Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0E002203.567ON57057024900.0
Smik_7.173.567ON56556813750.0
NDAI0I032403.567ON56355613670.0
YGL244W (RTF1)3.567ON55856113610.0
Skud_7.233.567ON56455913480.0
Kpol_507.103.567ON46147013321e-180
Suva_7.173.567ON56956813431e-180
TPHA0A060003.567ON54955013051e-175
Ecym_25973.567ON56256312641e-168
CAGL0H07711g3.567ON56649612311e-163
AFR266W3.567ON56256512231e-162
NCAS0E002603.567ON55832211441e-150
TDEL0D063503.567ON56532211321e-148
KAFR0J028803.567ON55532211271e-148
KLTH0G00726g3.567ON56132211211e-147
Kwal_47.192653.567ON56732210981e-143
KNAG0I002303.567ON57132510981e-143
SAKL0F00814g3.567ON57432210841e-141
ZYRO0E09526g3.567ON56032210601e-137
KLLA0A00737g3.567ON58232410381e-134
YNL020C (ARK1)2.284ON63836714.4
Suva_14.1172.16ON581109714.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0E00220
         (570 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0E00220 Chr5 (32538..34250) [1713 bp, 570 aa] {ON} Anc_3.567...   963   0.0  
Smik_7.17 Chr7 (36297..37994) [1698 bp, 565 aa] {ON} YGL244W (REAL)   534   0.0  
NDAI0I03240 Chr9 complement(760626..762317) [1692 bp, 563 aa] {O...   531   0.0  
YGL244W Chr7 (41498..43174) [1677 bp, 558 aa] {ON}  RTF1Subunit ...   528   0.0  
Skud_7.23 Chr7 (45674..47368) [1695 bp, 564 aa] {ON} YGL244W (REAL)   523   0.0  
Kpol_507.10 s507 (57107..58492) [1386 bp, 461 aa] {ON} (57107..5...   517   e-180
Suva_7.17 Chr7 (36045..37754) [1710 bp, 569 aa] {ON} YGL244W (REAL)   521   e-180
TPHA0A06000 Chr1 complement(1356928..1358577) [1650 bp, 549 aa] ...   507   e-175
Ecym_2597 Chr2 complement(1160898..1162586) [1689 bp, 562 aa] {O...   491   e-168
CAGL0H07711g Chr8 (752900..754600) [1701 bp, 566 aa] {ON} highly...   478   e-163
AFR266W Chr6 (912847..914535) [1689 bp, 562 aa] {ON} Syntenic ho...   475   e-162
NCAS0E00260 Chr5 (38732..40408) [1677 bp, 558 aa] {ON} Anc_3.567...   445   e-150
TDEL0D06350 Chr4 complement(1140059..1141756) [1698 bp, 565 aa] ...   440   e-148
KAFR0J02880 Chr10 complement(547671..549338) [1668 bp, 555 aa] {...   438   e-148
KLTH0G00726g Chr7 (49910..51595) [1686 bp, 561 aa] {ON} similar ...   436   e-147
Kwal_47.19265 s47 complement(1162019..1163722) [1704 bp, 567 aa]...   427   e-143
KNAG0I00230 Chr9 (28626..30341) [1716 bp, 571 aa] {ON} Anc_3.567...   427   e-143
SAKL0F00814g Chr6 (72843..74567) [1725 bp, 574 aa] {ON} similar ...   422   e-141
ZYRO0E09526g Chr5 complement(758296..759978) [1683 bp, 560 aa] {...   412   e-137
KLLA0A00737g Chr1 (72233..73981) [1749 bp, 582 aa] {ON} similar ...   404   e-134
YNL020C Chr14 complement(595623..597539) [1917 bp, 638 aa] {ON} ...    32   4.4  
Suva_14.117 Chr14 complement(216958..218703) [1746 bp, 581 aa] {...    32   4.4  

>TBLA0E00220 Chr5 (32538..34250) [1713 bp, 570 aa] {ON} Anc_3.567
           YGL244W
          Length = 570

 Score =  963 bits (2490), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 482/570 (84%), Positives = 482/570 (84%)

Query: 1   MSDIXXXXXXXXXXXXXXXXXTLMVSSKKRARNNDSSSKRRKIXXXXXXXXXXXXYNPVF 60
           MSDI                 TLMVSSKKRARNNDSSSKRRKI            YNPVF
Sbjct: 1   MSDIDEDLLALAGADEEEEEDTLMVSSKKRARNNDSSSKRRKIEVDNEDEEEEDDYNPVF 60

Query: 61  NEDNNQSTYNTMDGEREEPNPFPLEGKYKDEDDREKIESMPEMERETLLFERSQIMQKYQ 120
           NEDNNQSTYNTMDGEREEPNPFPLEGKYKDEDDREKIESMPEMERETLLFERSQIMQKYQ
Sbjct: 61  NEDNNQSTYNTMDGEREEPNPFPLEGKYKDEDDREKIESMPEMERETLLFERSQIMQKYQ 120

Query: 121 ERKMFRERSRKQMSLNNNSNLTGQKXXXXXXXXXXXGLSDAKSSKLSQLKRQRERRNKGQ 180
           ERKMFRERSRKQMSLNNNSNLTGQK           GLSDAKSSKLSQLKRQRERRNKGQ
Sbjct: 121 ERKMFRERSRKQMSLNNNSNLTGQKTRTSTRVTHTTGLSDAKSSKLSQLKRQRERRNKGQ 180

Query: 181 SNYSXXXXXXXXXXXXXXXXXKSSGSXXXXXXXXXXXXXXXXLYGSKTKYNHRGSXXXXX 240
           SNYS                 KSSGS                LYGSKTKYNHRGS     
Sbjct: 181 SNYSDEDEYEDEYEDDLEQEYKSSGSDYDENEAAEEEEDDYDLYGSKTKYNHRGSEEDDD 240

Query: 241 XXXXXXXXXXRESNVQDFNKIKIGRSFAFKFCFYPDFNDIVKNCYAKVNVSDDRHKPVYR 300
                     RESNVQDFNKIKIGRSFAFKFCFYPDFNDIVKNCYAKVNVSDDRHKPVYR
Sbjct: 241 DDVKWAEDIDRESNVQDFNKIKIGRSFAFKFCFYPDFNDIVKNCYAKVNVSDDRHKPVYR 300

Query: 301 MVKIEKVFLDKRPHDMGKFFTNQCFGVTQGNNRKVYSMKYFSDSPITHAEFDRYIRTLEH 360
           MVKIEKVFLDKRPHDMGKFFTNQCFGVTQGNNRKVYSMKYFSDSPITHAEFDRYIRTLEH
Sbjct: 301 MVKIEKVFLDKRPHDMGKFFTNQCFGVTQGNNRKVYSMKYFSDSPITHAEFDRYIRTLEH 360

Query: 361 DHITRPSVYAINNKFKEITAFTTEPLTDKLTDQIVRNRMRFNKKLSGTNAVLEKTVLRGK 420
           DHITRPSVYAINNKFKEITAFTTEPLTDKLTDQIVRNRMRFNKKLSGTNAVLEKTVLRGK
Sbjct: 361 DHITRPSVYAINNKFKEITAFTTEPLTDKLTDQIVRNRMRFNKKLSGTNAVLEKTVLRGK 420

Query: 421 LQFAKETGNERDVTKYSAQLRNLEKRLSLYEKHHENDQTGAKKLGQLTSRNRKLNMDKAR 480
           LQFAKETGNERDVTKYSAQLRNLEKRLSLYEKHHENDQTGAKKLGQLTSRNRKLNMDKAR
Sbjct: 421 LQFAKETGNERDVTKYSAQLRNLEKRLSLYEKHHENDQTGAKKLGQLTSRNRKLNMDKAR 480

Query: 481 NVEHKKVELAGFDAKADPFSRLKTRTKIYYQEIQKEENEKAQELAHKKQLEEDAEAKAQS 540
           NVEHKKVELAGFDAKADPFSRLKTRTKIYYQEIQKEENEKAQELAHKKQLEEDAEAKAQS
Sbjct: 481 NVEHKKVELAGFDAKADPFSRLKTRTKIYYQEIQKEENEKAQELAHKKQLEEDAEAKAQS 540

Query: 541 EKEQLLAEFKCLGGLEKMVGSLNFKFDFDI 570
           EKEQLLAEFKCLGGLEKMVGSLNFKFDFDI
Sbjct: 541 EKEQLLAEFKCLGGLEKMVGSLNFKFDFDI 570

>Smik_7.17 Chr7 (36297..37994) [1698 bp, 565 aa] {ON} YGL244W (REAL)
          Length = 565

 Score =  534 bits (1375), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/568 (52%), Positives = 369/568 (64%), Gaps = 48/568 (8%)

Query: 22  TLMVSSKKRARNNDSS-SKRRKIXXXXXXXXXXXX------YNPVFNEDNNQSTYNTMDG 74
            L  +S KRA+NND S SK+R+I                  YNP        S  N   G
Sbjct: 23  VLTTTSAKRAKNNDQSLSKKRRIEVGNAEEDDEEDEDEEDDYNPY-------SVGNASYG 75

Query: 75  --EREEPNPFPLEGKYKDEDDREKIESMPEMERETLLFERSQIMQKYQERKMFRERSR-- 130
             E EEPNPFPLEGKYK+E DRE +ES+PEMERETLLFERSQIMQKYQERK+FR R R  
Sbjct: 76  SEEVEEPNPFPLEGKYKNESDREHLESLPEMERETLLFERSQIMQKYQERKLFRARGRDM 135

Query: 131 KQMSLNNNSNLTGQKXXXXXXXXXXXGLSDAKSSKLSQLKRQRERRNKGQSNYSXXXXXX 190
           K+      ++   +K           G SD K+SKLSQLK+QR R+N+   +YS      
Sbjct: 136 KEQQQRAKNDEDSRKTRTSTRSTHATGHSDIKASKLSQLKKQRARKNR---HYSDNEGEV 192

Query: 191 XXXXXXXXXXXKSS-GSXXXXXXXXXXXXXXXXLYGSKTKYN--HRGS----XXXXXXXX 243
                      K   GS                 YG   +YN   RG             
Sbjct: 193 DDEDEYREDDYKDDEGSE----------------YGDDEEYNPFDRGDLYDKREEEVEWA 236

Query: 244 XXXXXXXRESNVQDFNKIKIGRSFAFKFCFYPDFNDIVKNCYAKVNVSDDRH--KPVYRM 301
                  RE  + DFNK++IGRSF  KFCFYP F D+VK CY +VNV  D+   K  YRM
Sbjct: 237 EEEDELDREPEISDFNKVRIGRSFVAKFCFYPGFEDVVKGCYGRVNVGTDKRTGKTSYRM 296

Query: 302 VKIEKVFLDKRPHDMGKFFTNQCFGVTQGNNRKVYSMKYFSDSPITHAEFDRYIRTLEHD 361
           V+IE+VFL K P++MGKF+TNQ FGVTQG +RKV+ M YFSD      E+ RY+R L++ 
Sbjct: 297 VRIERVFLQK-PYNMGKFYTNQYFGVTQGKDRKVFQMNYFSDGLFADDEYQRYLRALDNS 355

