI +                  YE+LQ +VD   D   
Sbjct: 908  TSQTDLEKYIPMSAKKTE--CSTIANAEAGQEESDWEDVDDVLEYEQLQHFVD--QDTFS 963

Query: 954  FGEDEDDIL-GTMDIEIDVKELLIRILKENASKNVSDFDKIYTTLSEDEKRILSECLV 1010
               DE+D++ G  +++   +ELLI   KE AS+N++DF  IY  LSE+EKRILSE LV
Sbjct: 964  SDRDEEDVIPGIKNVQQSTRELLISFFKEAASQNINDFKTIYDNLSENEKRILSENLV 1021

>KLLA0A00803g Chr1 (76350..79208) [2859 bp, 952 aa] {ON} similar to
            uniprot|P53067 Saccharomyces cerevisiae YGL241W KAP114
            Karyopherin, responsible for nuclear import of Spt15p,
            histones H2A and H2B, and Nap1p; amino terminus shows
            similarity to those of other importins, particularly
            Cse1p; localization is primarily nuclear
          Length = 952

 Score =  276 bits (707), Expect = 6e-78,   Method: Compositional matrix adjust.
 Identities = 275/1017 (27%), Positives = 473/1017 (46%), Gaps = 82/1017 (8%)

Query: 3    IDIDSLIKQAQSPETSLREHAENSLLEWCEHDXXXXXXXXXXXXXXXTEILSSRQYSLLA 62
            + I  L++  QSP+   RE AENSLLE C  D                   S+RQ +LL 
Sbjct: 1    MSIPYLLEGIQSPQKEEREDAENSLLERCATDPPDTFIELIDTATNNNASASTRQLALLC 60

Query: 63   LRKLITMYWSPGFESYHLTSNLNETVKAHVRHTILQLALDKNQDSKIRKSGSYCIVQVSA 122
            LRK  TMYWS GF S+     + E  K  VR  +L L  +++ + K+  + +YCIVQ+ A
Sbjct: 61   LRKFTTMYWSAGFPSFVGPPGVGEQGKDLVRRGLLSLLANEDTEKKVISTVTYCIVQICA 120

Query: 123  VDFPDLWPELLVTLYKSILETHSLEALSILNEIYDDIISEEMFFEEGIGLETMRVIFNIL 182
            VDFPD WP LL  L ++IL  HS  A+S+L E+  DII+ EMFF+   G + +  +   L
Sbjct: 121  VDFPDEWPGLLDYLNENILNYHSENAISLLTELVQDIITNEMFFDNHSGAKIVNTVLLAL 180

Query: 183  DDKTAPVETKIAAAKLFYPCLMQMSVVS--PTSSLKRMNLV--IDSLKEIISKWEQILQF 238
            +D T  ++ K    +L++ C+ Q+  VS   TS L    L+  + ++ + I K  +    
Sbjct: 181  NDDTLRLQAKSKLLQLYHHCISQLRNVSMFVTSELMSEWLIPHLKAMNDCIDKLLESYGN 240

Query: 239  PLEDALLISPEEAILEWKFRGSIYEGLAFVHSNFSKKILPMNFLNVFR-KCSLQDLTPAS 297
             +E  ++            +G ++  L+ +  + ++ IL  N    +R + +L  +   +
Sbjct: 241  NMESEVI----------GLKGELFMALSKLF-DLNQSILGSNGDLSYRLRITLDAIKSNA 289

Query: 298  TLYINMIS-GDNIAFNALNKYIIHIFEYLSNISRANYERXXXXXXXXXXYKLCCLDNLIV 356
              Y   ++  D +    +N   I+  +YL+ I     E            KLC L     
Sbjct: 290  NSYARALTNNDELRLEIINSSCINTVQYLAYIPSDLIENPTLPDFTEDFIKLCLLPEDYF 349

