Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0E002303.566ON39439418170.0
Kpol_380.73.566ON3853957705e-99
KAFR0J028703.566ON3843917367e-94
NDAI0I032303.566ON3863937341e-93
Smik_7.183.566ON3853977201e-91
Skud_7.243.566ON3913947132e-90
SAKL0F00836g3.566ON3833576974e-88
NCAS0E002703.566ON3883906984e-88
ZYRO0E09504g3.566ON3773926966e-88
YGL243W (TAD1)3.566ON4003936952e-87
TPHA0G036403.566ON3963926942e-87
TDEL0D063403.566ON4023956821e-85
Suva_7.183.566ON3853956774e-85
KNAG0I002403.566ON3913946768e-85
KLTH0G00748g3.566ON3853886722e-84
Kwal_47.192633.566ON3833946672e-83
CAGL0H07733g3.566ON3853896402e-79
Ecym_25963.566ON3873916262e-77
AFR267W3.566ON3853955871e-71
KLLA0A00759g3.566ON3803995782e-70
TDEL0F00150singletonON56049713.3
Smik_7.323.544ON95138703.8
TDEL0C07020singletonON56049694.8
ACR028C6.0ON60146686.9
KLLA0F26983g2.597ON467158687.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0E00230
         (394 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0E00230 Chr5 (35169..36353) [1185 bp, 394 aa] {ON} Anc_3.566...   704   0.0  
Kpol_380.7 s380 complement(11933..13090) [1158 bp, 385 aa] {ON} ...   301   5e-99
KAFR0J02870 Chr10 complement(546360..547514) [1155 bp, 384 aa] {...   288   7e-94
NDAI0I03230 Chr9 complement(759205..760365) [1161 bp, 386 aa] {O...   287   1e-93
Smik_7.18 Chr7 (38166..39323) [1158 bp, 385 aa] {ON} YGL243W (REAL)   281   1e-91
Skud_7.24 Chr7 (47515..48690) [1176 bp, 391 aa] {ON} YGL243W (REAL)   279   2e-90
SAKL0F00836g Chr6 (74958..76109) [1152 bp, 383 aa] {ON} similar ...   273   4e-88
NCAS0E00270 Chr5 (41231..42397) [1167 bp, 388 aa] {ON} Anc_3.566...   273   4e-88
ZYRO0E09504g Chr5 complement(756951..758084) [1134 bp, 377 aa] {...   272   6e-88
YGL243W Chr7 (43307..44509) [1203 bp, 400 aa] {ON}  TAD1tRNA-spe...   272   2e-87
TPHA0G03640 Chr7 complement(774037..775227) [1191 bp, 396 aa] {O...   271   2e-87
TDEL0D06340 Chr4 complement(1138653..1139861) [1209 bp, 402 aa] ...   267   1e-85
Suva_7.18 Chr7 (37929..39086) [1158 bp, 385 aa] {ON} YGL243W (REAL)   265   4e-85
KNAG0I00240 Chr9 (30503..31678) [1176 bp, 391 aa] {ON} Anc_3.566...   265   8e-85
KLTH0G00748g Chr7 (51751..52908) [1158 bp, 385 aa] {ON} similar ...   263   2e-84
Kwal_47.19263 s47 complement(1160721..1161872) [1152 bp, 383 aa]...   261   2e-83
CAGL0H07733g Chr8 (754933..756090) [1158 bp, 385 aa] {ON} simila...   251   2e-79
Ecym_2596 Chr2 complement(1159583..1160746) [1164 bp, 387 aa] {O...   245   2e-77
AFR267W Chr6 (914618..915775) [1158 bp, 385 aa] {ON} Syntenic ho...   230   1e-71
KLLA0A00759g Chr1 (74187..75329) [1143 bp, 380 aa] {ON} similar ...   227   2e-70
TDEL0F00150 Chr6 (12055..13737) [1683 bp, 560 aa] {ON}                 32   3.3  
Smik_7.32 Chr7 (64408..67263) [2856 bp, 951 aa] {ON} YGL227W (REAL)    32   3.8  
TDEL0C07020 Chr3 complement(1283600..1285282) [1683 bp, 560 aa] ...    31   4.8  
ACR028C Chr3 complement(408701..410506) [1806 bp, 601 aa] {ON} N...    31   6.9  
KLLA0F26983g Chr6 (2489326..2490729) [1404 bp, 467 aa] {ON} some...    31   7.0  

>TBLA0E00230 Chr5 (35169..36353) [1185 bp, 394 aa] {ON} Anc_3.566
           YGL243W
          Length = 394

 Score =  704 bits (1817), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 349/394 (88%), Positives = 349/394 (88%)

Query: 1   MDKRELGDKIAALLFREYXXXXXXXXXXXXXXXXXEWTIISGIVAVSNKDTNIIKVISLA 60
           MDKRELGDKIAALLFREY                 EWTIISGIVAVSNKDTNIIKVISLA
Sbjct: 1   MDKRELGDKIAALLFREYNKLKKSNKPIKKSNGIKEWTIISGIVAVSNKDTNIIKVISLA 60

Query: 61  TGVKATPDSELKRSQGSIVHDCHAEILAIRGFNTTLLREIENKEIDDTNSCDLIYKVENS 120
           TGVKATPDSELKRSQGSIVHDCHAEILAIRGFNTTLLREIENKEIDDTNSCDLIYKVENS
Sbjct: 61  TGVKATPDSELKRSQGSIVHDCHAEILAIRGFNTTLLREIENKEIDDTNSCDLIYKVENS 120

Query: 121 KCKKYSWNDEYDLGLYISKLPCGDXXXXXXXXXXXXXXIQFQENDLTQYVDPTIRTILRG 180
           KCKKYSWNDEYDLGLYISKLPCGD              IQFQENDLTQYVDPTIRTILRG
Sbjct: 121 KCKKYSWNDEYDLGLYISKLPCGDSSMEEENSLESNSLIQFQENDLTQYVDPTIRTILRG 180

Query: 181 RINYNKSGCVRTKPGRIDSEITFSKSCSDKICIKQVXXXXXXXXXXXXXXPIYIKYLVCP 240
           RINYNKSGCVRTKPGRIDSEITFSKSCSDKICIKQV              PIYIKYLVCP
Sbjct: 181 RINYNKSGCVRTKPGRIDSEITFSKSCSDKICIKQVLSLLNSLNTELLESPIYIKYLVCP 240

Query: 241 DIKPQNLILLKKSFNRIENIKLEVSSSYRYHPLSFIPSSIQFQDGKTNDLQEPSFTSVVK 300
           DIKPQNLILLKKSFNRIENIKLEVSSSYRYHPLSFIPSSIQFQDGKTNDLQEPSFTSVVK
Sbjct: 241 DIKPQNLILLKKSFNRIENIKLEVSSSYRYHPLSFIPSSIQFQDGKTNDLQEPSFTSVVK 300

Query: 301 IFNSNDKFGLEQSIVNGVKMGAYTKKSKPLSKNAMTIVSRTFQWNIFKNIMPEFEQYSYL 360
           IFNSNDKFGLEQSIVNGVKMGAYTKKSKPLSKNAMTIVSRTFQWNIFKNIMPEFEQYSYL
Sbjct: 301 IFNSNDKFGLEQSIVNGVKMGAYTKKSKPLSKNAMTIVSRTFQWNIFKNIMPEFEQYSYL 360

Query: 361 TFKRFQTDRIETRNRIRKCLSQDGWISTFNDDII 394
           TFKRFQTDRIETRNRIRKCLSQDGWISTFNDDII
Sbjct: 361 TFKRFQTDRIETRNRIRKCLSQDGWISTFNDDII 394

>Kpol_380.7 s380 complement(11933..13090) [1158 bp, 385 aa] {ON}
           complement(11933..13090) [1158 nt, 386 aa]
          Length = 385

 Score =  301 bits (770), Expect = 5e-99,   Method: Compositional matrix adjust.
 Identities = 163/395 (41%), Positives = 234/395 (59%), Gaps = 15/395 (3%)

Query: 1   MDKRELGDKIAALLFREYXXXXXXXXXXXXXXXXXEWTIISGIVAVSNKDTNIIKVISLA 60
           M ++ LGDKI+ ++F EY                 EWT+++ IVA+SN +  II  I+++
Sbjct: 1   MKEKSLGDKISNIIFEEYSKLKSSSKPTTRSNNVKEWTVLAAIVAISNDENEIIP-ITIS 59

Query: 61  TGVKATPDSELKRSQGSIVHDCHAEILAIRGFNTTLLREIENKEIDDTNSCDLIYKVENS 120
           TGVKATP+ EL+RS G I+HDCH+EIL++R FNT LL+ ++     D +   L  K +  
Sbjct: 60  TGVKATPNDELERSSGKILHDCHSEILSLRAFNTYLLQSVQRVSEGDKSKFILPAKADG- 118

