Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0E002103.568ON63163130900.0
TDEL0D063603.568ON58561420250.0
Kpol_507.93.568ON60362119320.0
NCAS0F039703.568ON59762018970.0
NDAI0B062803.568ON60563518620.0
ZYRO0E09548g3.568ON59263518550.0
CAGL0C01969g3.568ON61963618340.0
SAKL0F00770g3.568ON63662518270.0
Smik_7.3683.568ON65969318300.0
KNAG0D029603.568ON65165418030.0
KLTH0G00704g3.568ON61562517810.0
Kwal_47.192683.568ON61663317680.0
TPHA0A060103.568ON62362317660.0
KLLA0A00715g3.568ON59161217110.0
Ecym_25983.568ON60263716770.0
AFR265C3.568ON59161116730.0
KAFR0J001703.568ON60763916340.0
Suva_12.93.568ON65924011411e-147
YFR048W (RMD8)3.568ON66224011401e-147
Skud_6.1393.568ON66124011351e-147
Suva_4.2523.209ON4302444445e-48
YDL001W (RMD1)3.209ON4302434383e-47
Smik_4.2353.209ON4312434367e-47
Skud_4.2533.209ON4302434368e-47
NCAS0A101203.209ON4232304313e-46
TBLA0A001703.209ON5052354312e-45
TDEL0D041303.209ON4382374262e-45
SAKL0C11286g3.209ON4282354252e-45
Kpol_1045.583.209ON4472354263e-45
NDAI0A073503.209ON5222374294e-45
KNAG0K014903.209ON4052344216e-45
CAGL0M10483g3.209ON4322074227e-45
AEL004W3.209ON4752404249e-45
Ecym_52933.209ON4772354231e-44
KLTH0G16544g3.209ON4082384191e-44
KAFR0F025003.209ON4662424212e-44
Kwal_27.110013.209ON4082384172e-44
TPHA0P005503.209ON4462354183e-44
ZYRO0A04400g3.209ON4582264168e-44
KLLA0E17381g3.209ON4442074105e-43
YDR282C5.291ON4142502009e-16
Skud_4.5455.291ON4132501991e-15
Ecym_47435.291ON3662661935e-15
Suva_2.4485.291ON4172561936e-15
KLTH0G06622g5.291ON3922681831e-13
Kwal_23.56435.291ON3742671802e-13
SAKL0G10582g5.291ON3832351784e-13
Smik_4.5315.291ON4142561785e-13
Kpol_1033.65.291ON4032401776e-13
KLLA0C11165g5.291ON3562271766e-13
AAL122C5.291ON3662431759e-13
TPHA0D017105.291ON3862521615e-11
CAGL0H01045g5.291ON3611711597e-11
ZYRO0G16478g5.291ON4012471536e-10
TDEL0E033605.291ON4051801492e-09
KAFR0E015305.291ON3632331393e-08
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0E00210
         (631 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0E00210 Chr5 complement(29729..31624) [1896 bp, 631 aa] {ON}...  1194   0.0  
TDEL0D06360 Chr4 (1142081..1143838) [1758 bp, 585 aa] {ON} Anc_3...   784   0.0  
Kpol_507.9 s507 complement(53819..55630) [1812 bp, 603 aa] {ON} ...   748   0.0  
NCAS0F03970 Chr6 (796049..797842) [1794 bp, 597 aa] {ON} Anc_3.5...   735   0.0  
NDAI0B06280 Chr2 (1519871..1521688) [1818 bp, 605 aa] {ON} Anc_3...   721   0.0  
ZYRO0E09548g Chr5 (760326..762104) [1779 bp, 592 aa] {ON} simila...   719   0.0  
CAGL0C01969g Chr3 complement(206652..208511) [1860 bp, 619 aa] {...   711   0.0  
SAKL0F00770g Chr6 complement(66976..68886) [1911 bp, 636 aa] {ON...   708   0.0  
Smik_7.368 Chr7 (606969..608948) [1980 bp, 659 aa] {ON} YFR048W ...   709   0.0  
KNAG0D02960 Chr4 (533165..535120) [1956 bp, 651 aa] {ON} Anc_3.5...   699   0.0  
KLTH0G00704g Chr7 complement(47865..49712) [1848 bp, 615 aa] {ON...   690   0.0  
Kwal_47.19268 s47 (1163922..1165772) [1851 bp, 616 aa] {ON} YFR0...   685   0.0  
TPHA0A06010 Chr1 (1359051..1360922) [1872 bp, 623 aa] {ON} Anc_3...   684   0.0  
KLLA0A00715g Chr1 complement(69861..71636) [1776 bp, 591 aa] {ON...   663   0.0  
Ecym_2598 Chr2 (1162883..1164691) [1809 bp, 602 aa] {ON} similar...   650   0.0  
AFR265C Chr6 complement(910790..912565) [1776 bp, 591 aa] {ON} S...   649   0.0  