Query: 357  ETWNSNFNEFVSKEFGLMASYSLRDQISDFLISLSSNNFNIIFKEFITNLNNCLII--ED 414
            +   S+FNEF+SKE GL ASY+ RD+I  ++ S S   +  I       L  CL +   +
Sbjct: 350  KL--SDFNEFISKETGLSASYNARDEIGQYVSSCSDEIYRHITDSV---LQKCLQVTSNE 404

Query: 415  WRQLESMLYIFQSLLINDEDILNVANLNIENLLSSLAKNFHHYITNTILFSRLILLIPKI 474
             +  E+ L++FQ L  N E  +NV     ++ LS            T + SR IL IPK 
Sbjct: 405  AQYQEACLFLFQELCSN-ETSMNVPRY--QDFLSLAVMILDDDACPTFVKSRTILTIPKF 461

Query: 475  LEKFMDDIENIKLITCEFLKQSLAIGLDNYNALIKSSCLLMVNSYCSFAELLTVLGDKTC 534
             E  M+ +  IK +  +FL +++   +   +  + +S ++    Y SFAEL ++L  +T 
Sbjct: 462  FENNMETLPEIKQLVQQFLVKTVNCTISAEDDFLLASLVISFTYYTSFAELGSILDYQTS 521

Query: 535  QEVXXXXXXXXXXXXDDSEDDTYGMIMEVINNLIDCNLPNDKLGEIPQQEFNLILSITSR 594
              +             DSE+D+ G+++E ++ ++        L    Q+  NL+L ++S 
Sbjct: 522  MILQQSLLKAIKTLYVDSEEDSLGLLLEAMHEIVKTWHFQQDL-HTKQEILNLLLKLSSS 580

Query: 595  DPSNVQMTVESQECLKKLLEGLNTFEYSHYIEMCFPSMVKVLIGSSVTQYKYSALLSLAL 654
            +PSNV++  ES   L  LL  +N  +Y+   E CFPS ++ +     +Q  YS L+ LAL
Sbjct: 581  EPSNVRIVFESVRSLPYLLRDINCTDYTRLCESCFPSFIEAMSTFLQSQQTYSPLVVLAL 640

Query: 655  EFITIFMKKKPNDGYLPLEICKFIFNPLKDVLLVSNEDETLQLSSDAFSYLIYNTDPIVM 714
            EF+++F+K  P   ++  E+ +++ NP+   +    ++   + +  AF YL  N++P   
Sbjct: 641  EFLSVFLKNPPVGNHISDEVAEYVLNPIVQFIKQCPDENIAETALQAFVYLACNSNPKFW 700

Query: 715  VESLPGILE-VMDRLLSLDVT-DSAAMNAGSLVVTVFTHFENEIKPYMKQILSGTTKRLI 772
             +S+  +   V D   SL  T D A +   SL VT     EN    ++ QI+  T  +L+
Sbjct: 701  KDSMFDLCSLVFDPERSLYKTIDVAPIMLLSLRVT--QPHENR---FIGQIMEYTISKLV 755

Query: 773  QAKNISTIQNLISVICYLICSNTEDTINLLSR--LGTEGDILKLVLNKWISNFEIIRGER 830
                +  + + I + C +I  + +  +  +    +  E  I   ++ +    FE  R + 
Sbjct: 756  DPNKLHPVDSFIIISCEVILKDIQSFLAYIFSIPISAEESIPNKLIRELFDCFEENRSKN 815

Query: 831  RIKQNILALNKLYCLNNSNIKHIMVDDELIPYDGDRIITRSMAKEMPDRYTQIPVYSKII 890
             +K+  L+L++L+                  +  D+ +TRS   +  D   + P    I+
Sbjct: 816  MLKEVALSLSELF------------------FSNDQRLTRSSYHDESDGVVR-PFKEYIV 856

Query: 891  KLFIQELSEQMKQPEHNLKIEETVETIGDGNXXXXXXXXXXXXXXXXYEKLQEYVDDEDD 950
            K+F  EL+ Q    E   + EE    I   +                YE  ++YV   +D
Sbjct: 857  KMFADELTRQTDIEEEEEEEEEEENDITPKD----------------YE--EDYVSQLND 898