Query: 362 HITRPSVYAINNKFKEITAFTTEPLTDKLTDQIVRNRMRFNKKLSGTNAVLEKTVLRGKL 421
            I +PS++++NNK KE+  F   PLTDK TD++VR+RM+FNKKLSGTNAVLEKTVLR KL
Sbjct: 356 QIVKPSLHSLNNKTKEVMDFVNTPLTDKTTDEVVRHRMQFNKKLSGTNAVLEKTVLREKL 415

Query: 422 QFAKETGNERDVTKYSAQLRNLEKRLSLYEKHHENDQTGAKKLGQLTSRNRKLNMDKARN 481
           Q+AKET NE+D+ KYSAQLRN EKR+S+YEKHHENDQ+  KKLG+LTS+NRKLNM   RN
Sbjct: 416 QYAKETNNEKDIAKYSAQLRNFEKRMSVYEKHHENDQSDIKKLGELTSKNRKLNMSNIRN 475

Query: 482 VEH-KKVELAGFDAKADPFSRLKTRTKIYYQEIQKEENEKAQELAHKKQLEEDAEAKAQS 540
            EH KK ++  FD+K+DPFSRLKTRTK+YYQEIQKEEN KA+E+A +++L+ED  AK + 
Sbjct: 476 AEHVKKEDVNNFDSKSDPFSRLKTRTKVYYQEIQKEENAKAKEIAQQEKLQEDKVAKEKR 535

Query: 541 EKEQLLAEFKCLGGLEKMVGSLNFKFDF 568
           EKE LLA+F+ LGGLE+M+G L+ KFDF
Sbjct: 536 EKELLLAQFRRLGGLERMIGELDIKFDF 563

>NDAI0I03240 Chr9 complement(760626..762317) [1692 bp, 563 aa] {ON}
           Anc_3.567 YGL244W
          Length = 563

 Score =  531 bits (1367), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/556 (53%), Positives = 360/556 (64%), Gaps = 24/556 (4%)

Query: 23  LMVSSKKRARNNDS-SSKRRKIXXXXXXXXXXXX-YNPVFNEDNNQSTYNTMDGEREEPN 80
           L+ +S KRA+N+D   SKR+KI             YNP      NQS    +D    EPN
Sbjct: 24  LLTTSGKRAKNHDQVGSKRKKIEVDSEAEEEEEDDYNPY---GGNQSEEEEID----EPN 76

Query: 81  PFPLEGKYKDEDDREKIESMPEMERETLLFERSQIMQKYQERKMFRERSR--KQMSLNNN 138
           PFPLE KYKDEDDRE +ES+PEMERETLLFERSQ+M+KYQERK+FRER R  K+    N 
Sbjct: 77  PFPLENKYKDEDDREHLESLPEMERETLLFERSQVMRKYQERKLFRERQRNIKEQQERNE 136

Query: 139 SNLTGQKXXXXXXXXXXXGLSDAKSSKLSQLKRQRERRNKGQSNYSXXXXXXXXXXXXXX 198
               G+K           G SD K+SKLSQLK+QRER+ + Q +Y+              
Sbjct: 137 LEEEGKKTRSSTRATHATGHSDLKASKLSQLKKQRERKTRDQ-DYNDVEDEDDLDDYAPD 195

Query: 199 XXXKSSGSXXXXXXXXXXXXXXXXLYGSKTKYNHRGSXXXXXXXXXXXXXXXRESNVQDF 258
              K   S                 Y ++  Y+                   RE+ + DF
Sbjct: 196 DNYKHEDSEYEEEGEEDEEDYNP--YATRKSYD-----MDKDEVEWAEEQTDREAELDDF 248

Query: 259 NKIKIGRSFAFKFCFYPDFNDIVKNCYAKVNVSDDRHKPV--YRMVKIEKVFLDKRPHDM 316
           NK+K+GRSF  K+CFYP F+D++K CY +VNV  DR   +  YRMVKIEKVFL K P+ M
Sbjct: 249 NKVKVGRSFIAKYCFYPGFSDLLKGCYGRVNVGTDRRTGISSYRMVKIEKVFL-KGPYRM 307

Query: 317 GKFFTNQCFGVTQGNNRKVYSMKYFSDSPITHAEFDRYIRTLEHDHITRPSVYAINNKFK 376
           G FFTNQ  GVTQG++RKV  M  FSD   T AEFDRY R LE+ H+T+PS++ +  K K
Sbjct: 308 GDFFTNQYLGVTQGHDRKVLQMNIFSDGLFTSAEFDRYTRALENSHLTKPSIHVLRGKSK 367

Query: 377 EITAFTTEPLTDKLTDQIVRNRMRFNKKLSGTNAVLEKTVLRGKLQFAKETGNERDVTKY 436
           EI AF +EPLT K+TD IVRNRM FNKKLSGTNAVLEKTVL+ KL++A+E  NERDV KY
Sbjct: 368 EIQAFVSEPLTAKMTDAIVRNRMMFNKKLSGTNAVLEKTVLKDKLRYARENNNERDVAKY 427

Query: 437 SAQLRNLEKRLSLYEKHHENDQTGAKKLGQLTSRNRKLNMDKARNVEHKKVELAGFDAKA 496
           S+QLRNLEKR+S+YEKHHENDQ G  KLG LTS+NRK+NMDK RN EH K E  G D+K+
Sbjct: 428 SSQLRNLEKRMSVYEKHHENDQLGMNKLGALTSKNRKVNMDKIRNAEHIKKEDHGLDSKS 487

Query: 497 DPFSRLKTRTKIYYQEIQKEENEKAQELAH--KKQLEEDAEAKAQSEKEQLLAEFKCLGG 554
           DPFSRLKTRTKIYYQE+QKEENEKAQ +A   +KQL+E+       EKE LLA FK LGG
Sbjct: 488 DPFSRLKTRTKIYYQEVQKEENEKAQAMAEAKQKQLQENKALNEHKEKELLLARFKRLGG 547

Query: 555 LEKMVGSLNFKFDFDI 570
           LE ++ +L+    FDI
Sbjct: 548 LENLIQNLDINVTFDI 563

>YGL244W Chr7 (41498..43174) [1677 bp, 558 aa] {ON}  RTF1Subunit of
           RNAPII-associated chromatin remodeling Paf1 complex;
           regulates gene expression by directing cotranscriptional
           histone modification, influences transcription and
           chromatin structure through several independent
           functional domains; directly or indirectly regulates
           DNA-binding properties of Spt15p and relative activities
           of different TATA elements; involved in transcription
           elongation as demonstrated by the G-less-based run-on
           (GLRO) assay
          Length = 558

 Score =  528 bits (1361), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/561 (52%), Positives = 365/561 (65%), Gaps = 41/561 (7%)

Query: 22  TLMVSSKKRARNNDSS-SKRRKIXX-XXXXXXXXXXYNP--VFNEDNNQSTYNTMDGERE 77
            L  +S KRA+NND S SK+R+I             YNP  V N D           E E
Sbjct: 23  VLTTTSAKRAKNNDQSLSKKRRIEVGSVEDDDEEDDYNPYSVGNADYGSE-------EEE 75

Query: 78  EPNPFPLEGKYKDEDDREKIESMPEMERETLLFERSQIMQKYQERKMFRERSR--KQMSL 135
           E NPFPLEGKYKDE DRE +ES+PEMERETLLFERSQIMQKYQERK+FR R R  K+   
Sbjct: 76  EANPFPLEGKYKDESDREHLESLPEMERETLLFERSQIMQKYQERKLFRARGRDMKEQQQ 135

Query: 136 NNNSNLTGQKXXXXXXXXXXXGLSDAKSSKLSQLKRQRERRNKGQSNYSXXXXXXXXXXX 195
              ++   +K           G SD K+SKLSQLK+QR R+N+   +YS           
Sbjct: 136 RAKNDEDSRKTRASTRSTHATGHSDIKASKLSQLKKQRARKNR---HYSDNEDEDDEEDY 192

Query: 196 XXXXXXKSSGSXXXXXXXXXXXXXXXXLYGSKTKYN---HRGS--XXXXXXXXXXXXXXX 250
                    GS                 YG   +YN    R +                 
Sbjct: 193 REEDYKDDEGSE----------------YGDDEEYNPFDRRDTYDKREEVEWAEEEDEQD 236

Query: 251 RESNVQDFNKIKIGRSFAFKFCFYPDFNDIVKNCYAKVNVSDDRH--KPVYRMVKIEKVF 308
           RE  + DFNK++IGRSF  KFCFYP F D VK CY +VNV  D+   K  YRMV+IE+VF
Sbjct: 237 REPEISDFNKLRIGRSFVAKFCFYPGFEDAVKGCYGRVNVGTDKRTGKTSYRMVRIERVF 296

Query: 309 LDKRPHDMGKFFTNQCFGVTQGNNRKVYSMKYFSDSPITHAEFDRYIRTLEHDHITRPSV 368
           L K P++MGKF+TNQ FGVTQG +RKV+ M YFSD      E+ RY+R L++  + +PS+
Sbjct: 297 LQK-PYNMGKFYTNQYFGVTQGKDRKVFQMNYFSDGLFAEDEYQRYLRALDNSQMIKPSL 355

Query: 369 YAINNKFKEITAFTTEPLTDKLTDQIVRNRMRFNKKLSGTNAVLEKTVLRGKLQFAKETG 428
           ++++NK KE+  F   PLTDK TD++VR+RM+FNKKLSGTNAVLEKTVLR KLQ+AKET 
Sbjct: 356 HSLSNKTKEVMDFVNTPLTDKTTDEVVRHRMQFNKKLSGTNAVLEKTVLREKLQYAKETN 415

Query: 429 NERDVTKYSAQLRNLEKRLSLYEKHHENDQTGAKKLGQLTSRNRKLNMDKARNVEH-KKV 487
           NE+D+ KYSAQLRN EKR+S+YEKHHENDQ+  KKLG+LTS+NRKLNM   RN EH KK 
Sbjct: 416 NEKDIAKYSAQLRNFEKRMSVYEKHHENDQSDIKKLGELTSKNRKLNMSNIRNAEHVKKE 475

Query: 488 ELAGFDAKADPFSRLKTRTKIYYQEIQKEENEKAQELAHKKQLEEDAEAKAQSEKEQLLA 547
           +   FD+K+DPFSRLKTRTK+YYQEIQKEEN KA+E+A +++L+ED +AK + EKE L+A
Sbjct: 476 DSNNFDSKSDPFSRLKTRTKVYYQEIQKEENAKAKEIAQQEKLQEDKDAKDKREKELLVA 535

Query: 548 EFKCLGGLEKMVGSLNFKFDF 568
           +F+ LGGLE+MVG L+ KFD 
Sbjct: 536 QFRRLGGLERMVGELDIKFDL 556

>Skud_7.23 Chr7 (45674..47368) [1695 bp, 564 aa] {ON} YGL244W (REAL)
          Length = 564

 Score =  523 bits (1348), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/559 (51%), Positives = 361/559 (64%), Gaps = 31/559 (5%)

Query: 22  TLMVSSKKRARNNDSS-SKRRKIXXXXXXXXXXXX-----YNPVFNEDNNQSTYNTMDG- 74
            L  +S KRA+NND S SK+R+I                 YNP        S  N   G 
Sbjct: 23  VLTSTSAKRAKNNDQSVSKKRRIEVDSAEEEDEEDEEEDDYNPY-------SVGNAGYGS 75