KAFR0J00170 Chr10 complement(27714..29537) [1824 bp, 607 aa] {ON...   634   0.0  
Suva_12.9 Chr12 complement(11366..13345) [1980 bp, 659 aa] {ON} ...   444   e-147
YFR048W Chr6 (246146..248134) [1989 bp, 662 aa] {ON}  RMD8Cytoso...   443   e-147
Skud_6.139 Chr6 (241140..243125) [1986 bp, 661 aa] {ON} YFR048W ...   441   e-147
Suva_4.252 Chr4 (445183..446475) [1293 bp, 430 aa] {ON} YDL001W ...   175   5e-48
YDL001W Chr4 (447984..449276) [1293 bp, 430 aa] {ON}  RMD1Cytopl...   173   3e-47
Smik_4.235 Chr4 (427186..428481) [1296 bp, 431 aa] {ON} YDL001W ...   172   7e-47
Skud_4.253 Chr4 (439498..440790) [1293 bp, 430 aa] {ON} YDL001W ...   172   8e-47
NCAS0A10120 Chr1 (2022090..2023361) [1272 bp, 423 aa] {ON} Anc_3...   170   3e-46
TBLA0A00170 Chr1 (16781..18298) [1518 bp, 505 aa] {ON} Anc_3.209...   170   2e-45
TDEL0D04130 Chr4 (760040..761356) [1317 bp, 438 aa] {ON} Anc_3.2...   168   2e-45
SAKL0C11286g Chr3 complement(1012631..1013917) [1287 bp, 428 aa]...   168   2e-45
Kpol_1045.58 s1045 (139327..140670) [1344 bp, 447 aa] {ON} (1393...   168   3e-45
NDAI0A07350 Chr1 complement(1671549..1673117) [1569 bp, 522 aa] ...   169   4e-45
KNAG0K01490 Chr11 (310336..311553) [1218 bp, 405 aa] {ON} Anc_3....   166   6e-45
CAGL0M10483g Chr13 complement(1049771..1051069) [1299 bp, 432 aa...   167   7e-45
AEL004W Chr5 (630125..631552) [1428 bp, 475 aa] {ON} Syntenic ho...   167   9e-45
Ecym_5293 Chr5 (595331..596764) [1434 bp, 477 aa] {ON} similar t...   167   1e-44
KLTH0G16544g Chr7 complement(1435479..1436705) [1227 bp, 408 aa]...   166   1e-44
KAFR0F02500 Chr6 complement(484705..486105) [1401 bp, 466 aa] {O...   166   2e-44
Kwal_27.11001 s27 complement(593288..594514) [1227 bp, 408 aa] {...   165   2e-44
TPHA0P00550 Chr16 complement(110346..111686) [1341 bp, 446 aa] {...   165   3e-44
ZYRO0A04400g Chr1 (359271..360647) [1377 bp, 458 aa] {ON} simila...   164   8e-44
KLLA0E17381g Chr5 complement(1540387..1541721) [1335 bp, 444 aa]...   162   5e-43
YDR282C Chr4 complement(1023511..1024755) [1245 bp, 414 aa] {ON}...    82   9e-16
Skud_4.545 Chr4 complement(966078..967319) [1242 bp, 413 aa] {ON...    81   1e-15
Ecym_4743 Chr4 complement(1450271..1451371) [1101 bp, 366 aa] {O...    79   5e-15
Suva_2.448 Chr2 complement(788042..789295) [1254 bp, 417 aa] {ON...    79   6e-15
KLTH0G06622g Chr7 (527870..529048) [1179 bp, 392 aa] {ON} simila...    75   1e-13
Kwal_23.5643 s23 complement(1249364..1250488) [1125 bp, 374 aa] ...    74   2e-13
SAKL0G10582g Chr7 (900403..901554) [1152 bp, 383 aa] {ON} simila...    73   4e-13
Smik_4.531 Chr4 complement(955033..956277) [1245 bp, 414 aa] {ON...    73   5e-13
Kpol_1033.6 s1033 complement(11719..12930) [1212 bp, 403 aa] {ON...    73   6e-13
KLLA0C11165g Chr3 complement(957421..958491) [1071 bp, 356 aa] {...    72   6e-13
AAL122C Chr1 complement(132431..133531) [1101 bp, 366 aa] {ON} S...    72   9e-13
TPHA0D01710 Chr4 complement(356399..357559) [1161 bp, 386 aa] {O...    67   5e-11
CAGL0H01045g Chr8 complement(98818..99903) [1086 bp, 361 aa] {ON...    66   7e-11
ZYRO0G16478g Chr7 complement(1349497..1350702) [1206 bp, 401 aa]...    64   6e-10
TDEL0E03360 Chr5 (635665..636882) [1218 bp, 405 aa] {ON} Anc_5.2...    62   2e-09
KAFR0E01530 Chr5 complement(309332..310423) [1092 bp, 363 aa] {O...    58   3e-08