Query: 951  ELHFGEDEDDILGTMDIEIDVKELLIRILKENASKNVSDFDKIYTTLSEDEK-RILS 1006
            ++        +L    I++++KE+L++  K     N +   ++   L E E+ +ILS
Sbjct: 899  DVV-------LLTGRVIDMELKEILVQFFKSTQQSNDNSLGRVLKNLDEQERLKILS 948

>TBLA0C07090 Chr3 complement(1716766..1720209) [3444 bp, 1147 aa]
           {ON} Anc_5.11 YMR308C
          Length = 1147

 Score = 40.8 bits (94), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 34/131 (25%), Positives = 60/131 (45%), Gaps = 6/131 (4%)

Query: 14  SPETSLREHAENSLLE-WCEHDXXXXXXXXXXXXXXXTEILSSRQYSLLALRKLITMYWS 72
           SP+ ++R  AEN L   W   +               +   +    S +  RKL  +   
Sbjct: 21  SPDNNIRSDAENQLNNNWITKENIHILLIFLSEQAAYSTDETLSALSAVLFRKL-ALRAP 79

Query: 73  PGFESYHLTSNLNE---TVKAHVRHTILQLALDKNQDSKIRKSGSYCIVQVSAVDFPDLW 129
           P  ++  ++ N+ E    + A +R T+L+  +D N+ + +R   S  I + S  D P+ W
Sbjct: 80  PDSKTILISKNITELPQDILAQIRSTLLKGFIDYNKPNNLRHKLSDAIAECSQPDLPN-W 138

Query: 130 PELLVTLYKSI 140
           PELL TL +++
Sbjct: 139 PELLQTLLQAL 149

>TDEL0B06480 Chr2 (1144036..1147833) [3798 bp, 1265 aa] {ON}
           Anc_2.559 YMR012W
          Length = 1265

 Score = 37.0 bits (84), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 30/57 (52%), Gaps = 6/57 (10%)

Query: 569 DCNLPNDKLGEIPQQEFNLILSITSRDPSNVQMTVESQECLKKLLEGLNTFEYSHYI 625
           D  + N+K   I Q+EF+ +  ITSRD    QM+  SQ       +G+  F+  HYI
Sbjct: 524 DKVIGNEKFDSIIQKEFSKVFHITSRDVDGAQMSFSSQS------KGIIGFDKRHYI 574

>NCAS0A14490 Chr1 complement(2852114..2855455) [3342 bp, 1113 aa]
           {ON} Anc_7.408 YER110C
          Length = 1113

 Score = 35.8 bits (81), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 21/85 (24%), Positives = 45/85 (52%), Gaps = 12/85 (14%)

Query: 56  RQYSLLALRKLITMYWSPGFESYHLTSNLNETVKAHVRHTILQLALDKNQDSKIRKSGSY 115
           +Q + +  RKLI+ +W            L+ET+KA ++ ++LQ A  + ++  IR + + 
Sbjct: 58  KQLAGVESRKLISKHWDA----------LDETIKAQIKSSLLQTAFSEPKEI-IRHANAR 106

Query: 116 CIVQVSAVDF-PDLWPELLVTLYKS 139
            I  + + +   + WP+L+  L ++
Sbjct: 107 VIAAIGSQELETNKWPDLIPNLIQA 131

>NDAI0E02170 Chr5 complement(445219..448308) [3090 bp, 1029 aa] {ON}
           Anc_8.624 YPL125W
          Length = 1029

 Score = 35.0 bits (79), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 31/142 (21%), Positives = 63/142 (44%), Gaps = 13/142 (9%)

Query: 9   IKQAQSPE---TSLREHAENSLLEWCEHDXXXXXXXXXXXXXXXTEILSSRQYSLLALRK 65
           ++QA +P+   + +++ AE  L +W                   T  L SR  + +  + 
Sbjct: 16  LEQAGNPQQAGSQVQKSAEQQLKQWEIQPGYHYYLQSIYLDLSNT--LQSRWLAAIQFKN 73