Query: 75  EREEPNPFPLEGKYKDEDDREKIESMPEMERETLLFERSQIMQKYQERKMFRERSR--KQ 132
           E EE NPFPLEGK+KDE+DRE +ES+PEMERETLLFERSQIMQKYQERK+FR R R  K+
Sbjct: 76  EGEEANPFPLEGKFKDENDREHLESLPEMERETLLFERSQIMQKYQERKLFRARGRDMKE 135

Query: 133 MSLNNNSNLTGQKXXXXXXXXXXXGLSDAKSSKLSQLKRQRERRNKGQSNYSXXXXXXXX 192
                      +K           G SD K+SKLSQLK+QR R+N+    YS        
Sbjct: 136 QQQRAKDKEDSRKTRTSTRSTHATGHSDIKASKLSQLKKQRARKNR---QYSDNEDEEDD 192

Query: 193 XXXXXXXXXKSSGSXXXXXXXXXXXXXXXXLYGSKTKYNHRGSXXXXXXXXXXXXXXXRE 252
                    K+                   LY  + +                     RE
Sbjct: 193 EDEYREDNYKNEEESEYEDDEEYNPFDRKDLYDKREE--------EVEWAEEGEDELDRE 244

Query: 253 SNVQDFNKIKIGRSFAFKFCFYPDFNDIVKNCYAKVNVSDDRH--KPVYRMVKIEKVFLD 310
             + D+NK++IGRSF  KFCFYP F D+VK CY +VN+  D+   K  YRMV+IE+VFL 
Sbjct: 245 PEISDYNKLRIGRSFVAKFCFYPGFEDVVKGCYGRVNIGTDKRTGKTSYRMVRIERVFLQ 304

Query: 311 KRPHDMGKFFTNQCFGVTQGNNRKVYSMKYFSDSPITHAEFDRYIRTLEHDHITRPSVYA 370
           K P+ MGKF+TNQ FGVTQG +RKV+ M YFSD      E+ RY + L++ H+ +PS+++
Sbjct: 305 K-PYSMGKFYTNQYFGVTQGKDRKVFQMNYFSDGSFADDEYRRYFKALDNSHMVKPSLHS 363

Query: 371 INNKFKEITAFTTEPLTDKLTDQIVRNRMRFNKKLSGTNAVLEKTVLRGKLQFAKETGNE 430
           ++NK KE+  F   PLTDK TD++VR+RM+FNKKLSGTNAVLEKTVLR KLQ+AKET NE
Sbjct: 364 LSNKTKEVMDFVNTPLTDKTTDEVVRHRMQFNKKLSGTNAVLEKTVLREKLQYAKETNNE 423

Query: 431 RDVTKYSAQLRNLEKRLSLYEKHHENDQTGAKKLGQLTSRNRKLNMDKARNVEH-KKVEL 489
           +D+ KYSAQLRN EKR+S+YEKHHENDQ+  K LG+LTS+NRKLNM   RN EH KK + 
Sbjct: 424 KDIAKYSAQLRNFEKRMSIYEKHHENDQSDIKTLGELTSKNRKLNMSNIRNAEHVKKEDN 483

Query: 490 AGFDAKADPFSRLKTRTKIYYQEIQKEENEKAQELAHKKQLEEDAEAKAQSEKEQLLAEF 549
           + FD+K+DPFSRLKTRTK+YYQEIQKEEN KA+E+A +++L+ED EAK + EKE LLA+F
Sbjct: 484 SNFDSKSDPFSRLKTRTKVYYQEIQKEENAKAKEIAQQEKLQEDKEAKDKREKELLLAQF 543

Query: 550 KCLGGLEKMVGSLNFKFDF 568
           + LGGLE+M+G L+ KFDF
Sbjct: 544 RRLGGLERMIGELDIKFDF 562

>Kpol_507.10 s507 (57107..58492) [1386 bp, 461 aa] {ON}
           (57107..58492) [1386 nt, 462 aa]
          Length = 461

 Score =  517 bits (1332), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 275/470 (58%), Positives = 326/470 (69%), Gaps = 13/470 (2%)

Query: 103 MERETLLFERSQIMQKYQERKMFRERSR--KQMSLNNNSNLTGQKXXXXXXXXXXXGLSD 160
           MERETLLFERSQ+MQKYQ+RK+FRER R  K+   NN S   G+K           G SD
Sbjct: 1   MERETLLFERSQLMQKYQDRKLFRERQRNLKRQQRNNTSAQEGKKTRTSTRSTQATGHSD 60

Query: 161 AKSSKLSQLKRQRERRNKGQSNYSXXXXXXXXXXXXXXXXXKSSGSXXXXXXXXXXXXXX 220
            K+SKLSQLKRQRE+    Q + S                 K  GS              
Sbjct: 61  VKASKLSQLKRQREKNKNRQYSESEGEYEEEEDEDDYDTGYKYDGSEYEEDDEEEYDP-- 118

Query: 221 XXLYGSKTKYNHRGSXXXXXXXXXXXXXXXRESNVQDFNKIKIGRSFAFKFCFYPDFNDI 280
              Y  K +Y                    RES V DFNKIKIGRSF  ++CF+PDFN+I
Sbjct: 119 ---YSRKPRYR---EEEEEEDVKWAEESTNRESQVDDFNKIKIGRSFVARYCFHPDFNEI 172

Query: 281 VKNCYAKVNVSDDR--HKPVYRMVKIEKVFLDKRPHDMGKFFTNQCFGVTQGNNRKVYSM 338
           VK CY +VNV  DR  ++  YRMVKIEKVFL K P++MGKFFTNQ FGVTQG +RKV+ M
Sbjct: 173 VKGCYGRVNVGVDRRTNQTAYRMVKIEKVFLQK-PYNMGKFFTNQYFGVTQGKDRKVFQM 231

Query: 339 KYFSDSPITHAEFDRYIRTLEHDHITRPSVYAINNKFKEITAFTTEPLTDKLTDQIVRNR 398
            +FSD PIT  EFDRY R+L+  + ++PSVY++  K KEI  F +EP+TDKLTD+IVRNR
Sbjct: 232 NFFSDGPITIEEFDRYQRSLDASNASKPSVYSLTQKLKEINEFVSEPMTDKLTDEIVRNR 291

Query: 399 MRFNKKLSGTNAVLEKTVLRGKLQFAKETGNERDVTKYSAQLRNLEKRLSLYEKHHENDQ 458
           M FNKKLSGTNAVLEKTVLRGKLQ+AKE  NERD+ KYS QLRNLEKRLS YEKHHENDQ
Sbjct: 292 MVFNKKLSGTNAVLEKTVLRGKLQYAKENNNERDIAKYSTQLRNLEKRLSTYEKHHENDQ 351

Query: 459 TGAKKLGQLTSRNRKLNMDKARNVEHKKVELAGFDAKADPFSRLKTRTKIYYQEIQKEEN 518
            GA+KLG LTS+NRK+NMDKA+NVEH K E   FD+KADPFSRLKTRTKIYYQE+QKEEN
Sbjct: 352 AGARKLGALTSKNRKVNMDKAKNVEHVKEEDINFDSKADPFSRLKTRTKIYYQEVQKEEN 411

Query: 519 EKAQELAHKKQLEEDAEAKAQSEKEQLLAEFKCLGGLEKMVGSLNFKFDF 568
           EKA+ELA +K+LEED EA A+ E+E LLA+F+ LGGLE ++ S++ +   
Sbjct: 412 EKAKELAQQKKLEEDREAIAKKERELLLAKFRRLGGLESIISSIDIELSI 461

>Suva_7.17 Chr7 (36045..37754) [1710 bp, 569 aa] {ON} YGL244W (REAL)
          Length = 569

 Score =  521 bits (1343), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 290/568 (51%), Positives = 366/568 (64%), Gaps = 44/568 (7%)

Query: 22  TLMVSSKKRARNNDSS-SKRRKIXXXXXXXXXXXX-----YNPVFNEDNNQSTYNTMDGE 75
            L  +S KRA+NND S SK+R+I                 YNP        + Y + + E
Sbjct: 23  VLTSTSAKRAKNNDQSISKKRRIEVGSAEEEEEEDEEEDDYNPY---SVGNTGYGSEEEE 79

Query: 76  REEPNPFPLEGKYKDEDDREKIESMPEMERETLLFERSQIMQKYQERKMFRERSR----K 131
             EPNPFPLEGKYKDE DRE +ES+PEMERETLLFERSQIMQKYQERK+FR R +    +
Sbjct: 80  EVEPNPFPLEGKYKDESDREHLESLPEMERETLLFERSQIMQKYQERKLFRARGKDMKEQ 139

Query: 132 QMSLNNNSNLTGQKXXXXXXXXXXXGLSDAKSSKLSQLKRQRERRNKGQSNYSXXXXXXX 191
           Q       +   +K           G SD K+SKLSQLK+QR R+N+    YS       
Sbjct: 140 QQRKRARDDEDSRKTRTSTRSTHATGHSDIKASKLSQLKKQRARKNR---QYSDSEDEQD 196

Query: 192 XXXXXXXXXXKSS-GSXXXXXXXXXXXXXXXXLYGSKTKYN-------HRGSXXXXXXXX 243
                     K+  GS                 YG   +YN       +           
Sbjct: 197 DQEEYREDDYKNDEGSE----------------YGDDEEYNPFDRKGVYDKREEEVEWAE 240

Query: 244 XXXXXXXRESNVQDFNKIKIGRSFAFKFCFYPDFNDIVKNCYAKVNVSDDRH--KPVYRM 301
                  R+  + DFNK++IGRSF  KFCFYP F D+VK CY +VNV  D+   K  YRM
Sbjct: 241 EEEDELDRDPEISDFNKLRIGRSFVAKFCFYPGFEDVVKGCYGRVNVGTDKRTGKTSYRM 300

Query: 302 VKIEKVFLDKRPHDMGKFFTNQCFGVTQGNNRKVYSMKYFSDSPITHAEFDRYIRTLEHD 361
           V+IE++FL K P++MGKFFTNQ FGVTQG +RKV+ M YFSD   T  E+ RY + L+  
Sbjct: 301 VRIERIFLQK-PYNMGKFFTNQYFGVTQGKDRKVFQMNYFSDGLFTDDEYQRYFKALDGS 359

Query: 362 HITRPSVYAINNKFKEITAFTTEPLTDKLTDQIVRNRMRFNKKLSGTNAVLEKTVLRGKL 421
           H+ +PS++ ++NK KE+  F   PLTDK TD++VR+RM+FNKKLSGTNAVLEKTVLR KL
Sbjct: 360 HMVKPSLHTLSNKTKEVIDFVNTPLTDKTTDEVVRHRMQFNKKLSGTNAVLEKTVLREKL 419

Query: 422 QFAKETGNERDVTKYSAQLRNLEKRLSLYEKHHENDQTGAKKLGQLTSRNRKLNMDKARN 481
           Q+AKET NE+D+ KYSAQLRN EKR+S+YEKHHENDQ+  K LG+LTS+NRKLN+   RN
Sbjct: 420 QYAKETNNEKDIAKYSAQLRNFEKRMSVYEKHHENDQSDIKTLGELTSKNRKLNISNIRN 479

Query: 482 VEH-KKVELAGFDAKADPFSRLKTRTKIYYQEIQKEENEKAQELAHKKQLEEDAEAKAQS 540
            EH KK + + FD+K+DPFSRLKTRTK+YYQEIQKEEN KA+E+A +++L+ED E+K + 
Sbjct: 480 AEHVKKEDTSNFDSKSDPFSRLKTRTKVYYQEIQKEENAKAKEMAQQEKLQEDRESKERR 539