>TBLA0E00210 Chr5 complement(29729..31624) [1896 bp, 631 aa] {ON}
           Anc_3.568 YFR048W
          Length = 631

 Score = 1194 bits (3090), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 587/631 (93%), Positives = 587/631 (93%)

Query: 1   MDYLKPSKKTEKIEQKKPLSKRSPSILVTDYRSNRTRKSAPFAGHAADSNSNLEQVRKNL 60
           MDYLKPSKKTEKIEQKKPLSKRSPSILVTDYRSNRTRKSAPFAGHAADSNSNLEQVRKNL
Sbjct: 1   MDYLKPSKKTEKIEQKKPLSKRSPSILVTDYRSNRTRKSAPFAGHAADSNSNLEQVRKNL 60

Query: 61  SSYSGGYKSTWXXXXXXXXXXXXXXXXXXKPFKKSFASVNNGRKSRRGSQGRFSDISIDN 120
           SSYSGGYKSTW                  KPFKKSFASVNNGRKSRRGSQGRFSDISIDN
Sbjct: 61  SSYSGGYKSTWNRNLSNNSSAANGNVFGNKPFKKSFASVNNGRKSRRGSQGRFSDISIDN 120

Query: 121 ILQDTSEIPXXXXXXXXXXXXXXXXXMFDDHLRSSYYNFSKTITPLPPRTSKTSQKLVLI 180
           ILQDTSEIP                 MFDDHLRSSYYNFSKTITPLPPRTSKTSQKLVLI
Sbjct: 121 ILQDTSEIPSARREERSSGSSYERFSMFDDHLRSSYYNFSKTITPLPPRTSKTSQKLVLI 180

Query: 181 PEEPDSRSNSLGRPRSTSSLRAYPRGDRSRYGIKAKARLPRLTAYHLSEGLNLKLMSKFL 240
           PEEPDSRSNSLGRPRSTSSLRAYPRGDRSRYGIKAKARLPRLTAYHLSEGLNLKLMSKFL
Sbjct: 181 PEEPDSRSNSLGRPRSTSSLRAYPRGDRSRYGIKAKARLPRLTAYHLSEGLNLKLMSKFL 240

Query: 241 KKYHEVSPRLYDECLYVAYTLPLLPGKDGYRIKSNISKKVIGGKTLIDKMIDASEQRDHH 300
           KKYHEVSPRLYDECLYVAYTLPLLPGKDGYRIKSNISKKVIGGKTLIDKMIDASEQRDHH
Sbjct: 241 KKYHEVSPRLYDECLYVAYTLPLLPGKDGYRIKSNISKKVIGGKTLIDKMIDASEQRDHH 300

Query: 301 YEYYSGVEVLEDANNNYELSTNPVQADTDINNIPDHLPNTMANTDNFNPSEPQYFAEETP 360
           YEYYSGVEVLEDANNNYELSTNPVQADTDINNIPDHLPNTMANTDNFNPSEPQYFAEETP
Sbjct: 301 YEYYSGVEVLEDANNNYELSTNPVQADTDINNIPDHLPNTMANTDNFNPSEPQYFAEETP 360

Query: 361 SEQKLREQEEQLGLIANXXXXXXXXXELITGKSQHAEIFIFRYGVIVFWNFTEAQEKNIL 420
           SEQKLREQEEQLGLIAN         ELITGKSQHAEIFIFRYGVIVFWNFTEAQEKNIL
Sbjct: 361 SEQKLREQEEQLGLIANSTITTSSSSELITGKSQHAEIFIFRYGVIVFWNFTEAQEKNIL 420

Query: 421 GDIAFADYKDLVIRPLDEQDIETEEFHFEYDADTERPRIFNDVITLRSGDHIIKLTLSHS 480
           GDIAFADYKDLVIRPLDEQDIETEEFHFEYDADTERPRIFNDVITLRSGDHIIKLTLSHS
Sbjct: 421 GDIAFADYKDLVIRPLDEQDIETEEFHFEYDADTERPRIFNDVITLRSGDHIIKLTLSHS 480

Query: 481 IAQSSKLSRFESRLEPLLNSVTKLPKRLALYGTLGLTRQQLLKKSGKLFKLRVDVNLSSS 540
           IAQSSKLSRFESRLEPLLNSVTKLPKRLALYGTLGLTRQQLLKKSGKLFKLRVDVNLSSS
Sbjct: 481 IAQSSKLSRFESRLEPLLNSVTKLPKRLALYGTLGLTRQQLLKKSGKLFKLRVDVNLSSS 540

Query: 541 VLDTPEFFWTFEPSLHPLYVAMREYLEIDERVQVVNDRCMVLLEFFNICVDSVAERNIAR 600
           VLDTPEFFWTFEPSLHPLYVAMREYLEIDERVQVVNDRCMVLLEFFNICVDSVAERNIAR
Sbjct: 541 VLDTPEFFWTFEPSLHPLYVAMREYLEIDERVQVVNDRCMVLLEFFNICVDSVAERNIAR 600

Query: 601 VTWWFIIVLILGVLFSLTEILIRYLIIQRHQ 631
           VTWWFIIVLILGVLFSLTEILIRYLIIQRHQ
Sbjct: 601 VTWWFIIVLILGVLFSLTEILIRYLIIQRHQ 631

>TDEL0D06360 Chr4 (1142081..1143838) [1758 bp, 585 aa] {ON}
           Anc_3.568 YFR048W
          Length = 585

 Score =  784 bits (2025), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 396/614 (64%), Positives = 461/614 (75%), Gaps = 49/614 (7%)