Query: 121 KCKKYSWNDEYDLGLYISKLPCGDXXXXXXXXXXXXXXIQF--QENDLTQYVDPTIRTIL 178
              KY+WN+ Y + LYISKLPCGD                F  ++ND  Q++DP I+T++
Sbjct: 119 ---KYNWNENYKIALYISKLPCGDASMDTLNEDLEDNEQNFTIEDNDAYQFIDPKIKTVI 175

Query: 179 RGRINYNKSGCVRTKPGRIDSEITFSKSCSDKICIKQVXXXXXXXXXXXXXXPIYIKYLV 238
           RGR+NY+K   VRTKPGR DS +T SKSCSDK+C+KQ               PI++ Y++
Sbjct: 176 RGRLNYSKKNVVRTKPGRYDSNVTLSKSCSDKLCMKQAKSILNSLNWDLFENPIFLAYVI 235

Query: 239 CPDIKPQNLILLKKSF-NRIENIKLEVSSSYRYHPLSFIPSSIQFQDGKTNDLQEPSFTS 297
            P +K + L+ L K F  R+  I + +       PL+F+    +F D KT    EP+  S
Sbjct: 236 IPTLKDELLLKLNKEFPERLRGIGIPI------MPLTFLTCVEKFIDDKTEIKTEPALVS 289

Query: 298 VVKIFNSNDKFGLEQSIVNGVKMGAYTKKSKPLSKNAMTIVSRTFQWNIFKNIMPEFEQY 357
            +KI    +   +EQSIVNGV+ G+YTKK+KPL KN  + +S+  QW +FK +  E    
Sbjct: 290 SIKILLPRE-HQIEQSIVNGVRNGSYTKKNKPLKKNCQSDISKYSQWQLFKTLKEEQLAK 348

Query: 358 SYLTFKRFQTDRIETRNRIRKCLSQDGWISTFNDD 392
           SY+ +K+ QT R + ++ I+  LS DGWISTF DD
Sbjct: 349 SYIEYKKSQTLREDLKDIIKSKLSPDGWISTFQDD 383

>KAFR0J02870 Chr10 complement(546360..547514) [1155 bp, 384 aa] {ON}
           Anc_3.566 YGL243W
          Length = 384

 Score =  288 bits (736), Expect = 7e-94,   Method: Compositional matrix adjust.
 Identities = 155/391 (39%), Positives = 231/391 (59%), Gaps = 13/391 (3%)

Query: 6   LGDKIAALLFREYXXXXXXXXXXXXXXXXXEWTIISGIVAVS-NKDTNIIKVISLATGVK 64
           LGD+IA L++ EY                 EWT+++ +VA++ N D   +K+I+++TGVK
Sbjct: 5   LGDEIAKLVYEEYDQLKASSKPVTRSNGTKEWTVLAAVVAINENADEKDLKLIAISTGVK 64

Query: 65  ATPDSELKRSQGSIVHDCHAEILAIRGFNTTLLREIENKEIDDTNSCDLIYKVENSKCKK 124
           A P++ L RS G I+HDCHAEILA+RGFN  LL+ +++ + ++T+S    +  ++++  K
Sbjct: 65  AMPNARLDRSCGRILHDCHAEILALRGFNFVLLKNMQDLKNNETSS----FLDKSAQGGK 120

Query: 125 YSWNDEYDLGLYISKLPCGDXXXXXXXXXXXXXXIQFQENDLTQYVDPTIRTILRGRINY 184
           + W  ++ L LY+S+LPCGD              I+  E+D  QY+DP    ILRGR+N+
Sbjct: 121 FRWKSKWKLALYVSRLPCGDASMDHLEDASELD-IEMSEDDRLQYIDPGKSKILRGRMNF 179

Query: 185 NKSGCVRTKPGRIDSEITFSKSCSDKICIKQVXXXXXXXXXXXXXXPIYIKYLVCPDIKP 244
            + G VRTKPGR+DS+IT SKSCSDK+CIKQ+              P+Y+KYLV P++  
Sbjct: 180 KRKGAVRTKPGRLDSDITLSKSCSDKLCIKQITSALNSLTWELMETPVYLKYLVIPELND 239

Query: 245 QNLILLKKSFNRIENIKLEVSSSYRYHPLSFIPSSIQFQDGKTNDLQEPSFTSVVKIFNS 304
            +   L + F+      L++ S ++     F+     F D KT+D Q PS TS +K+F S
Sbjct: 240 TDKKALIRCFHTRLCSSLDLISRFQ-----FLTYQGSFTDDKTSDSQLPSATSFIKVFPS 294

Query: 305 NDKFGLEQSIVNGVKMGAYTKKSKPLSKNAMTIVSRTFQWNIFKNIMPEFEQ-YSYLTFK 363
            +   +EQ+I+NGVK G YTK  KPL +   +I+SR  QWN++K++  + E   SYL FK
Sbjct: 295 QE-HTIEQAILNGVKNGFYTKLDKPLRRGCESILSRYSQWNLYKSLKSDVENGLSYLQFK 353

Query: 364 RFQTDRIETRNRIRKCLSQDGWISTFNDDII 394
             Q  R +     + CLS   WI+T  DD I
Sbjct: 354 AEQEQRRDLVENAKICLSHGSWIATLKDDCI 384

>NDAI0I03230 Chr9 complement(759205..760365) [1161 bp, 386 aa] {ON}
           Anc_3.566 YGL243W
          Length = 386

 Score =  287 bits (734), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 159/393 (40%), Positives = 234/393 (59%), Gaps = 12/393 (3%)

Query: 3   KRELGDKIAALLFREYXXXXXXXXXXXXXXXXXEWTIISGIVAVSNKDTNIIKVISLATG 62
           + +L D+IA LL ++Y                 EWT+ +GIVA+ N DTN ++VISLATG
Sbjct: 4   EHQLADRIADLLQQKYDTLKSSSKPVARSNGIKEWTVFAGIVAI-NTDTNDLRVISLATG 62

Query: 63  VKATPDSELKRSQGSIVHDCHAEILAIRGFNTTLLREIENKEIDDTNSCDLIYKVENSKC 122
           VKA P+ EL+RS G ++HD HAEI+A+RGFNT +L++I   ++ +    DL+   ++S+ 
Sbjct: 63  VKALPNKELERSGGKMLHDGHAEIVALRGFNTVILQQI--YQLKNGEETDLVIHSKDSEY 120

Query: 123 KKYSWNDEYDLGLYISKLPCGDXXXXXXXXXXXX-XXIQFQENDLTQYVDPTIRTILRGR 181
             YS+     + LYIS+LPCGD               +  ++ D  QY++   +TILRGR
Sbjct: 121 --YSFKSNLKIALYISQLPCGDISMRMLKERDIAPEELAIKDEDSIQYINQDNKTILRGR 178

Query: 182 INYNKSGCVRTKPGRIDSEITFSKSCSDKICIKQVXXXXXXXXXXXXXXPIYIKYLVCPD 241
           +N+NK G VRTKPGR+DS++T SKSCSDK+C+KQ               P+Y+ Y++ P 
Sbjct: 179 LNFNKKGYVRTKPGRLDSQLTKSKSCSDKLCMKQYTSILNCLTFQLLEQPVYLDYMIVPG 238

Query: 242 IKPQNLILLKKSFNRIENIKLEVSSSYRYHPLSFIPSSIQFQDGKTNDLQEPSFTSVVKI 301
           +  +    +K+  +   N + E     R H + ++ +S +F+D +    QEPS    +K+
Sbjct: 239 MTTE----MKEDIDLCFNKQFERCVGTR-HEVCYLSTSKEFKDTRNTSDQEPSAIGAIKV 293

Query: 302 FNSNDKFGLEQSIVNGVKMGAYTKKSKPLSKNAMTIVSRTFQWNIFKNIMPEFEQYSYLT 361
           F       +EQ+I+NGVK G+YTKK+KPL KN  T+VSR  QW IFK I P++ Q SYL 
Sbjct: 294 FIGQGN-SIEQTILNGVKNGSYTKKNKPLRKNCETLVSRFSQWQIFKEIEPKYSQMSYLD 352

Query: 362 FKRFQTDRIETRNRIRKCLSQDGWISTFNDDII 394
           FK+ Q +R +  +  R  +S DGWIST  DD +
Sbjct: 353 FKQSQHERRKLIDYTRSKMSPDGWISTQEDDCL 385

>Smik_7.18 Chr7 (38166..39323) [1158 bp, 385 aa] {ON} YGL243W (REAL)
          Length = 385

 Score =  281 bits (720), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 164/397 (41%), Positives = 227/397 (57%), Gaps = 18/397 (4%)

Query: 1   MDKRELGDKIAALLFREYXXXXXXXXXXXXXXXXXEWTIISGIVAVSNK-DTNIIKVISL 59
           + + ELGD+I+  +  EY                 EWT+++GIVA++ K DTN I V+S+
Sbjct: 2   LSEDELGDRISTRVINEYSKLKPICRPVTRPTGVKEWTVLAGIVAINRKNDTNNIDVLSM 61