Query: 541 EKEQLLAEFKCLGGLEKMVGSLNFKFDF 568
           EKE LLA+F+ LGGLE+M+G L+ KFDF
Sbjct: 540 EKELLLAQFRRLGGLERMIGELDIKFDF 567

>TPHA0A06000 Chr1 complement(1356928..1358577) [1650 bp, 549 aa]
           {ON} Anc_3.567 YGL244W
          Length = 549

 Score =  507 bits (1305), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 293/550 (53%), Positives = 362/550 (65%), Gaps = 34/550 (6%)

Query: 22  TLMVSSKKRARNN-DSSSKRRKIXXXXXXXXXXXXYNPVFNEDNNQSTYNTMDGEREEPN 80
            ++ S+ KR R+N DS SK+R I            YNP      +    +  D + EE  
Sbjct: 23  VVISSTSKRGRSNEDSVSKKRHINVGEDDEDD---YNPA-----SAGLGDDDDNDDEEEA 74

Query: 81  PFPLEGKYKDEDDREKIESMPEMERETLLFERSQIMQKYQERKMFRERSRKQMSLNNNSN 140
           PFPLEGKY+DE DR+ +ES+PEMERETLLFERSQ+MQKY++R +FRER R       +S 
Sbjct: 75  PFPLEGKYRDERDRDYLESLPEMERETLLFERSQLMQKYKDRMLFRERQRTLKRQRESSE 134

Query: 141 LTGQKXXXXXXXXXXXGLSDAKSSKLSQLKRQRERRNKGQSNYSXXXXXXXXXXXXXXXX 200
              +K           G SD KSSKLSQLK+QRER+N    +YS                
Sbjct: 135 --NRKVRSSTRSSKVTGHSDVKSSKLSQLKKQRERKN--NHHYSDEDDEDEYEEEENIYE 190

Query: 201 XK-SSGSXXXXXXXXXXXXXXXXLYGSKTKYNHRGSXXXXXXXXXXXXXXXRESNVQDFN 259
            K   GS                 Y  K+ Y    +               RESNV DFN
Sbjct: 191 DKYEEGSEYEDESYDP--------YKRKSTY----AEESEEEDVKWADDTDRESNVNDFN 238

Query: 260 KIKIGRSFAFKFCFYPDFNDIVKNCYAKVNVSDDRH--KPVYRMVKIEKVFLDKRPHDMG 317
           KIKIGRSF  K+CFYP FNDIVK+CY +VNV  +++  + +YRMVKIEKVFL K P+ MG
Sbjct: 239 KIKIGRSFVAKYCFYPGFNDIVKDCYGRVNVGVNKNTNQVMYRMVKIEKVFLQK-PYSMG 297

Query: 318 KFFTNQCFGVTQGNNRKVYSMKYFSDSPITHAEFDRYIRTLEHDHITRPSVYAINNKFKE 377
            FFTNQ FGVTQG +RKV+ MK+FSD  IT  E++RY+R LE  ++T PS YA++NKFKE
Sbjct: 298 NFFTNQYFGVTQGKDRKVFQMKFFSDGAITQDEYERYVRALESSNLTIPSTYALSNKFKE 357

Query: 378 ITAFTTEPLTDKLTDQIVRNRMRFNKKLSGTNAVLEKTVLRGKLQFAKETGNERDVTKYS 437
           +  F  EP+T KLTD++VRNRM FNKKLSGTNAVLEKTVLR KL FAK+  +ERD+ KYS
Sbjct: 358 VDEFVNEPMTVKLTDEVVRNRMIFNKKLSGTNAVLEKTVLREKLNFAKQNNSERDIAKYS 417

Query: 438 AQLRNLEKRLSLYEKHHENDQTGAKKLGQLTSRNRKLNMDKAR---NVEHKKVELAGFDA 494
           +QLRNLEKRL  YEKHHENDQ GAKKLG+LTS+NRKLNMDK +   NV+  + E   FD 
Sbjct: 418 SQLRNLEKRLMTYEKHHENDQQGAKKLGKLTSKNRKLNMDKIKYGENVKEDRDE--SFDI 475

Query: 495 KADPFSRLKTRTKIYYQEIQKEENEKAQELAHKKQLEEDAEAKAQSEKEQLLAEFKCLGG 554
           K DPFSRLKTRTK+YYQEIQ+EENEKA+ELA +K+++E+ EA  Q E+E LLA+F+ LGG
Sbjct: 476 KTDPFSRLKTRTKVYYQEIQEEENEKAKELARQKKMQENKEAIEQKERELLLAKFRRLGG 535

Query: 555 LEKMVGSLNF 564
           LE +V +L+ 
Sbjct: 536 LESIVHNLDI 545

>Ecym_2597 Chr2 complement(1160898..1162586) [1689 bp, 562 aa] {ON}
           similar to Ashbya gossypii AFR266W
          Length = 562

 Score =  491 bits (1264), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 274/563 (48%), Positives = 358/563 (63%), Gaps = 40/563 (7%)

Query: 23  LMVSSKKRARNNDSSSKRRKIXXXXXX-------------XXXXXXYNPVFNEDNNQSTY 69
           +MVSSKKR++N+ + SK+R +                         YNP    D   +  
Sbjct: 21  VMVSSKKRSKNDIAGSKKRMLMDDDDEDDSNDDEDNDVEDSEGEDDYNPGTQYDFEGNDD 80

Query: 70  NTMDGEREEPNPFPLEGKYKDEDDREKIESMPEMERETLLFERSQIMQKYQERKMFRERS 129
            + D E+EE NP+PLEGKYKDE+DR +I+ MPEMERETLLFERSQ MQKYQERK+ R+R+
Sbjct: 81  GSGD-EQEERNPYPLEGKYKDEEDRNRIQDMPEMERETLLFERSQEMQKYQERKVLRQRA 139

Query: 130 RK-QMSLNNNSNLTGQKXXXXXXXXXXXGLSDAKSSKLSQLKRQRERRNKGQSNYSXXXX 188
           +  +                        G S+ ++SKLS+L++QR +++ G  +YS    
Sbjct: 140 KSIRAQQQQRQLQKDSTKRSSGRSTRTTGHSELRTSKLSELRKQRAKKS-GNYDYSESEE 198

Query: 189 XXXXXXXXXXXXXKSSGSXXXXXXXXXXXXXXXXLYGSKTKYNHRGSXXXXXXXXXXXXX 248
                            S                 +G K      G              
Sbjct: 199 DE---------------SDQSDNYAESDNDDYDPHHGHKD-----GFSDHDNEVKWAEED 238

Query: 249 XXRESNVQDFNKIKIGRSFAFKFCFYPDFNDIVKNCYAKVNVSDDRHK--PVYRMVKIEK 306
             R++ ++DFNK+KIGRSF  KFCFYPDF + V+ CY +VN+  D+H   P+YRMVKIE+
Sbjct: 239 LDRDAELEDFNKVKIGRSFVAKFCFYPDFAERVQACYGRVNIGLDKHTGLPMYRMVKIER 298

Query: 307 VFLDKRPHDMGKFFTNQCFGVTQGNNRKVYSMKYFSDSPITHAEFDRYIRTLEHDHITRP 366
           VFL K P+ MGKFFTNQ FGVTQG +RKV+ M YFSD PIT  EF+RY+  +    + +P
Sbjct: 299 VFLQK-PYSMGKFFTNQYFGVTQGKDRKVFQMNYFSDGPITQPEFERYLNQMAKYDMNKP 357

Query: 367 SVYAINNKFKEITAFTTEPLTDKLTDQIVRNRMRFNKKLSGTNAVLEKTVLRGKLQFAKE 426
           S+Y +NNK KE+  F ++P+T KLTDQIVRNRM FNKKL+GTNAVLEK+VL+ KLQ+AK+
Sbjct: 358 SLYTLNNKAKELFNFVSQPMTMKLTDQIVRNRMVFNKKLTGTNAVLEKSVLKDKLQYAKD 417

Query: 427 TGNERDVTKYSAQLRNLEKRLSLYEKHHENDQTGAKKLGQLTSRNRKLNMDKARNVEH-K 485
           T NE  V KY+AQL+NLEKR+S YEKHHENDQTG +KLG LTS+NRK+NMDK R  E+ +
Sbjct: 418 TNNESAVAKYAAQLKNLEKRMSSYEKHHENDQTGIRKLGALTSKNRKVNMDKIRLAENVR 477

Query: 486 KVELAGFDAKADPFSRLKTRTKIYYQEIQKEENEKAQELAHKKQLEEDAEAKAQSEKEQL 545
           K + +  DAK+DPFSRLKTRTKIYYQEIQ+EENEKA ELA +K  E+D E +   E++ L
Sbjct: 478 KEDSSNVDAKSDPFSRLKTRTKIYYQEIQQEENEKAMELAKQKHQEQDKETQENKERQLL 537

Query: 546 LAEFKCLGGLEKMVGSLNFKFDF 568
           LA+F+ LGGLE++V S+ FK + 
Sbjct: 538 LAKFRRLGGLEEIVSSIPFKIEL 560

>CAGL0H07711g Chr8 (752900..754600) [1701 bp, 566 aa] {ON} highly
           similar to uniprot|P53064 Saccharomyces cerevisiae
           YGL244w RTF1
          Length = 566

 Score =  478 bits (1231), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 267/496 (53%), Positives = 335/496 (67%), Gaps = 10/496 (2%)

Query: 80  NPFPLEGKYKDEDDREKIESMPEMERETLLFERSQIMQKYQERKMFRERSRKQMSLNNNS 139
           NPFPLEGKYKD  DR+ +ES+PEMERET+LFERSQ+M+KYQERK+FRER R        +
Sbjct: 76  NPFPLEGKYKDTADRDHLESLPEMERETILFERSQVMRKYQERKLFRERGRNLKQQKIQA 135

Query: 140 NLTGQKXXXXXXXXXXXGLSDAKSSKLSQLKRQRERRNKGQ--SNYSXXXXXXXXXXXXX 197
               QK           G SD K+SKLSQLK+QRER++KG+  S+Y              
Sbjct: 136 GEDSQKTRSSNRSTRATGHSDIKASKLSQLKKQRERKSKGRRSSDYEESDEDNYGDEDEF 195

Query: 198 XXXXKSSGSXXXXXXXXXXXXXXXXLYGSKTKYNHRGSXXXXXXXXXXXXXXXRESNVQD 257
                   S                 Y  K+KY    +               R++ VQD
Sbjct: 196 KDDFIEEDSDYKENDDDEEGYDP---YARKSKYAQD-NDEEEDEEVEWAEQLDRDAEVQD 251

Query: 258 FNKIKIGRSFAFKFCFYPDFNDIVKNCYAKVNVSDDRH--KPVYRMVKIEKVFLDKRPHD 315
           FNKI+IGRSF  K+CFYP FN++++ CY +VNV  D+      YRMVKIEKVFL K P++
Sbjct: 252 FNKIRIGRSFVAKYCFYPGFNELIQGCYGRVNVGVDKRTGNAAYRMVKIEKVFLQK-PYN 310

Query: 316 MGKFFTNQCFGVTQGNNRKVYSMKYFSDSPITHAEFDRYIRTLEHDHITRPSVYAINNKF 375
           MGKFFTNQ FGVTQG +RKV+ M +FSD P    EF+RY++ L+  +I +PS Y I  KF
Sbjct: 311 MGKFFTNQYFGVTQGKDRKVFQMNFFSDGPFVEQEFERYLKALDSSNIPKPSPYNIKTKF 370