Query: 18  PLSKRSPSILVTDYRSNRTRKSAPFAGHAADSNSNLEQVRKNLSSYSGGYKSTWXXXXXX 77
           PL++RSPSILVTD RS+R R SAPFAGHAA   S  E                       
Sbjct: 17  PLARRSPSILVTDSRSSRKRMSAPFAGHAAGVRSRDEL---------------------- 54

Query: 78  XXXXXXXXXXXXKPFKKSFASVNNGRKSRRGSQGRFSDISIDNILQDTSEIPXXXXXXXX 137
                        P  KS  S  N   ++R + GRFS+ISIDNIL + S++P        
Sbjct: 55  -------------PNMKSSGSFGNKVSNKRRTSGRFSEISIDNILSEMSDVPSGRREERL 101

Query: 138 XXXXXXXXXMFDDHLRSSYYNFSKTITPLPPRTSKTSQKLVLIPEEPDSR---SNSLGRP 194
                      D   +    N+SK I PLP RTSKTSQKLVLIPEE D R   +N+  R 
Sbjct: 102 SSSSADRHYASD---KPRSLNYSKMINPLPARTSKTSQKLVLIPEEADGRESSANAFSRK 158

Query: 195 RSTSSLRAYPRGDRSRYGIKAKARLPRLTAYHLSEGLNLKLMSKFLKKYHEVSPRLYDEC 254
           RST+S++ Y  G+ +R+  K   +L R+TAY+++EG NLKLMSKFLK  HEVSPR+YDEC
Sbjct: 159 RSTTSMKGY--GESARHA-KKDEKLARITAYNVAEGFNLKLMSKFLKCTHEVSPRMYDEC 215

Query: 255 LYVAYTLPLLPGKDGYRIKSNISKKVIGGKTLIDKMIDASEQRDHHYEYYSGVEVLEDAN 314
           LYVAYTLPLL GKDG+R+KSNISKKV+GGKTLI+K+ID SEQRDHHYEYYSGVE LEDA 
Sbjct: 216 LYVAYTLPLLLGKDGFRVKSNISKKVVGGKTLIEKLIDTSEQRDHHYEYYSGVETLEDAR 275

Query: 315 NNYELSTNPVQADTDINNIPDHLPNTMANTDNFNPSEPQYFAEETPSEQKLREQEEQLGL 374
           N +EL    V  + D N IP+HLPN   N D+F+PSEPQ+FAEETP+EQKLRE+ EQ  +
Sbjct: 276 NAFELDPTAVLVENDPNIIPNHLPNPPGNLDSFDPSEPQFFAEETPTEQKLRERREQFNM 335

Query: 375 IANXXXXXXXXXELITGKSQHAEIFIFRYGVIVFWNFTEAQEKNILGDIAFADYKDLVIR 434
            AN            +   QHAEIFIFRYGVIVFWNFTE QEKNILGDIAFADYK+LVIR
Sbjct: 336 PANNKRHGTT-----SSGDQHAEIFIFRYGVIVFWNFTEIQEKNILGDIAFADYKNLVIR 390

Query: 435 PLDEQDIETEEFHFEYDADTERPRIFNDVITLRSGDHIIKLTLSHSIAQSSKLSRFESRL 494
           PLDEQDIE E+FHF+YD DTERPRIFND++TLRSGDHII+LTLSH+IAQSSKLSRFESR+
Sbjct: 391 PLDEQDIEREQFHFDYDKDTERPRIFNDIVTLRSGDHIIELTLSHAIAQSSKLSRFESRI 450

Query: 495 EPLLNSVTKLPKRLALYGTLGLTRQQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWTFEPS 554
            P+L +VTKLPKRLALYGTLG+ R+QLLKKSGKLFKLRVDVNLSSSVLDTPEFFW+FEPS
Sbjct: 451 SPILTAVTKLPKRLALYGTLGMKREQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWSFEPS 510

Query: 555 LHPLYVAMREYLEIDERVQVVNDRCMVLLEFFNICVDSVAERNIARVTWWFIIVLILGVL 614
           LHPLY+AMREYLEID+RVQV+NDRC V LEFF+ICVDSVA+RNIARVTWWFII +I+GV+
Sbjct: 511 LHPLYIAMREYLEIDQRVQVLNDRCKVFLEFFDICVDSVADRNIARVTWWFIIAIIVGVV 570

Query: 615 FSLTEILIRYLIIQ 628
           FSL+EIL+RY+IIQ
Sbjct: 571 FSLSEILVRYIIIQ 584

>Kpol_507.9 s507 complement(53819..55630) [1812 bp, 603 aa] {ON}
           complement(53819..55630) [1812 nt, 604 aa]
          Length = 603

 Score =  748 bits (1932), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 392/621 (63%), Positives = 462/621 (74%), Gaps = 49/621 (7%)

Query: 19  LSKRSPSILVTDYRSNRTRKSAPFAGHAADSNSNLEQVRKNLSSYSGGYKSTWXXXXXXX 78
           +SKRSPSILVTD RSN+ R SAPFA HAA + S     R++LSS       +        
Sbjct: 19  MSKRSPSILVTDSRSNKNRLSAPFARHAAGARS-----RESLSSVPSNSIGS-------- 65