Query: 60  ATGVKATPDSELKRSQGSIVHDCHAEILAIRGFNTTLLREIENKEIDDTNSCDLIYKVEN 119
           ATGVKA PDSEL+RS G I+HDCHAEILA+RG NT LL  I  KE +  N  D I +  +
Sbjct: 62  ATGVKAMPDSELRRSGGKILHDCHAEILALRGLNTVLLNHI--KEYNPANGSDFI-QSND 118

Query: 120 SKCKKYSWNDEYDLGLYISKLPCGDXXXXXXXX--XXXXXXIQFQENDLTQYVDPTIRTI 177
               ++   D ++L LYISKLPCGD                 + +++D  QYV+ +++TI
Sbjct: 119 ETPPRFKLKDNWELALYISKLPCGDASIDFLNDNCKNDHDFPKIEDDDEFQYVNSSVKTI 178

Query: 178 LRGRINYNKSGCVRTKPGRIDSEITFSKSCSDKICIKQVXXXXXXXXXXXXXXPIYIKYL 237
           LRG +N+N+   VRTKPGR DS IT SKSCSDK+ +K++              P+++KY+
Sbjct: 179 LRGNLNFNRKNVVRTKPGRYDSNITLSKSCSDKLLMKRLSSILNALNYELFVQPVFLKYV 238

Query: 238 VCPDIKPQNLILLKKSFN-RIENIKLEVSSSYRYHPLSFIPSSIQFQDGKTNDLQEPSFT 296
           V P ++ +   +LK+SF+ R+ N           H   F+  +  F D K  +   PS  
Sbjct: 239 VIPGLENEVKHVLKQSFHDRLPNAN---------HETIFMSCNTSFYDDKAGEEDVPSLM 289

Query: 297 SVVKIFNSNDKFGLEQSIVNGVKMGAYTKKSKPLSKNAMTIVSRTFQWNIFKNIMPEFEQ 356
             +K+F  ND    E++I+NGVK G YTK SKPL K+  ++VSR  QW +FK I PE+E 
Sbjct: 290 CSIKLF-MNDHTN-EEAILNGVKNGFYTKSSKPLRKHCQSLVSRFAQWELFKQIRPEYEG 347

Query: 357 YSYLTFKRFQTDRIETRNRIRKCLSQDGWISTFNDDI 393
            SYL FK  Q  R      I+  LS DGWI T  DD+
Sbjct: 348 MSYLQFKSSQKRRTRLIIAIKDILSPDGWIPTKIDDV 384

>Skud_7.24 Chr7 (47515..48690) [1176 bp, 391 aa] {ON} YGL243W (REAL)
          Length = 391

 Score =  279 bits (713), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 160/394 (40%), Positives = 228/394 (57%), Gaps = 16/394 (4%)

Query: 3   KRELGDKIAALLFREYXXXXXXXXXXXXXXXXXEWTIISGIVAVS-NKDTNIIKVISLAT 61
           K EL ++I+  +  EY                 EWTI++G+V ++ +   N ++V+S+AT
Sbjct: 10  KNELAEEISNKVIGEYSKLKSVCKPATRPTGIKEWTILAGVVVINRSGGANNVEVLSVAT 69

Query: 62  GVKATPDSELKRSQGSIVHDCHAEILAIRGFNTTLLREIENKEIDDTNSCDLIYKVENSK 121
           GVKA PDSEL+RS G ++HDCHAEILA+RG NT LL+ I  K+ D  N  D I +  N  
Sbjct: 70  GVKALPDSELQRSGGKLLHDCHAEILALRGANTVLLKHI--KDYDPANGSDFI-ESNNEI 126

Query: 122 CKKYSWNDEYDLGLYISKLPCGDXXXXXXXXXXXXXX--IQFQENDLTQYVDPTIRTILR 179
             +++  D+++L LYIS+LPCGD                I+ ++ND  QYVDP ++TILR
Sbjct: 127 PIRFNLKDDWELALYISRLPCGDASMDFLNDSCKNNEDFIKIEDNDAFQYVDPKVKTILR 186

Query: 180 GRINYNKSGCVRTKPGRIDSEITFSKSCSDKICIKQVXXXXXXXXXXXXXXPIYIKYLVC 239
           GR+N++K   VRTKPGR DS IT SKSCSDK+ +KQ+              P+Y+KY+V 
Sbjct: 187 GRLNFHKKSVVRTKPGRYDSNITLSKSCSDKLSMKQISSILNSLNYELFEQPVYLKYIVI 246

Query: 240 PDIKPQNLILLKKSFNRIENIKLEVSSSYRYHPLSFIPSSIQFQDGKTNDLQEPSFTSVV 299
           PDI+ +   +L++SF+     +L        H + F+     F D +T++   PS    +
Sbjct: 247 PDIEDKTKHILERSFHN----RLPCDG----HKVEFLNCHTPFYDDRTDENDIPSSMCSI 298

Query: 300 KIFNSNDKFGLEQSIVNGVKMGAYTKKSKPLSKNAMTIVSRTFQWNIFKNIMPEFEQYSY 359
           K+F  ND    E++I NG+K G YTK SKPL K+  + VSR  QW +F+ I P+ +  SY
Sbjct: 299 KLF-VNDS-STEEAIFNGMKNGFYTKSSKPLRKHCQSQVSRFAQWELFRQIRPKHKSMSY 356

Query: 360 LTFKRFQTDRIETRNRIRKCLSQDGWISTFNDDI 393
           L FK  Q +R       +  LS DGWIST  DD+
Sbjct: 357 LHFKSQQKERNRLITTAKNALSPDGWISTRIDDV 390

>SAKL0F00836g Chr6 (74958..76109) [1152 bp, 383 aa] {ON} similar to
           uniprot|P53065 Saccharomyces cerevisiae YGL243W TAD1
           tRNA-specific adenosine deaminase deaminates
           adenosine-37 to inosine in tRNA-Ala
          Length = 383

 Score =  273 bits (697), Expect = 4e-88,   Method: Compositional matrix adjust.
 Identities = 150/357 (42%), Positives = 202/357 (56%), Gaps = 11/357 (3%)

Query: 36  EWTIISGIVAVSNKDTNIIKVISLATGVKATPDSELKRSQGSIVHDCHAEILAIRGFNTT 95
           EWT+++GI+A+ N+  N ++++SL TGVKATP+ ELKRS+G IVHDCHAEILA+RGFNT 
Sbjct: 37  EWTVLAGIIAI-NERKNTMRLVSLGTGVKATPNEELKRSKGKIVHDCHAEILALRGFNTV 95

Query: 96  LLREIENKEIDDTNSCDLIYKVENSKCKKYSWNDEYDLGLYISKLPCGDXXXXXXXXXXX 155
           LL ++           DL+ K  +    K    D +   LYISKLPCGD           
Sbjct: 96  LLMQVSELTQGKHERVDLVEKAVDGLSFKVP--DHWSFALYISKLPCGDSSMDTLEEEDL 153

Query: 156 XXXIQFQENDLTQYVDPTIRTILRGRINYNKSGCVRTKPGRIDSEITFSKSCSDKICIKQ 215
                 +  D  QY++    T+LRGR NY K G VRTKPGR DS+IT SKSCSDK+ I+Q
Sbjct: 154 NS-FNIENTDACQYLEQNNHTLLRGRFNYQKKGFVRTKPGRKDSKITLSKSCSDKLSIRQ 212

Query: 216 VXXXXXXXXXXXXXXPIYIKYLVCPDIKPQNLILLKKSFNRIENIKLEVSSSYRYHPLSF 275
           V              PIY+KY++ P++    L+ L++SF R+ N          ++ L F
Sbjct: 213 VTSMLNSINWELFDTPIYLKYIIIPNLDEHALVGLERSFERLCN-------HPSFNALRF 265

Query: 276 IPSSIQFQDGKTNDLQEPSFTSVVKIFNSNDKFGLEQSIVNGVKMGAYTKKSKPLSKNAM 335
           +  S  F D K    Q+PS  S + +   N+    +++I+NGVK G Y K  KPL KN  
Sbjct: 266 LSGSQTFCDDKITQDQQPSSMSSISLNVHNNGEEFQEAILNGVKNGFYVKNKKPLRKNCE 325

Query: 336 TIVSRTFQWNIFKNIMPEFEQYSYLTFKRFQTDRIETRNRIRKCLSQDGWISTFNDD 392
           +IVSR  QW ++  I    E  +YL FK  Q +R   +N  + CLS DGWI T  DD
Sbjct: 326 SIVSRLSQWQLYNTISSNTEHETYLQFKSTQVERNILKNEAKLCLSPDGWIPTGVDD 382

>NCAS0E00270 Chr5 (41231..42397) [1167 bp, 388 aa] {ON} Anc_3.566
           YGL243W
          Length = 388

 Score =  273 bits (698), Expect = 4e-88,   Method: Compositional matrix adjust.
 Identities = 154/390 (39%), Positives = 229/390 (58%), Gaps = 14/390 (3%)