Query: 376 KEITAFTTEPLTDKLTDQIVRNRMRFNKKLSGTNAVLEKTVLRGKLQFAKETGNERDVTK 435
           KEI+ F ++PLT+KLTD+IVRNRM  NKKLSGTNAVLEKT+L+ KL++AKE GNE D+ K
Sbjct: 371 KEISEFISQPLTEKLTDEIVRNRMVLNKKLSGTNAVLEKTILKDKLRYAKENGNEHDIAK 430

Query: 436 YSAQLRNLEKRLSLYEKHHENDQTGAKKLGQLTSRNRKLNMDKARNVEH-KKVELAGFDA 494
           YS QLRN EKR+++YEKHHENDQ   KKL  LTS+NRKLNM++ RN E  KK E   FD+
Sbjct: 431 YSKQLRNFEKRMAMYEKHHENDQADIKKLEGLTSKNRKLNMNRIRNAESIKKEEDVNFDS 490

Query: 495 KADPFSRLKTRTKIYYQEIQKEENEKAQELAHKKQLEEDAEAKAQSEKEQLLAEFKCLGG 554
           K+DPFSRLKTRTK+YYQEIQKEENEKA+E A ++QL+ D E K + EK+ +LAEF+ LGG
Sbjct: 491 KSDPFSRLKTRTKVYYQEIQKEENEKAKEEAAQEQLKIDEETKKEKEKQLMLAEFRRLGG 550

Query: 555 LEKMVGSLNFKFDFDI 570
           L+K++GS+N     DI
Sbjct: 551 LQKIIGSINVDIKLDI 566

>AFR266W Chr6 (912847..914535) [1689 bp, 562 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGL244W (RTF1)
          Length = 562

 Score =  475 bits (1223), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 272/565 (48%), Positives = 356/565 (63%), Gaps = 49/565 (8%)

Query: 25  VSSKKRARNNDSSSKRRKIXXXXXXXXXXXX-------------YNPVFNEDNNQSTYNT 71
           V+S+KR++++ S SK+R++                         YNP   E      +  
Sbjct: 26  VTSQKRSKHDSSGSKKRRVMDEESGDDEDNDNDAGDEEDEDEDDYNPG-TEYGFDEGHEA 84

Query: 72  MDGEREEPNPFPLEGKYKDEDDREKIESMPEMERETLLFERSQIMQKYQERKMFRERSRK 131
            + E EE NP+PL GKY+D+ DRE IE+MPEMERETLLFERSQ MQKYQERK+ RER++ 
Sbjct: 85  SEDEVEEENPYPLLGKYRDDADREHIENMPEMERETLLFERSQEMQKYQERKVLRERAKN 144

Query: 132 -QMSLNNNSNLTGQKXXXXXXXXXXXGLSDAKSSKLSQLKRQRERRNKGQSNYSXXXXXX 190
            +          G             G SD + SKLS+L++QR +++ G  +Y       
Sbjct: 145 IRAQQQRRQQKDGSALRSSGRSTRTTGHSDLRDSKLSELRKQRAKKS-GNYDY------- 196

Query: 191 XXXXXXXXXXXKSSGSXXXXXXXXXXXXXXXXLYGSKTKYNHRGSX---XXXXXXXXXXX 247
                       S+G                  Y       H G                
Sbjct: 197 ------------SAGEDDSDHSDDYVDSDNEDDYDP-----HDGRQLYREEADEVKWAED 239

Query: 248 XXXRESNVQDFNKIKIGRSFAFKFCFYPDFNDIVKNCYAKVNVSDDRH--KPVYRMVKIE 305
              R++ + DFNKIK+GRSF  KFCFYP+FN  V+ CY +VN+  D+H  + +YRMVKIE
Sbjct: 240 DLDRDAELDDFNKIKVGRSFVAKFCFYPEFNQRVQGCYGRVNIGVDKHTGQAMYRMVKIE 299

Query: 306 KVFLDKRPHDMGKFFTNQCFGVTQGNNRKVYSMKYFSDSPITHAEFDRYIRTLEHDHITR 365
           KVFL K P++MGKFFTNQ FGVTQG +RKV+ M +FSD PI   E++RY+  +    I +
Sbjct: 300 KVFLQK-PYNMGKFFTNQYFGVTQGKDRKVFQMNFFSDGPILQPEYERYLNQIAKHDINK 358

Query: 366 PSVYAINNKFKEITAFTTEPLTDKLTDQIVRNRMRFNKKLSGTNAVLEKTVLRGKLQFAK 425
           PS+Y +NNK K++T F ++P+T KLTDQIVRNRM+FNKKL+GTNAVLEKTVLR KLQ+A+
Sbjct: 359 PSLYTLNNKAKDLTNFVSQPMTPKLTDQIVRNRMQFNKKLTGTNAVLEKTVLRDKLQYAR 418

Query: 426 ETGNERDVTKYSAQLRNLEKRLSLYEKHHENDQTGAKKLGQLTSRNRKLNMDKARNVEH- 484
           +T NE+D+ KYS+QL+NLEKR+S YEKHHENDQTG +KL  LTS+NRK+N+DK R+VE+ 
Sbjct: 419 DTNNEKDIAKYSSQLKNLEKRMSSYEKHHENDQTGIRKLDALTSKNRKVNLDKIRHVENV 478

Query: 485 KKVELAGFDAKADPFSRLKTRTKIYYQEIQKEENEKAQELAHKKQLEEDAEAKAQSEKEQ 544
           KK + A  + K DPFSRLKTRTKIYYQEIQ+EENEKAQELA +KQ ++D E K    K+Q
Sbjct: 479 KKEDSATLNVKTDPFSRLKTRTKIYYQEIQQEENEKAQELAKQKQ-QQDKEEK-HDRKQQ 536

Query: 545 LLAEFKCLGGLEKMVGSLNFKFDFD 569
           LLA+F+ LGGLE  +  L+F+   D
Sbjct: 537 LLAKFRRLGGLEDALSKLDFRIKLD 561

>NCAS0E00260 Chr5 (38732..40408) [1677 bp, 558 aa] {ON} Anc_3.567
           YGL244W
          Length = 558

 Score =  445 bits (1144), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 213/322 (66%), Positives = 261/322 (81%), Gaps = 3/322 (0%)

Query: 251 RESNVQDFNKIKIGRSFAFKFCFYPDFNDIVKNCYAKVNVSDDRHKPV--YRMVKIEKVF 308
           RE+ + DFNK+KIGRSF  K+CFYP FN+++K CY KVNV  DR      YRMVKIEK+F
Sbjct: 238 RETELDDFNKVKIGRSFVAKYCFYPGFNELIKGCYGKVNVGTDRRTGTTSYRMVKIEKIF 297

Query: 309 LDKRPHDMGKFFTNQCFGVTQGNNRKVYSMKYFSDSPITHAEFDRYIRTLEHDHITRPSV 368
           L K P+ MG+FFTNQ FGVTQG+NRKV+ M +FSD   T  EF+RY+R+L+  HIT+PS+
Sbjct: 298 LQK-PYRMGEFFTNQYFGVTQGSNRKVFQMNFFSDGLFTPDEFERYVRSLDTSHITKPSI 356

Query: 369 YAINNKFKEITAFTTEPLTDKLTDQIVRNRMRFNKKLSGTNAVLEKTVLRGKLQFAKETG 428
           Y + NK KEI +F +EPLT++L D IVRNRM FNKKLSGTNAVLEKTVLR KL++A+E  
Sbjct: 357 YTLKNKAKEIQSFISEPLTEQLMDTIVRNRMLFNKKLSGTNAVLEKTVLRDKLRYAQENN 416

Query: 429 NERDVTKYSAQLRNLEKRLSLYEKHHENDQTGAKKLGQLTSRNRKLNMDKARNVEHKKVE 488
           NERDV KYS+QLRNLEKRLS+YEKHHENDQ G+ KLG LTS+NRK+NMDK +N  H+K E
Sbjct: 417 NERDVAKYSSQLRNLEKRLSVYEKHHENDQVGSNKLGALTSKNRKVNMDKIKNTGHEKKE 476

Query: 489 LAGFDAKADPFSRLKTRTKIYYQEIQKEENEKAQELAHKKQLEEDAEAKAQSEKEQLLAE 548
             GFD+K+DPFSRLKTRTKIYYQE+Q+EENEKA+ LA +KQL+E+ EA+A+ E E LLA+
Sbjct: 477 EIGFDSKSDPFSRLKTRTKIYYQEVQQEENEKAKALAAEKQLKENNEAQARKENELLLAK 536

Query: 549 FKCLGGLEKMVGSLNFKFDFDI 570
           F+ LGGLE M+ SLN   +FDI
Sbjct: 537 FRRLGGLENMINSLNLDVNFDI 558

 Score =  121 bits (303), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 77/178 (43%), Positives = 98/178 (55%), Gaps = 6/178 (3%)

Query: 1   MSDIXXXXXXXXXXXXXXXXXTLMVSSKKRARNNDSSSKRRKIXXXXXXXXXXXXYNPVF 60
           MSD+                  ++ +S KRA+N++ +S +RK             Y+P  
Sbjct: 1   MSDLDEDLLALAGADEEEEDEQVLTTSNKRAKNHEHASSKRKKIEVDSEAEEEDDYDPGN 60

Query: 61  NEDNNQSTYNTMDGEREEPNPFPLEGKYKDEDDREKIESMPEMERETLLFERSQIMQKYQ 120
               N S       +    NPFPLEGKYKDE DRE++ES+PEMERETLLFERSQ M+KYQ
Sbjct: 61  FGAGNISEEEEEMEQ----NPFPLEGKYKDEADREQLESLPEMERETLLFERSQTMRKYQ 116

Query: 121 ERKMFRERSR--KQMSLNNNSNLTGQKXXXXXXXXXXXGLSDAKSSKLSQLKRQRERR 176
           ERK+FRER R  K+    N  +  G K           G SD K+SKLSQLK+QRER+
Sbjct: 117 ERKLFRERQRNLKEQQQRNAPSEEGTKTRTSTRTTHATGHSDLKASKLSQLKKQRERK 174

>TDEL0D06350 Chr4 complement(1140059..1141756) [1698 bp, 565 aa]
           {ON} Anc_3.567 YGL244W
          Length = 565

 Score =  440 bits (1132), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 209/322 (64%), Positives = 261/322 (81%), Gaps = 3/322 (0%)

Query: 251 RESNVQDFNKIKIGRSFAFKFCFYPDFNDIVKNCYAKVNVSDDRH--KPVYRMVKIEKVF 308
           RE+++ DFNKIKIGRSF  KFCFYP FND+VK  Y +VNV  D+   +  YRMVKIEKVF
Sbjct: 245 READITDFNKIKIGRSFVAKFCFYPGFNDVVKGHYGRVNVGVDKRSGQTQYRMVKIEKVF 304

Query: 309 LDKRPHDMGKFFTNQCFGVTQGNNRKVYSMKYFSDSPITHAEFDRYIRTLEHDHITRPSV 368
             K P++MG FFTNQ FGVTQG +RKV+ M +FSD   T +E+DRY+R L+  HIT+PS+
Sbjct: 305 FQK-PYNMGNFFTNQYFGVTQGKDRKVFQMNFFSDGNFTQSEYDRYLRALDGVHITKPSM 363