Query: 79  XXXXXXXXXXXKPFKKSFASVNNGRKSRRGSQ---GRFSDISIDNILQDTSEIPXXXXXX 135
                       P+  S  + N  R   R +    GRFSDISIDNIL D+S++P      
Sbjct: 66  --------SSYVPYLNS--NKNQVRSVNRAASPQFGRFSDISIDNILSDSSDVPSGRREE 115

Query: 136 XXXXXXXXXXXMFDDHLRSSYYNFSKTITPLPPRTSKTSQKLVLIPEEP----DSRSNSL 191
                      ++D  LR+S  N+ K ++ +PPRTSKTS KLVLIPE      D   N+ 
Sbjct: 116 RRSSSSWDRFSIYDK-LRTS--NYGKGLSHIPPRTSKTSHKLVLIPENSEIPKDYMPNNF 172

Query: 192 GRPRSTS----SLRAYPRGDRSRYGIKAKARLPRLTAYHLSEGLNLKLMSKFLKKYHEVS 247
            R RS+S        + + DR          LPR+TAY+++EG NL LMSKFLK  HEVS
Sbjct: 173 LRNRSSSYKNLQSEQFQQHDRDEI-------LPRITAYNVAEGFNLDLMSKFLKSTHEVS 225

Query: 248 PRLYDECLYVAYTLPLLPGKDGYRIKSNISKKVIGGKTLIDKMIDASEQRDHHYEYYSGV 307
           PR Y ECLYVAYTLPLLPGKDGYRIKSNISKKV+GGKTLID++ID SEQRDHHYEYYSGV
Sbjct: 226 PRQYAECLYVAYTLPLLPGKDGYRIKSNISKKVVGGKTLIDELIDTSEQRDHHYEYYSGV 285

Query: 308 EVLEDANNNYELSTNPVQADTDINNIPDHLPNTMANTDNFNPSEPQYFAEETPSEQKLRE 367
           E+LEDANNNYEL+      + ++  IPDHLPN   N+D+F+PSEPQ+FAEETP EQKLRE
Sbjct: 286 EILEDANNNYELNATTPSQEPEVTVIPDHLPNPTNNSDSFDPSEPQFFAEETPIEQKLRE 345

Query: 368 QEEQLGLIANXXXXXXXXXELITGKSQHAEIFIFRYGVIVFWNFTEAQEKNILGDIAFAD 427
           ++EQ+ + ++          LI  + QHAEIFIF YGVIVFWNFTE QEKNILGDIAF++
Sbjct: 346 RKEQIKMNSDSKPMS-----LIRDEDQHAEIFIFHYGVIVFWNFTEQQEKNILGDIAFSE 400

Query: 428 YKDLVIRPLDEQDIETEEFHFEYDADTERPRIFNDVITLRSGDHIIKLTLSHSIAQSSKL 487
           YK+LVIR LDEQDIETE+FHFEYD + ERPRIFND+ITLRSGDHII+LTLSH+IAQSSKL
Sbjct: 401 YKNLVIRALDEQDIETEQFHFEYDKENERPRIFNDIITLRSGDHIIELTLSHAIAQSSKL 460

Query: 488 SRFESRLEPLLNSVTKLPKRLALYGTLGLTRQQLLKKSGKLFKLRVDVNLSSSVLDTPEF 547
           SRFESR+ P+L+S+TKLP+RLALYGTLGL R+QLLK+SGKLFKLRVDVNLSSSVLDTPEF
Sbjct: 461 SRFESRVTPILSSITKLPRRLALYGTLGLKREQLLKRSGKLFKLRVDVNLSSSVLDTPEF 520

Query: 548 FWTFEPSLHPLYVAMREYLEIDERVQVVNDRCMVLLEFFNICVDSVAERNIARVTWWFII 607
           FW+FEPSLHPLYVAMREYLEID+RVQV+NDRC V LEFF+ICVDSVAERN+ARVTWWFI+
Sbjct: 521 FWSFEPSLHPLYVAMREYLEIDQRVQVLNDRCKVFLEFFDICVDSVAERNMARVTWWFIM 580

Query: 608 VLILGVLFSLTEILIRYLIIQ 628
           ++I+ VLFSL EILIRY II 
Sbjct: 581 MIIVSVLFSLAEILIRYNIIH 601

>NCAS0F03970 Chr6 (796049..797842) [1794 bp, 597 aa] {ON} Anc_3.568
           YFR048W
          Length = 597

 Score =  735 bits (1897), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 383/620 (61%), Positives = 461/620 (74%), Gaps = 45/620 (7%)

Query: 18  PLSKRSPSILVTDYRSNRTRKSAPFAGHAADSNSNLEQVRKNLSSYSGGYKSTWXXXXXX 77
           P+SKRSPSILVTD RS++ R SAPFAGHAA S +  +   + +                 
Sbjct: 17  PMSKRSPSILVTDSRSSKHRMSAPFAGHAAGSLNQPKPFNRGI----------------- 59