Query: 6   LGDKIAALLFREYXXXXXXXXXXXXXXXXXEWTIISGIVAVSNKDTNIIKVISLATGVKA 65
           L D++A ++  EY                 EWT+++  + + + +T  +K+ISL+TGVKA
Sbjct: 7   LPDRVAKIVQEEYNKLKPSSKPVLRSNGVKEWTVLASTLLL-DSNTGNLKMISLSTGVKA 65

Query: 66  TPDSELKRSQGSIVHDCHAEILAIRGFNTTLLREIENKEIDDTNSCDLIYKVENSKCKKY 125
            PD EL RS G ++HDCHAEILA+RGFNT LL++I+N    +    DL+ ++ ++   KY
Sbjct: 66  LPDKELSRSGGKMIHDCHAEILALRGFNTVLLKDIDNMN-QNLRQSDLL-EISDAN-GKY 122

Query: 126 SWNDEYDLGLYISKLPCGDXXXXXXXXXXXXXXIQ--FQENDLTQYVDPTIRTILRGRIN 183
               ++ L LYIS+LPCGD                    ++D  QY+DP I TILRGR+N
Sbjct: 123 HLRAKWKLILYISRLPCGDASMRTLSNSSPTSSSLKSIDDSDEFQYIDPNIPTILRGRLN 182

Query: 184 YNKSGCVRTKPGRIDSEITFSKSCSDKICIKQVXXXXXXXXXXXXXXPIYIKYLVCPDIK 243
           ++++G VRTKPGR+DS  T SKSCSDK+C++QV              P++I YL+ P + 
Sbjct: 183 FSRNGVVRTKPGRLDSLTTLSKSCSDKLCLRQVTSILNCMTWSLLDTPVFIDYLLIPQLN 242

Query: 244 PQNLILLKKSF-NRIENIKLEVSSSYRYHPLSFIPSSIQFQDGKTNDLQEPSFTSVVKIF 302
             N   L  SF NR++       S   Y P+ ++ ++++F + K    +EPS  S +K+F
Sbjct: 243 YDNKNDLLLSFQNRLK------CSKVNYRPMKYLTTTVKFSEDKNFITEEPSSMSSIKLF 296

Query: 303 NSNDKFGLEQSIVNGVKMGAYTKKSKPLSKNAMTIVSRTFQWNIFKNIMPEFEQYSYLTF 362
            +  +  +E++++NGVK G+YTK +KPL KN  +IVSR  QW+I+K I P +   SYL F
Sbjct: 297 LTQGE-TIEEALLNGVKNGSYTKGNKPLRKNCESIVSRYAQWHIYKRINPNYSATSYLEF 355

Query: 363 KRFQTDRIETRNRIRKCLSQDGWISTFNDD 392
           KR QT R+E      + LS +GW+ T  DD
Sbjct: 356 KRSQTARLELIKYTNEILSSEGWLPTQPDD 385

>ZYRO0E09504g Chr5 complement(756951..758084) [1134 bp, 377 aa] {ON}
           similar to uniprot|P53065 Saccharomyces cerevisiae
           YGL243W TAD1 tRNA-specific adenosine deaminase
           deaminates adenosine-37 to inosine in tRNA-Ala
          Length = 377

 Score =  272 bits (696), Expect = 6e-88,   Method: Compositional matrix adjust.
 Identities = 155/392 (39%), Positives = 223/392 (56%), Gaps = 17/392 (4%)

Query: 1   MDKRELGDKIAALLFREYXXXXXXXXXXXXXXXXXEWTIISGIVAVSNKDTNIIKVISLA 60
           MD   LG++IA  +   Y                 EWT+++GIVA+  K++++ ++IS+A
Sbjct: 1   MDDVSLGNRIAQKVLEGYRKLGSSCKPGTRSNGVKEWTVLAGIVAIDKKNSDL-RLISIA 59

Query: 61  TGVKATPDSELKRSQGSIVHDCHAEILAIRGFNTTLLREIENKEIDDTNSCDLIYKVENS 120
           TGVKA PD+ L RS G +VHDCHAEILA+R FN  +L +I     +  N  DL+ +   S
Sbjct: 60  TGVKALPDAFLHRSGGKMVHDCHAEILALRAFNAVILDQIAYLNSNSDNQIDLVERA--S 117

Query: 121 KCKKYSWNDEYDLGLYISKLPCGDXXXXXXXXXXXXXXIQFQENDLTQYVDPTIRTILRG 180
           + + + + D ++L +YIS LPCGD              I+ Q++D  Q+VDP + +I+RG
Sbjct: 118 EDQLFHFKDNWELAIYISTLPCGDASMDLLCQDESI--IEMQDDDPIQFVDPAVTSIVRG 175

Query: 181 RINYNKSGCVRTKPGRIDSEITFSKSCSDKICIKQVXXXXXXXXXXXXXXPIYIKYLVCP 240
           R NY++   VRTKPGR DS+IT  KSCSDK+C +QV              P+Y+KYLV P
Sbjct: 176 RFNYSRRQVVRTKPGRFDSQITLCKSCSDKLCQRQVISILNCMTWKLLNKPVYLKYLVTP 235

Query: 241 DIKPQNLILLKKSFNRIENIKLEVSSSYRYHPLSFIPSSIQFQDGKTNDLQEPSFTSVVK 300
           +       LL +SF   + IK+  +      PL  +  S QF+  K +  +EPS  S +K
Sbjct: 236 NTTD----LLHQSF--YDRIKVLPNV-----PLKVLQCSYQFEHDKHSSEEEPSAMSSIK 284

Query: 301 IFNSNDKFGLEQSIVNGVKMGAYTKKSKPLSKNAMTIVSRTFQWNIFKNIMPEFEQYSYL 360
           ++++ +   +EQ+++NG+K G YTK +KPL +N    VSR  QW +FK + PEF   +YL
Sbjct: 285 LYSTPES-TVEQALLNGLKNGFYTKGNKPLRRNCEPAVSRYAQWQLFKTLRPEFTNATYL 343

Query: 361 TFKRFQTDRIETRNRIRKCLSQDGWISTFNDD 392
            FK    DR       RK LS  GWIST  DD
Sbjct: 344 QFKATIQDRNALIQDCRKLLSPKGWISTSRDD 375

>YGL243W Chr7 (43307..44509) [1203 bp, 400 aa] {ON}
           TAD1tRNA-specific adenosine deaminase, deaminates
           adenosine-37 to inosine in tRNA-Ala
          Length = 400

 Score =  272 bits (695), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 157/393 (39%), Positives = 228/393 (58%), Gaps = 19/393 (4%)

Query: 5   ELGDKIAALLFREYXXXXXXXXXXXXXXXXXEWTIISGIVAVSNKD--TNIIKVISLATG 62
           +LG++I+  +  EY                 EWTI++G+ A+ N+D   N I+++S+ATG
Sbjct: 22  KLGEEISTRVINEYSKLKSACRPIIRPSGIREWTILAGVAAI-NRDGGANKIEILSIATG 80

Query: 63  VKATPDSELKRSQGSIVHDCHAEILAIRGFNTTLLREIENKEIDDTNSCDLIYKVENSKC 122
           VKA PDSEL+RS+G I+HDCHAEILA+RG NT LL  I+N    + +S D   +  +   
Sbjct: 81  VKALPDSELQRSEGKILHDCHAEILALRGANTVLLNRIQNY---NPSSGDKFIQHNDEIP 137

Query: 123 KKYSWNDEYDLGLYISKLPCGDXXXXXXXXX-XXXXXIQFQENDLTQYVDPTIRTILRGR 181
            +++  + ++L LYIS+LPCGD               I+ +++D  QYVD +++TILRGR
Sbjct: 138 ARFNLKENWELALYISRLPCGDASMSFLNDNCKNDDFIKIEDSDEFQYVDRSVKTILRGR 197

Query: 182 INYNKSGCVRTKPGRIDSEITFSKSCSDKICIKQVXXXXXXXXXXXXXXPIYIKYLVCPD 241
           +N+N+   VRTKPGR DS IT SKSCSDK+ +KQ               P+++KY+V P+
Sbjct: 198 LNFNRRNVVRTKPGRYDSNITLSKSCSDKLLMKQRSSVLNCLNYELFEKPVFLKYIVIPN 257

Query: 242 IKPQNLILLKKSFN-RIENIKLEVSSSYRYHPLSFIPSSIQFQDGKTNDLQEPSFTSVVK 300
           ++ +    L++SF+ R+ N+  E+          F+     F D K ++   P     VK
Sbjct: 258 LEDETKHHLEQSFHTRLPNLDNEIK---------FLNCLKPFYDDKLDEEDVPGLMCSVK 308

Query: 301 IFNSNDKFGLEQSIVNGVKMGAYTKKSKPLSKNAMTIVSRTFQWNIFKNIMPEFEQYSYL 360
           +F   D F  E++I+NGV+ G YTK SKPL K+  + VSR  QW +FK I PE+E  SYL
Sbjct: 309 LFM--DDFSTEEAILNGVRNGFYTKSSKPLRKHCQSQVSRFAQWELFKKIRPEYEGISYL 366