Query: 369 YAINNKFKEITAFTTEPLTDKLTDQIVRNRMRFNKKLSGTNAVLEKTVLRGKLQFAKETG 428
           Y+++NK KE+ AF ++PLTDKLTD IVRNRM FNKKLSG+NAVLEKTVL+ KL++A+ETG
Sbjct: 364 YSLDNKAKEMNAFVSQPLTDKLTDDIVRNRMLFNKKLSGSNAVLEKTVLKEKLRYAQETG 423

Query: 429 NERDVTKYSAQLRNLEKRLSLYEKHHENDQTGAKKLGQLTSRNRKLNMDKARNVEHKKVE 488
           N+RD+ KYS+QLRNL KR+S YEKHHE DQ+G KKLG LTS+NRK+NMD+ RN EH K E
Sbjct: 424 NDRDIAKYSSQLRNLVKRMSAYEKHHETDQSGIKKLGALTSKNRKVNMDRIRNAEHIKKE 483

Query: 489 LAGFDAKADPFSRLKTRTKIYYQEIQKEENEKAQELAHKKQLEEDAEAKAQSEKEQLLAE 548
              FDAK+DPFSRLKTRTK+YYQEIQKEENE+AQ++A +KQL+E  EA A+ EKE L ++
Sbjct: 484 DVNFDAKSDPFSRLKTRTKVYYQEIQKEENERAQDIARQKQLDESEEAIARREKELLSSD 543

Query: 549 FKCLGGLEKMVGSLNFKFDFDI 570
           FK LGGLE+++G +   F FD+
Sbjct: 544 FKRLGGLERVIGQMQLPFTFDV 565

 Score =  116 bits (290), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 77/185 (41%), Positives = 100/185 (54%), Gaps = 9/185 (4%)

Query: 1   MSDIXXXXXXXXXXXXXXXXXTLMVSSKKRARNND-SSSKRRKIXXXXXXXXXXXX---- 55
           MSDI                  ++ +S KR + +D +SSKRRKI                
Sbjct: 1   MSDIEEDLLALAGADEEEDEDEVLTTSAKRNKTSDNASSKRRKIAVEGAEEDEDEDEDEE 60

Query: 56  --YNPV-FNEDNNQSTYNTMDGEREEPNPFPLEGKYKDEDDREKIESMPEMERETLLFER 112
             YNP     ++ + +    + E EE NPFPLEGKYKD++DR  +E +PEMERETLLFER
Sbjct: 61  DDYNPAAVQTESGRYSEEDEEDEEEEENPFPLEGKYKDDNDRAHLEGLPEMERETLLFER 120

Query: 113 SQIMQKYQERKMFRERSRKQMSLNNNSNL-TGQKXXXXXXXXXXXGLSDAKSSKLSQLKR 171
           SQIMQKY +R++FRER R       N  L  G K           G SD K+SKLSQL++
Sbjct: 121 SQIMQKYHDRRLFRERGRNMKEQQKNRQLREGNKTRSSARTTHATGHSDLKASKLSQLRK 180

Query: 172 QRERR 176
           QRE++
Sbjct: 181 QREQK 185

>KAFR0J02880 Chr10 complement(547671..549338) [1668 bp, 555 aa] {ON}
           Anc_3.567 YGL244W
          Length = 555

 Score =  438 bits (1127), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 211/322 (65%), Positives = 261/322 (81%), Gaps = 4/322 (1%)

Query: 251 RESNVQDFNKIKIGRSFAFKFCFYPDFNDIVKNCYAKVNVSDDRH--KPVYRMVKIEKVF 308
           R++ + DFNK++IGRSF  KFCFYPDF +IVK CY +VNV  D+   +  YRMVKIE++F
Sbjct: 236 RDTELNDFNKLRIGRSFVAKFCFYPDFGEIVKGCYGRVNVGVDKRTGQTSYRMVKIERIF 295

Query: 309 LDKRPHDMGKFFTNQCFGVTQGNNRKVYSMKYFSDSPITHAEFDRYIRTLEHDHITRPSV 368
           L K P+ MGKFFTNQ FGVTQG +RKV+ M +FSD  IT  E++RYIR+LE  HI +P+V
Sbjct: 296 LQK-PYSMGKFFTNQYFGVTQGKDRKVFQMSFFSDGLITPQEYERYIRSLESSHIPKPTV 354

Query: 369 YAINNKFKEITAFTTEPLTDKLTDQIVRNRMRFNKKLSGTNAVLEKTVLRGKLQFAKETG 428
           Y + +K KE+ +F +EPLT+KLT++IVRNRM FNKKLSGTNAVLEKTVL+ KLQ+A+ET 
Sbjct: 355 YTLKSKSKELVSFVSEPLTEKLTNEIVRNRMVFNKKLSGTNAVLEKTVLKEKLQYARETN 414

Query: 429 NERDVTKYSAQLRNLEKRLSLYEKHHENDQTGAKKLGQLTSRNRKLNMDKARNVEHKKVE 488
           NERDV KYSAQLRN EKR+++YEKHHENDQTG+KKLG LTS+N+K+NMDK RN EH K E
Sbjct: 415 NERDVAKYSAQLRNFEKRMNMYEKHHENDQTGSKKLGALTSKNKKVNMDKLRNAEHVKKE 474

Query: 489 LAGFDAKADPFSRLKTRTKIYYQEIQKEENEKAQELAHKKQLEEDAEAKAQSEKEQLLAE 548
               D K+DPFSRLKTRTKIYYQEIQKEENE+A+ LA +K++EE+ EA  + EKE LLA+
Sbjct: 475 DLPID-KSDPFSRLKTRTKIYYQEIQKEENERAKALAQQKKMEENEEATKRKEKELLLAQ 533

Query: 549 FKCLGGLEKMVGSLNFKFDFDI 570
           F+ LGGLEKM+  LN +FD  I
Sbjct: 534 FRRLGGLEKMISGLNIEFDLGI 555

 Score =  100 bits (249), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 64/158 (40%), Positives = 98/158 (62%), Gaps = 4/158 (2%)

Query: 23  LMVSSKKRARNNDSSS-KRRKIXXXXXXXXXXXXYNPVFNEDNNQSTYNTMDGEREEPNP 81
           ++ +SK+  ++ DSS+ K+R+I            YNP   +  + +     D E  E NP
Sbjct: 22  VLTTSKRTKQSGDSSANKKRRIESDSDEDEDD--YNPAAIDGGDGAYNENDDEEEYEENP 79

Query: 82  FPLEGKYKDEDDREKIESMPEMERETLLFERSQIMQKYQERKMFRERSRK-QMSLNNNSN 140
           FPLEGKYK+E+DR+ +ES+PEMERET+L++RSQ M+KY+ER+ F++R++  +     N +
Sbjct: 80  FPLEGKYKNEEDRDYLESLPEMERETVLYDRSQTMRKYRERQFFKDRNKNLKRQKERNED 139

Query: 141 LTGQKXXXXXXXXXXXGLSDAKSSKLSQLKRQRERRNK 178
               K           G +D K+SKLSQLK+QRE++NK
Sbjct: 140 DEALKTRSSGRATHATGHTDLKASKLSQLKKQREKKNK 177

>KLTH0G00726g Chr7 (49910..51595) [1686 bp, 561 aa] {ON} similar to
           uniprot|P53064 Saccharomyces cerevisiae YGL244W RTF1
           Subunit of the RNA polymerase II- associated Paf1
           complex directly or indirectly regulates DNA-binding
           properties of Spt15p (TATA box-binding protein) and
           relative activities of different TATA elements
          Length = 561

 Score =  436 bits (1121), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 208/322 (64%), Positives = 261/322 (81%), Gaps = 3/322 (0%)

Query: 251 RESNVQDFNKIKIGRSFAFKFCFYPDFNDIVKNCYAKVNVSDDRH--KPVYRMVKIEKVF 308
           RE  + DFN+IKIGRSF  KFCFYP+FND++K CY +VNV  D+   + +YRMVKIEKVF
Sbjct: 241 REPELGDFNRIKIGRSFVAKFCFYPEFNDMIKGCYGRVNVGVDKRSGQTLYRMVKIEKVF 300

Query: 309 LDKRPHDMGKFFTNQCFGVTQGNNRKVYSMKYFSDSPITHAEFDRYIRTLEHDHITRPSV 368
           L K P++MGKFFTNQ FGVTQG NRKV+ M +FSD  IT  EF+RY+R+LE   I +PS+
Sbjct: 301 LQK-PYNMGKFFTNQYFGVTQGKNRKVFQMNFFSDGAITQPEFERYLRSLETSEINKPSL 359

Query: 369 YAINNKFKEITAFTTEPLTDKLTDQIVRNRMRFNKKLSGTNAVLEKTVLRGKLQFAKETG 428
           Y INNK  EI +F ++P+T KLTD++VRNRM FNKKLSGTNAVLEKT+L+ KLQ+AKE+G
Sbjct: 360 YIINNKSNEINSFVSQPVTSKLTDELVRNRMIFNKKLSGTNAVLEKTILKDKLQYAKESG 419

Query: 429 NERDVTKYSAQLRNLEKRLSLYEKHHENDQTGAKKLGQLTSRNRKLNMDKARNVEHKKVE 488
           +ERDV KYS+QLRNLEKRLS YEKHHENDQ G+KKLG LTS+NR++N+DK +NVE  K E
Sbjct: 420 SERDVAKYSSQLRNLEKRLSSYEKHHENDQAGSKKLGALTSKNRRVNLDKGKNVEVTKKE 479

Query: 489 LAGFDAKADPFSRLKTRTKIYYQEIQKEENEKAQELAHKKQLEEDAEAKAQSEKEQLLAE 548
              FDAK DPFSRLKTRTKIYYQEIQ+EENEKA+ELA ++QL++D     + E++ LLA+
Sbjct: 480 DTPFDAKTDPFSRLKTRTKIYYQEIQREENEKAKELARQEQLQKDDLNLVEKERKLLLAK 539

Query: 549 FKCLGGLEKMVGSLNFKFDFDI 570
           FK LGGLE ++ +++F+   D+
Sbjct: 540 FKNLGGLEDIISNMDFQVSLDV 561

 Score =  102 bits (255), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 67/161 (41%), Positives = 93/161 (57%), Gaps = 16/161 (9%)

Query: 26  SSKKRARNNDSSSKRRKIXXXXXXXXXXXX------YNPVFNEDNNQSTYNTMDGEREE- 78
           SSKKR+R++  SS +R+I                  YNP        ++Y+    E E+ 
Sbjct: 28  SSKKRSRSDHQSSSKRRIVDEDEEQDDDEEEGEEDDYNP------EAASYDMDSEEDEDE 81

Query: 79  -PNPFPLEGKYKDEDDREKIESMPEMERETLLFERSQIMQKYQERKMFRERSR--KQMSL 135
            PNPFPLEGKYK+E+DR  +ES+PEMERET+LFERSQ MQKYQER++ +ER++  +    
Sbjct: 82  EPNPFPLEGKYKNEEDRSYLESLPEMERETMLFERSQTMQKYQERRVLKERAKNIRDQQQ 141

Query: 136 NNNSNLTGQKXXXXXXXXXXXGLSDAKSSKLSQLKRQRERR 176
                  G+K           G SD K S+LS+LK+QR ++
Sbjct: 142 KRQLQQEGKKTRSSTRSTRTTGHSDLKESRLSELKKQRAKK 182