Query: 78  XXXXXXXXXXXXKPFKKSFASVNNGRKSRRGSQGRFSDISIDNILQDTSEIPXXXXXXXX 137
                        P    ++S     + R+ S GRF D+SIDNIL D+S++P        
Sbjct: 60  -------------PHHTPYSSTGIHSQLRKKSSGRFGDVSIDNILLDSSDVPSGRREERL 106

Query: 138 XXXXXXXXXMFDDHLRSSYYNFSKTITPLPPRTSKTSQKLVLIPE-EP----DSRSNSLG 192
                       D LRSSY  F ++I PLP RTSKTSQKLVLIPE EP       SN L 
Sbjct: 107 SNSSQERFPFASDRLRSSY--FKRSINPLPSRTSKTSQKLVLIPEDEPIGAEVGSSNVLD 164

Query: 193 RPRSTSSLRAYPRGDRSRYGIKAKARLPRLTAYHLSEGLNLKLMSKFLKKYHEVSPRLYD 252
           R R  ++ R+  R + S      +++L R+TAY++++G NLKL+SKFL   HEVSPR+YD
Sbjct: 165 RKRHATTPRSPERYESS----YKESKLARITAYNVADGFNLKLLSKFLGDTHEVSPRMYD 220

Query: 253 ECLYVAYTLPLLPGKDGYRIKSNISKKVIGGKTLIDKMIDASEQRDHHYEYYSGVEVLED 312
           ECLY+AYTLPLLPGK+G+RIKSNISKK +GG+TLIDK+ID SEQRDHHYEY+SGVE LED
Sbjct: 221 ECLYIAYTLPLLPGKEGFRIKSNISKKTVGGQTLIDKLIDTSEQRDHHYEYFSGVETLED 280

Query: 313 ANNNYELSTNPVQADT-DINNIPDHLPNTMANTDNFNPSEPQYFAEETPSEQKLREQEEQ 371
           A+NNYEL +N +  DT D N IP HLP    N D+FNPSEPQ+FAEE+ ++Q+LR+ +  
Sbjct: 281 AHNNYELDSNAIPIDTTDPNLIPSHLPIPTTNPDSFNPSEPQFFAEESHNDQELRKGD-- 338

Query: 372 LGLIANXXXXXXXXXELITGKSQHAEIFIFRYGVIVFWNFTEAQEKNILGDIAFADYKDL 431
            G + N           I  + QHAE+FIF YGVIVFWNFTE +EKN+LGDIAF+DYK+L
Sbjct: 339 -GRLKNQKNKSINLATTIPSEDQHAELFIFHYGVIVFWNFTEMEEKNLLGDIAFSDYKNL 397

Query: 432 VIRPLDEQDIETEEFHFEYDADTERPRIFNDVITLRSGDHIIKLTLSHSIAQSSKLSRFE 491
           VIRPLDEQDIETE+FHFEYD DTERPRIFND++TLRSGDH+I+LTLSH+IAQSSKLSRFE
Sbjct: 398 VIRPLDEQDIETEQFHFEYDKDTERPRIFNDILTLRSGDHMIELTLSHAIAQSSKLSRFE 457

Query: 492 SRLEPLLNSVTKLPKRLALYGTLGLTRQQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWTF 551
           SR+ P+L SVTKLPKRLALYGTLGL R+QLLK+SGKLFKLRVDVNLSSSVLD+PEFFW+ 
Sbjct: 458 SRITPILASVTKLPKRLALYGTLGLQRKQLLKRSGKLFKLRVDVNLSSSVLDSPEFFWSS 517

Query: 552 EPSLHPLYVAMREYLEIDERVQVVNDRCMVLLEFFNICVDSVAERNIARVTWWFIIVLIL 611
           EPSLHPLY+AMREYLEID+RVQV+NDRC V LEFF+ICVDSVAERNIARVTWWFIIV+I+
Sbjct: 518 EPSLHPLYIAMREYLEIDQRVQVLNDRCKVFLEFFDICVDSVAERNIARVTWWFIIVIIV 577

Query: 612 GVLFSLTEILIRYLIIQRHQ 631
           GV+FSLTEI +RY+II  H+
Sbjct: 578 GVIFSLTEIFVRYIIIHSHR 597

>NDAI0B06280 Chr2 (1519871..1521688) [1818 bp, 605 aa] {ON}
           Anc_3.568
          Length = 605

 Score =  721 bits (1862), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 374/635 (58%), Positives = 456/635 (71%), Gaps = 47/635 (7%)

Query: 7   SKKTEKIEQKKPLSKRSPSILVTDYRSNRTRKSAPFAGHAADS-NSNLEQVRKNLSSYSG 65
           +  TE   + +P++KRSPSILVTD R+++ R SAPFAGHAA   N +  ++ +N      
Sbjct: 3   TTNTEGNGRVRPMAKRSPSILVTDSRTSKNRLSAPFAGHAAGVLNRDEHRLPRN------ 56