Query: 66  LITMYWSPGFESYHLTSNLNETVKAHVRHTILQLALDKNQDSKIRKSGSYCIVQVSAVDF 125
            +  YW            +N+  KA +R  + +L  ++N    I+ + +  I +++ +DF
Sbjct: 74  GVDRYWRSS-----RVHAINKDEKASIRARLFELIDEQNNQLGIQYAQA--IAKIARLDF 126

Query: 126 PDLWPELLVTLYKSILETHSLE 147
           P  WP+L   L +S+L  H++ 
Sbjct: 127 PAEWPDLFEHL-ESLLSDHNVR 147

>KLLA0A08316g Chr1 (733200..735302) [2103 bp, 700 aa] {ON} similar
           to uniprot|P32340 Saccharomyces cerevisiae YML120C NDI1
           NADH:ubiquinone oxidoreductase transfers electrons from
           NADH to ubiquinone in the respiratory chain but does not
           pump protons in contrast to the higher eukaryotic
           multisubunit respiratory complex I which is absent in S.
           cerevisiae
          Length = 700

 Score = 33.9 bits (76), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 39/81 (48%), Gaps = 16/81 (19%)

Query: 124 DFPDLWPELLVTLYKSILETHSLEALSILNEIYDDIISE---EMFFEEGIGLETM----- 175
           D P ++P +L    +  L  H +++ S +   YD+ ISE   + F +E I + T      
Sbjct: 349 DLPSMYPRIL----RQQLSVHVIQSRSNILNTYDEKISEYATQRFRKETIDVLTNSRVER 404

Query: 176 ----RVIFNILDDKTAPVETK 192
               RVIF   DDKT  VE K
Sbjct: 405 ILPDRVIFKQKDDKTGEVELK 425

>Kwal_47.19247 s47 complement(1151230..1154109) [2880 bp, 959 aa]
           {ON} YGL238W (CSE1) - (putative) kinetochore protein
           [contig 344] FULL
          Length = 959

 Score = 33.5 bits (75), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 46/206 (22%), Positives = 92/206 (44%), Gaps = 21/206 (10%)

Query: 583 QEFNLILSITSRDPSNVQMTVESQECLKKLLEGLNTFEYSHYIEMCFPSMVKVLIGSSVT 642
           Q+   I+SI S++PSN + +    E L  +L+  N  + S ++++  P  +++L      
Sbjct: 596 QQLLSIISIISKNPSNPRFSHYCFESLGVVLK-YNKQDLSKFLDLIMPQFMEIL------ 648

Query: 643 QYKYSALLSLALEFITIFMKKKPNDGYLPLEICKFIFNPLKDVLLVSNEDETLQLSSDAF 702
                  +   L+ I   +++ P    LP  + +    P+     VS+    L+ +  A 
Sbjct: 649 SEDLQEFIPYTLQLIAYCIEQLPAASSLPPSVSQLC-QPI-----VSSSVWELKGNIPAV 702

Query: 703 SYL---IYNTDPIVMVESLPGILEVMDRLLSLDVTDSAAMNAGSLVVTVFTHFE-NEIKP 758
           + L   I   DP    + +P +L V  RL++    D    N   L+  + T+   ++++P
Sbjct: 703 TRLLKDIIRVDPSAYPDLVP-VLGVFQRLIASKTYDD---NGFELLEFIMTYMPVDKVQP 758

Query: 759 YMKQILSGTTKRLIQAKNISTIQNLI 784
           YMKQI     +RL  ++    ++  +
Sbjct: 759 YMKQIAVLLLQRLQNSRTEKYVKKFV 784

>TPHA0F03160 Chr6 complement(690476..693571) [3096 bp, 1031 aa] {ON}
           Anc_8.624 YPL125W
          Length = 1031