>Kwal_47.19265 s47 complement(1162019..1163722) [1704 bp, 567 aa]
           {ON} YGL244W (RTF1) - Nuclear protein [contig 344] FULL
          Length = 567

 Score =  427 bits (1098), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 204/322 (63%), Positives = 257/322 (79%), Gaps = 3/322 (0%)

Query: 251 RESNVQDFNKIKIGRSFAFKFCFYPDFNDIVKNCYAKVNVSDDR--HKPVYRMVKIEKVF 308
           R+  + DFNK+KIGRSF  KFCFYP+FND+++ CY +VNV  D+  ++ +YRMVKIE+VF
Sbjct: 247 RDPELSDFNKVKIGRSFVAKFCFYPEFNDLIRGCYGRVNVGVDKRNNQTLYRMVKIERVF 306

Query: 309 LDKRPHDMGKFFTNQCFGVTQGNNRKVYSMKYFSDSPITHAEFDRYIRTLEHDHITRPSV 368
           L K P++MGKFFTNQ FGVTQG +RKV+ M +FSD  IT  EF+RY+++L+   I  PS+
Sbjct: 307 LQK-PYNMGKFFTNQYFGVTQGKDRKVFQMNFFSDGAITQPEFERYMKSLDASGINPPSL 365

Query: 369 YAINNKFKEITAFTTEPLTDKLTDQIVRNRMRFNKKLSGTNAVLEKTVLRGKLQFAKETG 428
           Y +NNK  EI  F ++P+T KLTD++VRNRM FNKKLSGTNAVLEKT+LR KLQ+AKETG
Sbjct: 366 YTLNNKSNEINGFVSQPVTPKLTDELVRNRMLFNKKLSGTNAVLEKTILRDKLQYAKETG 425

Query: 429 NERDVTKYSAQLRNLEKRLSLYEKHHENDQTGAKKLGQLTSRNRKLNMDKARNVEHKKVE 488
           +ERDV KYS+QLR+LE+RL+ YEKHHENDQ G+KKLG LTSRNR+ NMDK +NV+  K E
Sbjct: 426 SERDVAKYSSQLRSLERRLTSYEKHHENDQAGSKKLGALTSRNRRANMDKGKNVDTTKKE 485

Query: 489 LAGFDAKADPFSRLKTRTKIYYQEIQKEENEKAQELAHKKQLEEDAEAKAQSEKEQLLAE 548
              FDAK DPFSRLKTRTKIYYQEIQKEENEKA+ELA  +QLE+     A+ E++ LLA 
Sbjct: 486 DTPFDAKTDPFSRLKTRTKIYYQEIQKEENEKAKELARIEQLEKGNSDLAEKERKLLLAR 545

Query: 549 FKCLGGLEKMVGSLNFKFDFDI 570
           FK LGGLE++V  ++FK   ++
Sbjct: 546 FKNLGGLEEVVSGIDFKLSIEV 567

 Score = 97.8 bits (242), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 69/164 (42%), Positives = 94/164 (57%), Gaps = 7/164 (4%)

Query: 27  SKKRARNNDSSSKRRKIXXXXXXXXXXXX----YNPVFNEDNNQSTYNTMDGEREEPNPF 82
           SKKR+R++ ++S +R+I                YNP      + S     + E EE NPF
Sbjct: 30  SKKRSRSSQNASNKRRIVDEDEEIDEDDDDQDDYNPERGIYGDASGAEDEEDEEEEENPF 89

Query: 83  PLEGKYKDEDDREKIESMPEMERETLLFERSQIMQKYQERKMFRERSR--KQMSLNNNSN 140
           PLEGKYKDE DRE +ES+PEMERETLLF+RSQ MQKY+ER++ +ER+R  +         
Sbjct: 90  PLEGKYKDERDREYLESLPEMERETLLFDRSQEMQKYRERRVLKERARNIRAQQQKRQLQ 149

Query: 141 LTGQKXXXXXXXXXXXGLSDAKSSKLSQLKRQRERRNKGQSNYS 184
               K           G SD K S+LS+LK+QR +++ G  +YS
Sbjct: 150 QESTKTRSSTRSTRTTGHSDLKESRLSELKKQRAKKS-GTYDYS 192

>KNAG0I00230 Chr9 (28626..30341) [1716 bp, 571 aa] {ON} Anc_3.567
           YGL244W
          Length = 571

 Score =  427 bits (1098), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 209/325 (64%), Positives = 260/325 (80%), Gaps = 6/325 (1%)

Query: 251 RESNVQDFNKIKIGRSFAFKFCFYPDFNDIVKNCYAKVNVSDDRH--KPVYRMVKIEKVF 308
           R S + DFNK++IGRSF  KFCFYP FND+V  CY +VNV  D+   + +YRMVKIEKVF
Sbjct: 248 RVSELADFNKLRIGRSFVAKFCFYPGFNDLVNGCYGRVNVGVDKRSGQTLYRMVKIEKVF 307

Query: 309 LDKRPHDMGKFFTNQCFGVTQGNNRKVYSMKYFSDSPITHAEFDRYIRTLEHDHITRPSV 368
           L K P++MGKF+TNQ FGVTQG +RKV+ M +FSD   T  E++RY+R+LE  +I+RPS 
Sbjct: 308 LQK-PYNMGKFYTNQYFGVTQGKDRKVFQMNFFSDGHFTQNEYERYLRSLETANISRPSA 366

Query: 369 YAINNKFKEITAFTTEPLTDKLTDQIVRNRMRFNKKLSGTNAVLEKTVLRGKLQFAKETG 428
           + ++NK KEI +F TEPLT+KLTD+IVRNRM FNKKLSGTNAVLEKTVLR KLQ+A+E+ 
Sbjct: 367 HILSNKSKEIVSFITEPLTEKLTDEIVRNRMLFNKKLSGTNAVLEKTVLRSKLQYARESN 426

Query: 429 NERDVTKYSAQLRNLEKRLSLYEKHHENDQTGAKKLGQLTSRNRKLNMDKARNVEH-KKV 487
           NERDV KYSAQLRN EKR++ YEKHHEND TG KKLG LTS+NRK+NM K +N +H KK 
Sbjct: 427 NERDVAKYSAQLRNFEKRMNNYEKHHENDHTGTKKLGALTSKNRKVNMGKTKNYDHGKKE 486

Query: 488 ELAG--FDAKADPFSRLKTRTKIYYQEIQKEENEKAQELAHKKQLEEDAEAKAQSEKEQL 545
           + AG   D+K+DPFSRLKTRTKIYYQE+QKEENEKA+ LA +K++E++ EA  + EKE L
Sbjct: 487 DSAGPTVDSKSDPFSRLKTRTKIYYQEVQKEENEKAKALAQQKEIEKNKEADERKEKELL 546

Query: 546 LAEFKCLGGLEKMVGSLNFKFDFDI 570
           LA+F+ LGGLE M+  +N  FD D+
Sbjct: 547 LAQFRRLGGLENMISKINVNFDIDL 571

 Score =  112 bits (279), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 64/123 (52%), Positives = 81/123 (65%), Gaps = 16/123 (13%)

Query: 56  YNPVFNEDNNQSTYNTMD--GEREEPNPFPLEGKYKDEDDREKIESMPEMERETLLFERS 113
           YNP     +    Y+T D   E EE NPFPL+GKYKDE DRE +ES+PE+ERET+LF+RS
Sbjct: 68  YNP-----HEVGNYDTGDDEAENEEQNPFPLQGKYKDEKDREYLESLPEVERETVLFDRS 122

Query: 114 QIMQKYQERKMFRERSRKQMSLNNNSNLTGQKXXXXXXXXXXXGLSDAKSSKLSQLKRQR 173
           Q M+KYQERK+FRER R+Q +    S+                G SD K+SKLSQLKRQR
Sbjct: 123 QTMRKYQERKLFRERKRQQEAKPTRSS---------GRTAHSTGHSDLKASKLSQLKRQR 173

Query: 174 ERR 176
           +++
Sbjct: 174 DKK 176

>SAKL0F00814g Chr6 (72843..74567) [1725 bp, 574 aa] {ON} similar to
           uniprot|P53064 Saccharomyces cerevisiae YGL244W RTF1
           Subunit of the RNA polymerase II-associated Paf1 complex
           directly or indirectly regulates DNA-binding properties
           of Spt15p (TATA box-binding protein) and relative
           activities of different TATA elements
          Length = 574

 Score =  422 bits (1084), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 200/322 (62%), Positives = 258/322 (80%), Gaps = 3/322 (0%)

Query: 251 RESNVQDFNKIKIGRSFAFKFCFYPDFNDIVKNCYAKVNVSDDRH--KPVYRMVKIEKVF 308
           R++ + DFNK+KIGRSF  KFCFYP FN++V+N Y +VNV  D+H  +  YRMVKIEKVF
Sbjct: 254 RDTGLADFNKVKIGRSFVAKFCFYPGFNELVQNSYGRVNVGIDKHTGQTAYRMVKIEKVF 313

Query: 309 LDKRPHDMGKFFTNQCFGVTQGNNRKVYSMKYFSDSPITHAEFDRYIRTLEHDHITRPSV 368
           L K P++MGKFFTNQ FGVTQG +RKV+ M +FSD  IT  E++RY+++LE   I +PSV
Sbjct: 314 LQK-PYNMGKFFTNQYFGVTQGKDRKVFQMNFFSDGAITQVEYERYLKSLEKYGINKPSV 372

Query: 369 YAINNKFKEITAFTTEPLTDKLTDQIVRNRMRFNKKLSGTNAVLEKTVLRGKLQFAKETG 428
           Y +NNK KEI+ F ++P+T KLTD IVRNRM FNKKLSGTNAVLEKTVL+ KLQ+AKET 
Sbjct: 373 YNLNNKSKEISEFVSQPMTSKLTDDIVRNRMVFNKKLSGTNAVLEKTVLKEKLQYAKETS 432

Query: 429 NERDVTKYSAQLRNLEKRLSLYEKHHENDQTGAKKLGQLTSRNRKLNMDKARNVEHKKVE 488
           NERD+ KYS+QL+NLEKR+S YEKHHENDQ G KKLG LTS+NRKLN+D+ ++ E  + +
Sbjct: 433 NERDIAKYSSQLKNLEKRISSYEKHHENDQAGIKKLGVLTSKNRKLNIDRIKHAELVQKD 492

Query: 489 LAGFDAKADPFSRLKTRTKIYYQEIQKEENEKAQELAHKKQLEEDAEAKAQSEKEQLLAE 548
              FDAK+DPFSRLKTRTKIYY+E+Q++ENEKA+E A +KQLEED     + E E LLA+
Sbjct: 493 DVNFDAKSDPFSRLKTRTKIYYKEVQQQENEKAKEAARQKQLEEDKGTATRKENELLLAK 552

Query: 549 FKCLGGLEKMVGSLNFKFDFDI 570
           F+ LGGLE+++G ++ + + ++
Sbjct: 553 FRSLGGLEEIIGGIDLQINVNL 574

 Score = 99.4 bits (246), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 53/107 (49%), Positives = 73/107 (68%), Gaps = 3/107 (2%)

Query: 80  NPFPLEGKYKDEDDREKIESMPEMERETLLFERSQIMQKYQERKMFRERSR--KQMSLNN 137
           NPFPLEGKYKDE DR ++ES+PEMERE+LLFERSQIMQ+YQER+  ++R++  +      
Sbjct: 93  NPFPLEGKYKDEQDRTQLESLPEMERESLLFERSQIMQQYQERRFLKQRAKNIRDQQQKR 152