Query: 66  GYKSTWXXXXXXXXXXXXXXXXXXKPFKKSFASVNNGRKSRR--GSQGRFSDISIDNILQ 123
                                   K ++ +  + N   + R   G  GRFSD+SIDNIL 
Sbjct: 57  ------------------------KSYRYNATNSNAELRGRHPSGGGGRFSDVSIDNILS 92

Query: 124 DTSEIPXXXXXXXXXXXXXXXXXMFDD--HLRSSYYNFSKTITPLPPRTSKTSQKLVLIP 181
           D+S++P                 +  D  H RS Y    KTI PLP RTSKTSQ+LVLIP
Sbjct: 93  DSSDVPSGRREERLSNSSLERSPLVTDRAHSRSQYQR--KTINPLPSRTSKTSQRLVLIP 150

Query: 182 EEPDSRSNSLGRPRSTSSL-----RAYPRGDRSRYGIKAKA-RLPRLTAYHLSEGLNLKL 235
           EE D+ S    R   +S L        P+ +   Y  + +  +L R+TAY+++EG NL L
Sbjct: 151 EEGDNVSKDDIRGNISSGLDRKRHTPIPKYNDEYYQPEPRTHKLARITAYNVAEGFNLSL 210

Query: 236 MSKFLKKYHEVSPRLYDECLYVAYTLPLLPGKDGYRIKSNISKKVIGGKTLIDKMIDASE 295
           +SKFL+  HEVSPR+YDECLYVAYTLPLLPGKDG+RIKSN+SKK +GG TLIDK+ID SE
Sbjct: 211 LSKFLQDTHEVSPRMYDECLYVAYTLPLLPGKDGFRIKSNVSKKFVGGMTLIDKLIDTSE 270

Query: 296 QRDHHYEYYSGVEVLEDANNNYELS-TNPVQADTDINNIPDHLPNTMANTDNFNPSEPQY 354
           QRDHHYEY+SGVE LEDANNNYEL+ T+P   + +   IP HLP    N D FNPSEPQ+
Sbjct: 271 QRDHHYEYFSGVETLEDANNNYELNPTSPPMENVENQPIPTHLPVPPTNPDAFNPSEPQF 330

Query: 355 FAEETPSEQKLREQEEQLGLIANXXXXXXXXXELITGKSQHAEIFIFRYGVIVFWNFTEA 414
           FAEETP EQKLREQ E+L ++           ++     QHAEIF+F YGVIVFWNFTE 
Sbjct: 331 FAEETPIEQKLREQNERLNIVPTNIAMNSS--QVAANGDQHAEIFVFHYGVIVFWNFTEV 388

Query: 415 QEKNILGDIAFADYK-DLVIRPLDEQDIETEEFHFEYDADTERPRIFNDVITLRSGDHII 473
           QEKN+LGDI F+ Y+ +LVIRPLDEQDIETE+FHF YD +TERPRIFND++TLRSGDH+I
Sbjct: 389 QEKNLLGDITFSYYRRNLVIRPLDEQDIETEQFHFGYDKNTERPRIFNDIVTLRSGDHMI 448

Query: 474 KLTLSHSIAQSSKLSRFESRLEPLLNSVTKLPKRLALYGTLGLTRQQLLKKSGKLFKLRV 533
           +LTLSH+IAQSSKLSRFESR+ PLL S+TKLPKRLALYGTLGL R QLLKKSGKLFKLRV
Sbjct: 449 ELTLSHAIAQSSKLSRFESRISPLLTSITKLPKRLALYGTLGLKRSQLLKKSGKLFKLRV 508

Query: 534 DVNLSSSVLDTPEFFWTFEPSLHPLYVAMREYLEIDERVQVVNDRCMVLLEFFNICVDSV 593
           DVNLSSS+LD+PEFFW+ EPSL PLY+AMREYLEID+RVQV+NDRC+V LEFF+ICVDSV
Sbjct: 509 DVNLSSSILDSPEFFWSTEPSLSPLYIAMREYLEIDQRVQVLNDRCIVFLEFFDICVDSV 568

Query: 594 AERNIARVTWWFIIVLILGVLFSLTEILIRYLIIQ 628
           AE+NIAR TWWF+I +I+G+ FSL+EI +RY+II 
Sbjct: 569 AEKNIARFTWWFVIAIIVGLFFSLSEIFVRYIIIH 603

>ZYRO0E09548g Chr5 (760326..762104) [1779 bp, 592 aa] {ON} similar
           to uniprot|P43620 Saccharomyces cerevisiae YFR048W RMD8
           Cytosolic protein required for sporulation
          Length = 592

 Score =  719 bits (1855), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 380/635 (59%), Positives = 453/635 (71%), Gaps = 62/635 (9%)

Query: 5   KPSKKTEKIEQKK--PLSKRSPSILVTDYRSNRTRKSAPFAGHAADSNSNLEQV--RKNL 60
           KP+ + +  +Q     +SKRSPSILVTD RS   R SAPFAGHAA   S  + V  R  L
Sbjct: 4   KPTSRRKPGQQDATMSMSKRSPSILVTDSRSAGKRMSAPFAGHAAGVKSREDHVADRNRL 63