Query: 361 TFKRFQTDRIETRNRIRKCLSQDGWISTFNDDI 393
            FK  Q  R +    I+  LS DGWI T  DD+
Sbjct: 367 EFKSRQKKRSQLIIAIKNILSPDGWIPTRTDDV 399

>TPHA0G03640 Chr7 complement(774037..775227) [1191 bp, 396 aa] {ON}
           Anc_3.566 YGL243W
          Length = 396

 Score =  271 bits (694), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 152/392 (38%), Positives = 215/392 (54%), Gaps = 17/392 (4%)

Query: 6   LGDKIAALLFREYXXXXXXXXXXXXXXXXXEWTIISGIVAVSNKDTNIIKVISLATGVKA 65
           + +K++A +  EY                 EWT+++GI+A++N +T   + I++ TGVKA
Sbjct: 16  IAEKVSATVHGEYSKLRPSSKPVIKSNSVPEWTVLAGIIAINN-ETGEFETIAITTGVKA 74

Query: 66  TPDSELKRSQGSIVHDCHAEILAIRGFNTTLLREIENKEIDDTNSCDLIYKVENSKCKKY 125
           TPD++L RSQG I+HDCHAEILA+R FN  LL  I      D  S      V+ +K   Y
Sbjct: 75  TPDADLDRSQGKIIHDCHAEILALRCFNIFLLDTINRISNHDGTS----KFVQVTKTNSY 130

Query: 126 SWNDEYDLGLYISKLPCGDXXXXXXXXXXXXXXIQFQENDLTQYVDPTIRTILRGRINYN 185
            WN ++DL LYISKLPCGD               +  +++  QY+DP  +T +RGR+NY 
Sbjct: 131 EWNKKWDLALYISKLPCGDASMDDLMKVGDTAEFEITDDNPLQYIDPKNKTTIRGRLNYK 190

Query: 186 KSGCVRTKPGRIDSEITFSKSCSDKICIKQVXXXXXXXXXXXXXXPIYIKYLVCPDIKPQ 245
           K   +RTKPGR DS+IT SKSC+DK+C+KQV              PI+++Y++ P I  +
Sbjct: 191 KRDVIRTKPGRYDSKITLSKSCTDKLCMKQVMGILDSTCSLLMKDPIFLQYIIIPRISGK 250

Query: 246 NLILLKKSFNRIENIKLEVSSSYRYHPLSFIPSSIQFQDGK--TNDLQEPSFTSVVKIFN 303
             IL     +R+         ++      FI     F D    T  ++EP+  + +KIF 
Sbjct: 251 ESILKHAFIDRLR------GGNFPVQEFKFISCENHFIDDNHDTTIVREPALVNSIKIFM 304

Query: 304 SNDKFGLEQSIVNGVKMGAYTKKSKPLSKNAMTIVSRTFQWNIFKNI---MPEFEQYSYL 360
            N++  +EQSI+NGVK G Y+K  KPL KN   I+SR  +WN+ K I     E    SYL
Sbjct: 305 DNNRV-MEQSIINGVKNGFYSKPKKPLRKNCEPIISRYSKWNLLKQIEFNRAELLNVSYL 363

Query: 361 TFKRFQTDRIETRNRIRKCLSQDGWISTFNDD 392
            FK   T R+  +  +R  LS DGWI+T  DD
Sbjct: 364 EFKSTLTKRMTLQQEVRSLLSPDGWITTKKDD 395

>TDEL0D06340 Chr4 complement(1138653..1139861) [1209 bp, 402 aa]
           {ON} Anc_3.566 YGL243W
          Length = 402

 Score =  267 bits (682), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 160/395 (40%), Positives = 222/395 (56%), Gaps = 19/395 (4%)

Query: 6   LGDKIAALLFREYXXXXXXXXXXXXXXXXXEWTIISGIVAVSNKDTNI-IKVISLATGVK 64
           LGD+IA L   EY                 EWT++SGIVA+ +   +  ++++S+ TGVK
Sbjct: 10  LGDRIAKLFEDEYLKLSSACKPVIRSNGSKEWTVLSGIVAIDHLSVDKKLRLVSIGTGVK 69

Query: 65  ATPDSELKRSQGSIVHDCHAEILAIRGFNTTLLREIENKEIDDTNSCDLIYKVENSKCKK 124
           A PD+ L+RS G +VHDCHAEILA+RGFNT LL  +     +     DLI +     C  
Sbjct: 70  ALPDATLERSHGRMVHDCHAEILALRGFNTVLLEHMNYMVTEQCGETDLIERTTAGVCIL 129

Query: 125 YSWNDEYDLGLYISKLPCGDXXXXXXXX-----XXXXXXIQFQENDLTQYVDPTIRTILR 179
            S   ++ L LYIS LPCGD                   + F+EN   Q++D  IR+ILR
Sbjct: 130 KS---KWKLALYISTLPCGDASMKDLQTYNNTDTNRKQELTFEENTEIQWIDQKIRSILR 186

Query: 180 GRINYNKSGCVRTKPGRIDSEITFSKSCSDKICIKQVXXXXXXXXXXXXXXPIYIKYLVC 239
           GR NY++ G VRTKPGR DS+ITFSKSCSDK+CIKQV              P+++ YLV 
Sbjct: 187 GRFNYDRLGVVRTKPGRYDSQITFSKSCSDKLCIKQVTSILNSLTWSLMAQPVFLDYLVI 246

Query: 240 PDIKPQNLILLKKSF-NRIENIKLEVSSSYRYHPLSFIPSSIQFQDGKTNDLQEPSFTSV 298
           P++       +  SF +R+  +  +         L  +  ++ F D K++  +EPS  S 
Sbjct: 247 PNLAVDRCQGVHHSFQDRLGRLPQK--------SLELLECNVPFFDNKSSKSEEPSSMSS 298

Query: 299 VKIF-NSNDKFGLEQSIVNGVKMGAYTKKSKPLSKNAMTIVSRTFQWNIFKNIMPEFEQY 357
           VK+F +  ++   EQ+I+NG+K G YTK +KPL KN  + VSR  QW I+ NI P+ +Q 
Sbjct: 299 VKLFLDLPERKCTEQAILNGLKNGFYTKGNKPLRKNCESAVSRLAQWKIYVNIRPDAKQQ 358

Query: 358 SYLTFKRFQTDRIETRNRIRKCLSQDGWISTFNDD 392
           +YL FK   ++R      ++K LS DGWIST NDD
Sbjct: 359 TYLEFKAGLSERNRIIQEVKKVLSPDGWISTRNDD 393

>Suva_7.18 Chr7 (37929..39086) [1158 bp, 385 aa] {ON} YGL243W (REAL)
          Length = 385

 Score =  265 bits (677), Expect = 4e-85,   Method: Compositional matrix adjust.
 Identities = 156/395 (39%), Positives = 222/395 (56%), Gaps = 18/395 (4%)

Query: 3   KRELGDKIAALLFREYXXXXXXXXXXXXXXXXXEWTIISGIVAVS-NKDTNIIKVISLAT 61
           K EL ++I+  +  EY                 EWTI++G+ A++ N   + IKV+S+AT
Sbjct: 4   KDELAEQISTKVIGEYSKLKAVCRPVTRPSGIREWTILAGVAAINRNASADNIKVLSIAT 63

Query: 62  GVKATPDSELKRSQGSIVHDCHAEILAIRGFNTTLLREIENKEIDDTNSCDLIYKVENSK 121
           GVK+ PDSEL+RS+G ++HDCHAEILA+RG NT  L  I  K+ D TN  DLI +  N  
Sbjct: 64  GVKSLPDSELQRSRGKLLHDCHAEILALRGANTVFLNHI--KDWDLTNGDDLI-ESNNEI 120

Query: 122 CKKYSWNDEYDLGLYISKLPCGDXXXXXXXXXXXXXXIQFQENDLT--QYVDPTIRTILR 179
             K+   D+++L LYISKLPCGD                 + +D    QYVDP ++TILR
Sbjct: 121 PPKFRLKDKWELALYISKLPCGDASMDFLNDNCRSDDDFLEIDDDDTFQYVDPDVKTILR 180

Query: 180 GRINYNKSGCVRTKPGRIDSEITFSKSCSDKICIKQVXXXXXXXXXXXXXXPIYIKYLVC 239
           GR+N+ K   VRTKPGR DS IT SKSCSDK+ ++Q               P++++Y+V 
Sbjct: 181 GRLNFGKKSVVRTKPGRYDSNITLSKSCSDKLLMRQSSSILNSLNSALFAQPVFLRYIVI 240

Query: 240 PDIKPQNLILLKKSF-NRIENIKLEVSSSYRYHPLSFIPSSIQFQDGKTNDLQEPSFTSV 298
           P++  +    L++SF NR+          +  H   F+     F D K ++   PS    
Sbjct: 241 PNLDEKTRHTLEQSFHNRL---------PFCSHRFEFLNCHTPFYDDKKDENSVPSLMCS 291