 Score = 33.5 bits (75), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 29/137 (21%), Positives = 58/137 (42%), Gaps = 12/137 (8%)

Query: 3   IDIDSLIKQAQSPE---TSLREHAENSLLEWCEHDXXXXXXXXXXXXXXXTEILSSRQYS 59
           I++  +++QA  P+   + +++ AE  L EW   +               +  L  R  S
Sbjct: 7   INLIQVLEQASDPKNIGSEIQKLAEAKLKEWEVQEGFHYYLQSIYLNMDNS--LQIRWIS 64

Query: 60  LLALRKLITMYWSPGFESYHLTSNLNETVKAHVRHTILQLALDKNQDSKIRKSGSYCIVQ 119
           ++  +  I  YW         ++ +N+  K  +R  +  L  +KN    I+ + +    +
Sbjct: 65  IIQFKNGIEKYWRST-----RSNAINKNEKLKIRERLFNLVNEKNNQLSIQNAQA--TAK 117

Query: 120 VSAVDFPDLWPELLVTL 136
           ++  DFP  WP+L   L
Sbjct: 118 IARFDFPGHWPDLFENL 134

>Ecym_5454 Chr5 complement(932244..935138) [2895 bp, 964 aa] {ON}
           similar to Ashbya gossypii AAR115C
          Length = 964

 Score = 32.3 bits (72), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 37/64 (57%), Gaps = 2/64 (3%)

Query: 442 NIENLLSSLAKNFHHYITNTILFSRLILLIPKILEKFMDDIENIKLITCEFLKQSLA-IG 500
           +I NL S L  N+    TNTI+  R++ L+ ++ EK+   +E+I  +  E L Q+ A  G
Sbjct: 651 SIWNLASDLL-NYEGGATNTIIVERIMKLLRRLFEKYHIFLESILPMVVEMLAQNYAKTG 709

Query: 501 LDNY 504
           L +Y
Sbjct: 710 LGSY 713

>KLLA0C14157g Chr3 complement(1223130..1226402) [3273 bp, 1090 aa]
           {ON} similar to uniprot|P32337 Saccharomyces cerevisiae
           YMR308C PSE1 Karyopherin/importin that interacts with
           the nuclear pore complex acts as the nuclear import
           receptor for specific proteins including Pdr1p Yap1p
           Ste12p and Aft1p
          Length = 1090

 Score = 32.3 bits (72), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 32/140 (22%), Positives = 62/140 (44%), Gaps = 7/140 (5%)

Query: 8   LIKQAQSPETSLREHAENSLLE-WCEHDXXXXXXXXXXXXXXXTEILSSRQYSLLALRKL 66
           L++   SP+ ++R  AE++L   W   +               ++ L++   S +  RKL
Sbjct: 15  LLQGFASPDNAIRSAAEDALNNNWITPEHIEVLLMFLAEQSAYSDDLTTAGLSAVLFRKL 74

Query: 67  ITMYWSPGFESYHLTSNLNETVK---AHVRHTILQLALDKNQDSKIRKSGSYCIVQVSAV 123
             +   P  ++  +  N+    K     +R T+L+      + + IR   S  I + +  
Sbjct: 75  -ALRAPPSSKTIIIAKNITHISKEALKQIRDTLLK-GFISQRPNNIRHKLSDAIAECALE 132

Query: 124 DFPDLWPELLVTLYKSILET 143
           + P+ WP LL TL+++I  T
Sbjct: 133 ELPE-WPPLLQTLFEAIKNT 151

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.137    0.388 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 103,539,660
Number of extensions: 4623623
Number of successful extensions: 19675
Number of sequences better than 10.0: 82
Number of HSP's gapped: 20090
Number of HSP's successfully gapped: 82
Length of query: 1010
Length of database: 53,481,399
Length adjustment: 120
Effective length of query: 890
Effective length of database: 39,721,479
Effective search space: 35352116310
Effective search space used: 35352116310
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 71 (32.0 bits)