Query: 138 NSNLTGQKXXXXXXXXXXXGLSDAKSSKLSQLKRQRERRNKGQSNYS 184
                G++           G SD K+SKLS+LK+QR +++ G  +YS
Sbjct: 153 QQQQEGKQVRSSTRTTRATGHSDVKTSKLSELKKQRAKKS-GTYDYS 198

>ZYRO0E09526g Chr5 complement(758296..759978) [1683 bp, 560 aa] {ON}
           similar to uniprot|P53064 Saccharomyces cerevisiae
           YGL244W RTF1 Subunit of the RNA polymerase II-associated
           Paf1 complex directly or indirectly regulates
           DNA-binding properties of Spt15p (TATA box-binding
           protein) and relative activities of different TATA
           elements
          Length = 560

 Score =  412 bits (1060), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 199/322 (61%), Positives = 249/322 (77%), Gaps = 3/322 (0%)

Query: 251 RESNVQDFNKIKIGRSFAFKFCFYPDFNDIVKNCYAKVNVSDDRH--KPVYRMVKIEKVF 308
           RE+NV DFNK KIGRSF   FCFYP FNDIV+  Y +VNV  D+   + +YRMVKIEKVF
Sbjct: 240 REANVADFNKAKIGRSFVANFCFYPGFNDIVRGNYGRVNVGTDKRSGETLYRMVKIEKVF 299

Query: 309 LDKRPHDMGKFFTNQCFGVTQGNNRKVYSMKYFSDSPITHAEFDRYIRTLEHDHITRPSV 368
           L K P++MGKF TNQ FGVTQG +RKV+ M+YFSD  IT  EF+RY+  LE DHIT PSV
Sbjct: 300 LQK-PYNMGKFITNQYFGVTQGKDRKVFQMRYFSDGAITQQEFERYMHALERDHITGPSV 358

Query: 369 YAINNKFKEITAFTTEPLTDKLTDQIVRNRMRFNKKLSGTNAVLEKTVLRGKLQFAKETG 428
           Y++ NK KEI +F ++PLT++LT+ IVRNRM FNKKLSG NAVLEKTVL+ KLQ+A ET 
Sbjct: 359 YSLENKAKEINSFVSQPLTEQLTNDIVRNRMVFNKKLSGVNAVLEKTVLKEKLQYAMETK 418

Query: 429 NERDVTKYSAQLRNLEKRLSLYEKHHENDQTGAKKLGQLTSRNRKLNMDKARNVEHKKVE 488
           NERD+ KYS+QLR+ EKR+S YEK HEND+ G  KL  LT++NR++N+D+ +N E  K E
Sbjct: 419 NERDIAKYSSQLRSFEKRMSTYEKQHENDKVGINKLNALTTKNRRVNIDRLKNAEQVKKE 478

Query: 489 LAGFDAKADPFSRLKTRTKIYYQEIQKEENEKAQELAHKKQLEEDAEAKAQSEKEQLLAE 548
              FD+K+DPFSRLKTRTK YYQEIQKEENEKA+  A +KQLEED     + + E L A 
Sbjct: 479 DTSFDSKSDPFSRLKTRTKFYYQEIQKEENEKAKNDAEQKQLEEDESTTERKKHELLSAR 538

Query: 549 FKCLGGLEKMVGSLNFKFDFDI 570
           F+ LGGL++++G+++F+F  DI
Sbjct: 539 FRRLGGLKQVIGTVDFQFSIDI 560

 Score =  115 bits (289), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 77/184 (41%), Positives = 103/184 (55%), Gaps = 9/184 (4%)

Query: 1   MSDIXXXXXXXXXXXXXXXXXTLMVSSKKRARNND-SSSKRRKIXXXXXXXXXXXX---Y 56
           MSDI                  ++ SS KR+  +D +SSK+R+I               Y
Sbjct: 1   MSDIEEDLLALAGADEEEDDDEVLASSAKRSGKSDRASSKKRRIEVEGGEDDEDEDEDDY 60

Query: 57  NPVFNEDNNQSTYNTMDGEREEPNPFPLEGKYKDEDDREKIESMPEMERETLLFERSQIM 116
           NP     +   T +  D E EE NPFPLEGKYKDE DR+ +  +PEMERET+LFERSQIM
Sbjct: 61  NPA---ASGAGTGDYDDEEEEEENPFPLEGKYKDEADRDYLGGLPEMERETMLFERSQIM 117

Query: 117 QKYQERKMFRERSR--KQMSLNNNSNLTGQKXXXXXXXXXXXGLSDAKSSKLSQLKRQRE 174
           QKYQ+RKMFR+R +  K+    +     G+K           G SD K+SKLSQL++QRE
Sbjct: 118 QKYQDRKMFRQRGKNLKEQQQRSKQQEEGKKTRSSTRSTVATGHSDIKASKLSQLRKQRE 177

Query: 175 RRNK 178
           ++++
Sbjct: 178 KKSQ 181

>KLLA0A00737g Chr1 (72233..73981) [1749 bp, 582 aa] {ON} similar to
           uniprot|P53064 Saccharomyces cerevisiae YGL244W RTF1
           Subunit of the RNA polymerase II-associated Paf1 complex
           directly or indirectly regulates DNA-binding properties
           of Spt15p (TATA box-binding protein) and relative
           activities of different TATA elements
          Length = 582

 Score =  404 bits (1038), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 202/324 (62%), Positives = 251/324 (77%), Gaps = 6/324 (1%)

Query: 251 RESNVQDFNKIKIGRSFAFKFCFYPDFNDIVKNCYAKVNVSDDRHK--PVYRMVKIEKVF 308
           RES++ D+NKI+IGRSF  KFCFYP FN IV+ CY +VN+  D+H    +YRMVKIE+VF
Sbjct: 261 RESSLDDYNKIQIGRSFVAKFCFYPHFNKIVEGCYGRVNIGKDKHTGNSMYRMVKIERVF 320

Query: 309 LDKRPHDMGKFFTNQCFGVTQGNNRKVYSMKYFSDSPITHAEFDRYIRTLEHDHITRPSV 368
           L K P++MGKFFTNQ FGVTQG +RK++ M YFSDSP+T  E++RY+ +LE   IT+PS 
Sbjct: 321 LQK-PYNMGKFFTNQYFGVTQGKDRKIFQMSYFSDSPVTQPEYERYLLSLEKYDITQPSP 379

Query: 369 YAINNKFKEITAFTTEPLTDKLTDQIVRNRMRFNKKLSGTNAVLEKTVLRGKLQFAKETG 428
           Y +NNK K +  F  EPLT KL D IVRNRM FNKKLSGTNAV+EK VL+ KLQF+K++G
Sbjct: 380 YILNNKSKAVNEFVCEPLTPKLMDDIVRNRMVFNKKLSGTNAVMEKQVLKEKLQFSKQSG 439

Query: 429 NERDVTKYSAQLRNLEKRLSLYEKHHENDQTGAKKLGQLTSRNRKLNMDKARNVEHKKVE 488
           +    +KY+ QL+ LEKRLS YEKHHENDQ   K LG LTS+NRKLN+D+ R+ E  K E
Sbjct: 440 DIESESKYANQLKALEKRLSSYEKHHENDQNDIKTLGALTSKNRKLNIDRIRHAETIKRE 499

Query: 489 --LAGFDAKADPFSRLKTRTKIYYQEIQKEENEKAQELAHKKQLEEDAEAKAQSEKEQLL 546
             +   DAK+DPFSRLKTRTKIYYQEIQ+EENEKA+E A K+QLE D EA+ Q +KE LL
Sbjct: 500 EGVNKVDAKSDPFSRLKTRTKIYYQEIQQEENEKAREEA-KRQLEVDQEAEEQKKKELLL 558

Query: 547 AEFKCLGGLEKMVGSLNFKFDFDI 570
           A+F+ LGGLE+++GSL+ K   DI
Sbjct: 559 AKFRRLGGLEEIIGSLDLKLHIDI 582

 Score = 96.3 bits (238), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 64/164 (39%), Positives = 85/164 (51%), Gaps = 11/164 (6%)

Query: 23  LMVSSKKRARNNDSSSKRRKIXXXXXXXXXXXX---------YNPVFNEDNNQSTYNTMD 73
            + +SKK A    S SKRR+I                     Y P  + DN++       
Sbjct: 24  FLSTSKKHASKESSGSKRRRIMKDDEDEDEDEDDNDEEDDDGYMPADSFDNDEEEEEEE- 82

Query: 74  GEREEPNPFPLEGKYKDEDDREKIESMPEMERETLLFERSQIMQKYQERKMFRERSRKQM 133
            E  +  PFPLEGKYKDE DREK+E +PEMERE++LFERSQ MQKYQERK+ R+ ++   
Sbjct: 83  -EETDSIPFPLEGKYKDEKDREKLELLPEMERESILFERSQQMQKYQERKLLRQHAKSIK 141

Query: 134 SLNNNSNLTGQKXXXXXXXXXXXGLSDAKSSKLSQLKRQRERRN 177
                     +            G SD K SKLS+LK+QR +++
Sbjct: 142 QQQQLQREGSKSTRASTRSSRTTGHSDLKQSKLSELKKQRAKKS 185

>YNL020C Chr14 complement(595623..597539) [1917 bp, 638 aa] {ON}
           ARK1Serine/threonine protein kinase involved in
           regulation of the cortical actin cytoskeleton; involved
           in control of endocytosis
          Length = 638

 Score = 32.0 bits (71), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 13/36 (36%), Positives = 24/36 (66%), Gaps = 1/36 (2%)

Query: 269 FKFCFYPDFNDIVKNCYAKVNVSDDRHKP-VYRMVK 303
           F+F  YP++++ +K     + V D RH+P VY+++K
Sbjct: 259 FEFPLYPNYSEQLKGLIRDILVQDPRHRPNVYQLLK 294

>Suva_14.117 Chr14 complement(216958..218703) [1746 bp, 581 aa] {ON}
           YNL225C (REAL)
          Length = 581

 Score = 32.0 bits (71), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 33/109 (30%), Positives = 48/109 (44%), Gaps = 12/109 (11%)

Query: 393 QIVRNRMRFNKKLSGTNAVLEKT--VLRGKLQFAKETGNERDVTK-----YSAQLRNLEK 445
           Q++R R   N  L GTN  L K   VL  K  F K + +E+++ K       A+L +L +
Sbjct: 344 QVIRER---NNNLLGTNKTLSKQNKVLCDK--FEKLSNDEKEMLKGCNEEIKAKLESLNE 398

Query: 446 RLSLYEKHHENDQTGAKKLGQLTSRNRKLNMDKARNVEHKKVELAGFDA 494
           RL  +EK  EN +   K   Q      K     +R + H K  L   + 
Sbjct: 399 RLGSWEKSKENYEAALKDKDQTIGEFEKKANSMSREINHLKSRLGNLEG 447

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.130    0.359 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 53,940,067
Number of extensions: 2354104
Number of successful extensions: 13076
Number of sequences better than 10.0: 289
Number of HSP's gapped: 13153
Number of HSP's successfully gapped: 356
Length of query: 570
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 455
Effective length of database: 40,294,809
Effective search space: 18334138095
Effective search space used: 18334138095
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 68 (30.8 bits)