Query: 299 VKIFNSNDKFGLEQSIVNGVKMGAYTKKSKPLSKNAMTIVSRTFQWNIFKNIMPEFEQYS 358
            K+F ++    +E++I+NG+K G YTK  KPL K+  + +SR  QW +F  I PE++  S
Sbjct: 292 TKLFMNDST--VEEAILNGMKNGFYTKPCKPLRKHCESHLSRFAQWELFTQIKPEYKDTS 349

Query: 359 YLTFKRFQTDRIETRNRIRKCLSQDGWISTFNDDI 393
           YL FK  QT+R +    I+  LS DGWI T  DD+
Sbjct: 350 YLQFKAQQTERNQLITLIKGALSPDGWIPTKTDDV 384

>KNAG0I00240 Chr9 (30503..31678) [1176 bp, 391 aa] {ON} Anc_3.566
           YGL243W
          Length = 391

 Score =  265 bits (676), Expect = 8e-85,   Method: Compositional matrix adjust.
 Identities = 153/394 (38%), Positives = 220/394 (55%), Gaps = 16/394 (4%)

Query: 6   LGDKIAALLFREYXXXXXXXXXXXXXXXXXEWTIISGIVAVSNKDTNIIKVISLATGVKA 65
           LG++IA L++ EY                 EWTI+SG+VAV       +++ISL TGVKA
Sbjct: 5   LGNEIADLVYSEYDRLSTSSKPAVRSNGTKEWTILSGLVAVPLHPGPQLRLISLTTGVKA 64

Query: 66  TPDSELKRSQGSIVHDCHAEILAIRGFNTTLLREIENKEIDDTNSCDLIYK-VENSKCKK 124
           TP+ +L+RSQG ++HDCHAEILA+RGFN  LLR+++    +D   CDLI   ++++   K
Sbjct: 65  TPNQDLERSQGRVLHDCHAEILALRGFNYVLLRQMQAARNND--RCDLILPGIQDTN--K 120

Query: 125 YSWNDEYDLGLYISKLPCGDXXXXXXXXXXXXXXIQ--FQENDLTQYVDPTIRTILRGRI 182
           +  N EY L L+IS+LPCGD                    ++D  QY+DP  R++LRGR 
Sbjct: 121 FRLNPEYQLALFISRLPCGDGSMNSLQEQGGLGQDTNGIDDDDPVQYIDPNNRSLLRGRF 180

Query: 183 NYNKSGCVRTKPGRIDSEITFSKSCSDKICIKQVXXXXXXXXXXXXXXPIYIKYLVCPDI 242
           NY K GCVRTKPGR+DS+IT+SKSCSDK+C  Q                +YI YL+ P+I
Sbjct: 181 NYAKKGCVRTKPGRMDSKITYSKSCSDKLCCHQATSILNACTWPLIEEAVYIDYLIVPNI 240

Query: 243 KPQNLILLKKSFNRIENIKLEVSSSYRYHPLSFIPSSIQFQDGKTNDLQEPSFTSVVKIF 302
              +   L++ F      +L  S+++  H +  +     F D + ++ ++PS  S VK++
Sbjct: 241 SASDRNALERCF----TTRLS-SATFPVHKMQILSCGQSFADDQQDEDEQPSSISCVKLY 295

Query: 303 NSNDKFGLEQSIVNGVKMGAYTKKSKPLSKNAMTIVSRTFQWNIFKNIMPEFEQ--YSYL 360
            +  +  LEQ++++G++ G +TK SKPL  N  T VSR  QW +F  + PE      SY 
Sbjct: 296 ITEGE-TLEQAVLSGIRNGFFTKVSKPLRNNCETAVSRLSQWRLFCTLNPEASNKYTSYR 354

Query: 361 TFKRFQTDRIETRNRIRKCLSQ-DGWISTFNDDI 393
            FK     R E   R R  L+    WI T +DD 
Sbjct: 355 DFKSKLVPRAELITRTRSLLTNGQPWIPTCSDDF 388

>KLTH0G00748g Chr7 (51751..52908) [1158 bp, 385 aa] {ON} similar to
           uniprot|P53065 Saccharomyces cerevisiae YGL243W TAD1
           tRNA-specific adenosine deaminase deaminates
           adenosine-37 to inosine in tRNA-Ala
          Length = 385

 Score =  263 bits (672), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 148/388 (38%), Positives = 214/388 (55%), Gaps = 10/388 (2%)

Query: 5   ELGDKIAALLFREYXXXXXXXXXXXXXXXXXEWTIISGIVAVSNKDTNIIKVISLATGVK 64
           E+ DKIA L    Y                 EW +++ +VA+ N+    ++++SLATGVK
Sbjct: 6   EVADKIAELASEYYRKLKPSAKPTVRSNGTKEWNVLACVVAI-NRANEDLRLVSLATGVK 64

Query: 65  ATPDSELKRSQGSIVHDCHAEILAIRGFNTTLLREIENKEIDDTNSCDLIYKVENSKCKK 124
           A P+ +LKRS G I+HDCHAEILA+RGFN  LL++I+  +   ++    +    +     
Sbjct: 65  AAPNEDLKRSNGRILHDCHAEILALRGFNAVLLKQIQLLKDSQSHPVPDLVSSSSDNSGI 124

Query: 125 YSWNDEYDLGLYISKLPCGDXXXXXXXXXXXXXXIQFQENDLTQYVDPTIRTILRGRINY 184
           Y  N+E+   LYIS+ PCGD              I F ++D  QYVD   +TI+RGR NY
Sbjct: 125 YRLNEEWSFALYISRAPCGDASMGLLYDEGC---ISFTDDDRCQYVDDNNKTIIRGRFNY 181

Query: 185 NKSGCVRTKPGRIDSEITFSKSCSDKICIKQVXXXXXXXXXXXXXXPIYIKYLVCPDIKP 244
            K G VRTKPGR DS++T SKSC+DK+C KQV              P++++Y+V P + P
Sbjct: 182 AKKGYVRTKPGRKDSKVTLSKSCTDKLCSKQVLSILNSLTWDLLEAPVFLEYIVIPQL-P 240

Query: 245 QNLILLKKSFNRIENIKLEVSSSYRYHPLSFIPSSIQFQDGKTNDLQEPSFTSVVKIFNS 304
           +   + +  F R  + +++   S     +  +  S +F D KT + Q PS  S + +   
Sbjct: 241 R---VAEADFERAFDTRIK--DSVPMEKVQILSCSQRFDDDKTYENQPPSLMSSILLNII 295

Query: 305 NDKFGLEQSIVNGVKMGAYTKKSKPLSKNAMTIVSRTFQWNIFKNIMPEFEQYSYLTFKR 364
             +   +QSI+NGVK GA+ K   PL KN  T+VSR  QW++FK I    +  +Y  FK 
Sbjct: 296 EGQVTQQQSILNGVKCGAFVKPPNPLKKNCETVVSRASQWSLFKQIKGGVDSQTYREFKS 355

Query: 365 FQTDRIETRNRIRKCLSQDGWISTFNDD 392
            QTDR   + RIR  LS+DGW+ T +DD
Sbjct: 356 QQTDRNALKERIRLALSKDGWVGTESDD 383

>Kwal_47.19263 s47 complement(1160721..1161872) [1152 bp, 383 aa]
           {ON} YGL243W (TAD1) - tRNA-specific adenosine deaminase
           1 (TAD1); Tad1p/scADAT1 [contig 344] FULL
          Length = 383

 Score =  261 bits (667), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 153/394 (38%), Positives = 212/394 (53%), Gaps = 13/394 (3%)

Query: 1   MDK-RELGDKIAALLFREYXXXXXXXXXXXXXXXXXEWTIISGIVAVSNKDTNIIKVISL 59
           MD+  +L DKI+ L F  Y                 EW +++ ++A+       ++++SL
Sbjct: 1   MDQPHDLADKISDLAFSYYEKLKPSAKPVIRSNGVKEWNVLACVIAIGPDQG--LRLVSL 58

Query: 60  ATGVKATPDSELKRSQGSIVHDCHAEILAIRGFNTTLLREIENKEIDDTNSCDLIYKVEN 119
           ATGVK+TP+ ELKRS G I+HDCHAEILA+RGFN  LL++I+            +    +
Sbjct: 59  ATGVKSTPNDELKRSNGRILHDCHAEILALRGFNMVLLKQIQMLVDPKAAVVPDLVSPSS 118

Query: 120 SKCKKYSWNDEYDLGLYISKLPCGDXXXXXXXXXXXXXXIQFQENDLTQYVDPTIRTILR 179
            +  K+   D++   LYIS++PCGD              ++F E+   QYV+P  RTILR
Sbjct: 119 DEDGKFKLGDDWSFALYISRIPCGDASMDLLQSESD---MEFSEDTSCQYVNPCNRTILR 175

Query: 180 GRINYNKSGCVRTKPGRIDSEITFSKSCSDKICIKQVXXXXXXXXXXXXXXPIYIKYLVC 239
           GR NYNK G VRTKPGR DS +T SKSCSDK+C +QV              PI++KY+V 
Sbjct: 176 GRFNYNKRGYVRTKPGRKDSSLTLSKSCSDKLCYRQVMSILNAMTWDLMESPIFLKYIVV 235

Query: 240 PDIKPQNLILLKKSFNRIENIKLEVSSSYRYHPLSFIPSSIQFQDGKTNDLQEPSFTSVV 299
           P +        ++ F      +L      +   L   P   QF D K    Q PS  S +
Sbjct: 236 PKVSNT----ARRGFESAFKDRLREFPGIKSVELLECPK--QFPDDKFELNQVPSSVSGI 289

Query: 300 KIFNSNDKFGLEQSIVNGVKMGAYTKKSKPLSKNAMTIVSRTFQWNIFKNIMPEFEQYSY 359
            + N+ND    +QSI+NGVK GAY ++ KPL KN  T++SR  QW +FK +    ++ SY
Sbjct: 290 -LLNTNDGQPEQQSILNGVKSGAYVREPKPLRKNCETMISRLAQWTLFKKVKDYSDKKSY 348

Query: 360 LTFKRFQTDRIETRNRIRKCLSQDGWISTFNDDI 393
             FK  Q  R   +N++R  LS DGWIST  DD 
Sbjct: 349 QAFKGEQVARNVLKNKVRSSLSSDGWISTGPDDF 382

>CAGL0H07733g Chr8 (754933..756090) [1158 bp, 385 aa] {ON} similar
           to uniprot|P53065 Saccharomyces cerevisiae YGL243w TAD1
          Length = 385

 Score =  251 bits (640), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 152/389 (39%), Positives = 215/389 (55%), Gaps = 18/389 (4%)

Query: 7   GDKIAALLFREYXXXXXXXXXXXXXXXXXEWTIISGIVAVSNKDTNIIKVISLATGVKAT 66
           G KI  L+  EY                 E TI++ ++A S+  T+   ++++ TGVK+T
Sbjct: 8   GTKITELVLSEYEKLSAKGRPVTRSNGAKEGTIVAAVIA-SDTRTDKHSILTITTGVKST 66

Query: 67  PDSELKRSQGSIVHDCHAEILAIRGFNTTLLREIENKEIDDTNSCDLIYKVENSKCKKYS 126
           P+ EL RS+G I+HDCHAEILA+RGFN  LL  I+ + ++   S +LI+   N     + 
Sbjct: 67  PNDELARSKGKILHDCHAEILALRGFNRLLLEHIK-RSMEGIES-NLIHNTPNG----FE 120

Query: 127 WNDEYDLGLYISKLPCGDXXXXXXXXX--XXXXXIQFQENDLTQYVDPTIRTILRGRINY 184
           WN+E +L L+ISKLPCG+                + F+E+D  QY+ P I+TILRGR N+
Sbjct: 121 WNNELELTLFISKLPCGELSMSLLEEMKCEDENSLTFEEDDNQQYITPEIKTILRGRCNF 180

Query: 185 NKSGCVRTKPGRIDSEITFSKSCSDKICIKQVXXXXXXXXXXXXXXPIYIKYLVCPDIKP 244
           NK   VRTKPGRIDS+ T+SKSCSDK+ I+                P+YI   V P+I  
Sbjct: 181 NKRNYVRTKPGRIDSKATYSKSCSDKLYIRHKTSVLNSLTSYMMPTPLYISNYVIPNINS 240

Query: 245 QNLILLKKSFNRIENIKLEVSSSYRYHPLSFIPSSIQFQDGKTNDLQEPSFTSVVKIFNS 304
             +  +   FNR     +++ SS R   L    S  +F D  + +    S +++  +FN 
Sbjct: 241 HQIEEMNLYFNR----PMDLHSSARR--LYIHTSHYKFGDDLSPETPPSSMSALKILFND 294

Query: 305 NDKFGLEQSIVNGVKMGAYTKKSKPLSKNAMTIVSRTFQWNIFKNIMPEFEQYSYLTFK- 363
           ND    E+ I+NGVK G YTK SKPL KN  + VSR   W++F  +  EF+  +YL FK 
Sbjct: 295 NDI--QEEQILNGVKNGYYTKASKPLRKNCESKVSRYSLWSLFITMHREFKDLTYLEFKR 352

Query: 364 RFQTDRIETRNRIRKCLSQDGWISTFNDD 392
           R+  +R E    I+  LS DGW+ST  DD
Sbjct: 353 RYCAERAELIRSIKSSLSSDGWLSTAEDD 381

>Ecym_2596 Chr2 complement(1159583..1160746) [1164 bp, 387 aa] {ON}
           similar to Ashbya gossypii AFR267W
          Length = 387

 Score =  245 bits (626), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 142/391 (36%), Positives = 207/391 (52%), Gaps = 9/391 (2%)

Query: 2   DKRELGDKIAALLFREYXXXXXXXXXXXXXXXXXEWTIISGIVAVSNKDTNIIKVISLAT 61
           + R L + ++ L+ ++Y                 EWT+++GIVA+ +++TN +++IS+AT
Sbjct: 4   NTRLLAEGVSELVIKQYDSLKISNKPSIKSNGIKEWTVLAGIVAI-DENTNELRLISVAT 62

Query: 62  GVKATPDSELKRSQGSIVHDCHAEILAIRGFNTTLLREIENKEIDDTNSCDLIYKVENSK 121
           GVKA P+ EL+RS G ++HD HAEILA+R FN  LL+++     + T +CDL+ +   + 
Sbjct: 63  GVKALPNEELERSHGRMLHDSHAEILALRAFNVVLLKQMALLAANPTETCDLVERCNTTH 122

Query: 122 CKKYSWNDEYDLGLYISKLPCGDXXXXXXXXXXXXXXIQFQENDLTQYVDPTIRTILRGR 181
              Y     + + LYIS+ PCGD              +QF  +D  QY++P IRT LRGR
Sbjct: 123 --PYRMRKRWKIALYISRPPCGDCSMDILGEDDTNY-MQFSFDDCCQYINPGIRTTLRGR 179

Query: 182 INYNKSGCVRTKPGRIDSEITFSKSCSDKICIKQVXXXXXXXXXXXXXXPIYIKYLVCPD 241
            NY+  G  RTKPGR DS+IT SKSCSDK+  KQV              P+++ YLV P 
Sbjct: 180 FNYDCKGVTRTKPGRPDSKITLSKSCSDKLASKQVISILNSTNWKLLETPVFLSYLVLPQ 239

Query: 242 IKPQNLILLKKSFNRIENIKLEVSSSYRYHPLSFIPSSIQFQDGKTNDLQEPSFTSVVKI 301
              +     K S   + N    +      H +  I  S +F   K  + Q P   S V I
Sbjct: 240 HHRE-----KASDGCLRNFHYRLLGLNEVHSIEMIFCSKKFNGDKEEESQTPCPISGVYI 294

Query: 302 FNSNDKFGLEQSIVNGVKMGAYTKKSKPLSKNAMTIVSRTFQWNIFKNIMPEFEQYSYLT 361
                +  +E+ I+NGV  G Y K ++PL KN  +I+SR+  W +F  +       SYL 
Sbjct: 295 NIKPMEMDIEEGILNGVLNGFYVKATRPLRKNCESILSRSSFWTLFTQLGYYVNSNSYLD 354

Query: 362 FKRFQTDRIETRNRIRKCLSQDGWISTFNDD 392
           FK  QT R + + ++R  LS DGWI T  DD
Sbjct: 355 FKSKQTSRNQLKEQVRLHLSSDGWIPTSADD 385

>AFR267W Chr6 (914618..915775) [1158 bp, 385 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGL243W (TAD1)
          Length = 385

 Score =  230 bits (587), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 140/395 (35%), Positives = 198/395 (50%), Gaps = 17/395 (4%)

Query: 1   MDKRELGDKIAALLFREYXXXXXXXXXXXXXXXXXEWTIISGIVAVSNKDTNIIKVISLA 60
           MD  +L + I A + R+Y                 EWT+++G+V V ++ T   +++S A
Sbjct: 1   MDDDKLAEAICAQVIRQYGNFKPSSKPARRSNGSHEWTVLAGVVLV-DRQTAECRLVSAA 59

Query: 61  TGVKATPDSELKRSQGSIVHDCHAEILAIRGFNTTLLREIENKEIDDTNSCDLIYKVENS 120
           TGVKA PD EL+RS G +VHD HAEILA+RGFN  LL++ +      +  CDL   VE +
Sbjct: 60  TGVKALPDKELERSHGRMVHDSHAEILALRGFNAVLLQQAKLVTDGRSAECDL---VEQA 116

Query: 121 KCK-KYSWNDEYDLGLYISKLPCGDXXXXXXXXXXXXXXIQFQENDLTQYVDPTIRTILR 179
           K + ++     +   LYISK PCGD              + F  +D  QYV     T+LR
Sbjct: 117 KTQDRFRLASRWQAALYISKAPCGDCSMDMADDDADE--MTFSPDDPIQYVAEHNYTMLR 174

Query: 180 GRINYNKSGCVRTKPGRIDSEITFSKSCSDKICIKQVXXXXXXXXXXXXXXPIYIKYLVC 239
           GR NY++ G  RTKPGR DS+IT SKSCSDK+  K V              P+++ YLV 
Sbjct: 175 GRFNYSRKGVARTKPGRADSQITLSKSCSDKLASKTVMSLLSSMTWELFEEPVFLDYLVL 234

Query: 240 PDIKPQNLILLKKSFNRIENIKLEVSSSYRYHPLSFIPSSIQFQDGKTNDLQEPSFTSVV 299
           P        +    F R    +L  +     H    +     F   +    Q P+ T+ V
Sbjct: 235 PH------TIATAGFERCFAERL--AGLEGTHMPRLLCCHTAFPGDRAAPQQPPALTASV 286

Query: 300 KIFNSNDKFGLEQSIVNGVKMGAYTKKSKPLSKNAMTIVSRTFQWNIFKNIMPEFEQYSY 359
            + N   K  +EQ+++NGV+ GAY +  + L+ +A TIVSR   W +F  +  +    SY
Sbjct: 287 YL-NITAKKHVEQALLNGVRNGAYVRPPRALAAHAETIVSRAALWRVFMQLH-QAPPLSY 344

Query: 360 LTFKRFQTDRIETRNRIRKCLSQDGWISTFNDDII 394
             FKR Q  R   +  +R  LS DGW +T  DD I
Sbjct: 345 AAFKRQQHARNRLKRHVRHRLSPDGWPTTRVDDCI 379

>KLLA0A00759g Chr1 (74187..75329) [1143 bp, 380 aa] {ON} similar to
           uniprot|P53065 Saccharomyces cerevisiae YGL243W TAD1
           tRNA-specific adenosine deaminase deaminates
           adenosine-37 to inosine in tRNA-Ala
          Length = 380

 Score =  227 bits (578), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 144/399 (36%), Positives = 201/399 (50%), Gaps = 32/399 (8%)

Query: 6   LGDKIAALLFREYXXXXXXXXXXXXXXXXXEWTIISGIVAVSNKDTNIIKVISLATGVKA 65
           + D+IAA +   Y                 EWT++SGIVA  ++  +  + ISL TGVKA
Sbjct: 4   IADRIAASVISAYDKLPKSGKPGIRSNGVTEWTVLSGIVAF-DELNDRYEPISLGTGVKA 62

Query: 66  TPDSELKRSQGSIVHDCHAEILAIRGFNTTLLREIENKEIDDTNSCDL-----IYKVENS 120
           TP+ EL+RS G IVHDCHAE++ +R FN  LL+EI          CDL      + +E S
Sbjct: 63  TPNEELQRSNGQIVHDCHAEVICLRAFNALLLKEI----------CDLQNGQKSFLIEKS 112

Query: 121 KCKKYSWNDEYDLGLYISKLPCGDXXXXXXXXXXXXXXIQFQENDLT----QYVDPTIRT 176
               Y   D +   +YIS++PCGD                 Q+        QYV P I T
Sbjct: 113 A-DGYKVKDVWKFAMYISRIPCGDASMNLLEAEDKSECENCQQVGNIFINGQYVHPEIDT 171

Query: 177 ILRGRINYNKSGCVRTKPGRIDSEITFSKSCSDKICIKQVXXXXXXXXXXXXXXPIYIKY 236
           I+RGR NY     VRTKPGR DS+IT SKSCSDK+ +KQ+              P+Y+++
Sbjct: 172 IIRGRANYKLRKVVRTKPGRADSKITLSKSCSDKLTMKQMISICNALTWSLLQSPVYLEW 231

Query: 237 LVCPDIKPQNLILLKKSFN-RIENIKLEVSSSYRYHPLSFIPSSIQFQDGKTNDLQEPSF 295
           +V P       + L+ +F  R++N         ++ P  F+  +  F   +TN  Q+PS 
Sbjct: 232 IVLPKQYQYEQVQLEDTFWLRLKN--------QQFLPFKFLFCNETFSADRTNLSQQPSL 283

Query: 296 TSVVKIFNSNDKFGLEQSIVNGVKMGAYTKKSKPLSKNAMTIVSRTFQWNIFKNIMPEFE 355
           +S V ++ SN+   + + I+NGVK G Y K  KPL K   +I+SR  QW+ FK I     
Sbjct: 284 SSCVSLYGSNE--AVSEVILNGVKNGFYVKGKKPLRKGCQSIISRCAQWSAFKKIKAMPS 341

Query: 356 QYSYLTFKRFQTDRIETRNRIRKCLSQDGWISTFNDDII 394
              Y  FK    DR    ++ +  LS  GWIST  D+ I
Sbjct: 342 DTDYYGFKSSVVDRNHIISKAKATLSASGWISTCRDNCI 380

>TDEL0F00150 Chr6 (12055..13737) [1683 bp, 560 aa] {ON} 
          Length = 560

 Score = 32.0 bits (71), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 12/49 (24%), Positives = 28/49 (57%)

Query: 280 IQFQDGKTNDLQEPSFTSVVKIFNSNDKFGLEQSIVNGVKMGAYTKKSK 328
           ++  DG  N+++  ++ ++++ FN+ND  G    +  G ++    KK+K
Sbjct: 473 VEIHDGPYNNIKNWNYAALMEAFNANDGHGKGFQVKTGAELAEAIKKAK 521

>Smik_7.32 Chr7 (64408..67263) [2856 bp, 951 aa] {ON} YGL227W (REAL)
          Length = 951

 Score = 31.6 bits (70), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 11/38 (28%), Positives = 20/38 (52%)

Query: 349 NIMPEFEQYSYLTFKRFQTDRIETRNRIRKCLSQDGWI 386
           ++ P  + +SY+T++R        RNR+R C    G +
Sbjct: 346 HLQPNPDYHSYMTYERSNASSASARNRLRTCFENSGKV 383

>TDEL0C07020 Chr3 complement(1283600..1285282) [1683 bp, 560 aa]
           {ON} 
          Length = 560

 Score = 31.2 bits (69), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 12/49 (24%), Positives = 28/49 (57%)

Query: 280 IQFQDGKTNDLQEPSFTSVVKIFNSNDKFGLEQSIVNGVKMGAYTKKSK 328
           ++  DG  N+++  ++ ++++ FN+ND  G    +  G ++    KK+K
Sbjct: 473 VEIHDGPYNNIKNWNYAALMEAFNANDGHGKGFQVKTGAELSEAIKKAK 521

>ACR028C Chr3 complement(408701..410506) [1806 bp, 601 aa] {ON}
           NOHBY319; No homolog in Saccharomyces cerevisiae
          Length = 601

 Score = 30.8 bits (68), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 14/46 (30%), Positives = 26/46 (56%)

Query: 78  IVHDCHAEILAIRGFNTTLLREIENKEIDDTNSCDLIYKVENSKCK 123
           +V    A  L +RGF  TLLRE++  ++ D   C+++  V + + +
Sbjct: 430 LVEHEEAVTLELRGFGLTLLRELQVCKVTDLELCEIVRDVSDLRLQ 475

>KLLA0F26983g Chr6 (2489326..2490729) [1404 bp, 467 aa] {ON} some
           similarities with uniprot|P32801 Saccharomyces
           cerevisiae YKL048C ELM1 Serine/threonine protein kinase
           that regulates cellular morphogenesis septin behavior
           and cytokinesis required for the regulation of other
           kinases forms part of the bud neck ring
          Length = 467

 Score = 30.8 bits (68), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 34/158 (21%), Positives = 65/158 (41%), Gaps = 36/158 (22%)

Query: 241 DIKPQNLILLKKSFN--RIENIKLEVSSSYRYHPLSFIPSSIQFQDGKTNDLQEPSFTSV 298
           D+KPQN ILL   ++  RI +    +           +PS + F+DG+  DL E     +
Sbjct: 234 DLKPQN-ILLDPVYHSLRISDFGCSL----------IVPSKLPFKDGRLQDLFEKELNKI 282

Query: 299 V--KIFNSNDKFGLEQSIVNGVKMGAYTKKSKPLSKNAMTIVSRTFQWNIFKNIMP---- 352
           V   +F + +       + N  +  A+    +P   +  ++    +   I  N++P    
Sbjct: 283 VGTPLFTAPE-------LCNFAEGSAHASNEQPFKIDVWSLGITVYA--ILYNVLPFWGE 333

Query: 353 -EFEQYSYLTFKRFQTDRIETRNRIRKCLSQDGWISTF 389
            EF+ Y+ +  ++ + D   + N         GWI  +
Sbjct: 334 TEFDTYNLICHRQLKPDVHNSSNIY-------GWIHEY 364

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.136    0.399 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 39,024,938
Number of extensions: 1635776
Number of successful extensions: 4460
Number of sequences better than 10.0: 29
Number of HSP's gapped: 4501
Number of HSP's successfully gapped: 29
Length of query: 394
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 282
Effective length of database: 40,638,807
Effective search space: 11460143574
Effective search space used: 11460143574
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 67 (30.4 bits)