Query: 61  SSY-SGGYKSTWXXXXXXXXXXXXXXXXXXKPFKKSFASVNNGRKSRRGSQGRFSDISID 119
           + Y S G KS+                                   RR   GRFSDISID
Sbjct: 64  APYPSNGSKSS---------------------------------SVRRRPSGRFSDISID 90

Query: 120 NILQDTSEIPXXXXXXXXXXXXXXXXXMFDDHLRSS---YYNFSKTITPLPPRTSKTSQK 176
           NIL D S++P                   D    S      +++K + PLP RTSKTSQK
Sbjct: 91  NILSDASDVPSGRREERQSSSS------LDRFFPSGPLRPLSYTKMLNPLPSRTSKTSQK 144

Query: 177 LVLIPEEPDSRSNSL---GRPRSTSSLRAYPRGDRSRYGIKAKARLPRLTAYHLSEGLNL 233
           LVLIPEE   R +S    G  R+ +SL A  +  + R G K    L R+TAY+++EG NL
Sbjct: 145 LVLIPEEVAGRESSTTGYGPKRAAASLNATGKRSQGRRGRK----LSRITAYNVAEGFNL 200

Query: 234 KLMSKFLKKYHEVSPRLYDECLYVAYTLPLLPGKDGYRIKSNISKKVIGGKTLIDKMIDA 293
           + M+ FLK  HEVSPR+YDECLYVAYTLPLL GKDG+R++SN+SKKV+GGKTLIDK+ID 
Sbjct: 201 EYMADFLKATHEVSPRVYDECLYVAYTLPLLLGKDGFRVRSNVSKKVLGGKTLIDKLIDN 260

Query: 294 SEQRDHHYEYYSGVEVLEDANNNYELSTNPVQADTDINNIPDHLPNTMANTDNFNPSEPQ 353
           SEQRDHHYEYYSGVE +ED +NN+EL +N    + D +  PDHLPN M N D FNPSEPQ
Sbjct: 261 SEQRDHHYEYYSGVETIEDVDNNFELDSN---GNYDADITPDHLPNAMGNQDTFNPSEPQ 317

Query: 354 YFAEETPSEQKLREQEEQLGLIANXXXXXXXXXELITGKSQHAEIFIFRYGVIVFWNFTE 413
           +FAEETP EQ+ RE+ E     ++         ++     QHAEIFIFRYGVIVFWNFTE
Sbjct: 318 FFAEETPVEQERRERRENFNFDSS-----SKNDDVGNDSDQHAEIFIFRYGVIVFWNFTE 372

Query: 414 AQEKNILGDIAFADYKDLVIRPLDEQDIETEEFHFEYDADTERPRIFNDVITLRSGDHII 473
            QEKNILGDIAFAD+K+LVIRPLDE DIE E+FHF+YD D ERPRIFND++TLRSGDHII
Sbjct: 373 IQEKNILGDIAFADFKNLVIRPLDEHDIEREQFHFDYDKDIERPRIFNDIVTLRSGDHII 432

Query: 474 KLTLSHSIAQSSKLSRFESRLEPLLNSVTKLPKRLALYGTLGLTRQQLLKKSGKLFKLRV 533
           +LTLSH+IAQSSKLSRFESR+ P+L S TKLPKRLAL+GTLG+ R+QLLKKSGKLFKLRV
Sbjct: 433 ELTLSHAIAQSSKLSRFESRITPILTSATKLPKRLALFGTLGMKREQLLKKSGKLFKLRV 492

Query: 534 DVNLSSSVLDTPEFFWTFEPSLHPLYVAMREYLEIDERVQVVNDRCMVLLEFFNICVDSV 593
           DVNLSSS+LDTPEFFW+FEPSLHPLY+AMREYLEID+RVQV+NDR  V LEFF++CVDSV
Sbjct: 493 DVNLSSSILDTPEFFWSFEPSLHPLYIAMREYLEIDQRVQVINDRAKVYLEFFDVCVDSV 552

Query: 594 AERNIARVTWWFIIVLILGVLFSLTEILIRYLIIQ 628
           AERN+ARVTWWFI V++LGVLFS+ EIL+RY++I+
Sbjct: 553 AERNMARVTWWFIFVIVLGVLFSVAEILVRYVMIR 587

>CAGL0C01969g Chr3 complement(206652..208511) [1860 bp, 619 aa] {ON}
           similar to uniprot|P43620 Saccharomyces cerevisiae
           YFR048w
          Length = 619

 Score =  711 bits (1834), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 378/636 (59%), Positives = 441/636 (69%), Gaps = 60/636 (9%)

Query: 19  LSKRSPSILVTDYRSNRTRKSAPFAGHAADSNSN------------------LEQVRKNL 60
           +SKRSPSILVTD R+++ R+SAPFAGHAA   S                   ++ V  NL
Sbjct: 16  MSKRSPSILVTDARTSKNRRSAPFAGHAAGVRSASSSTGSGSSASAERGAELMKYVNGNL 75

Query: 61  SSYSGGYKSTWXXXXXXXXXXXXXXXXXXKPFKKSFASVNNGRKSRRGSQGRFSDISIDN 120
               G Y +T                    P              RR + GRFS+ISIDN
Sbjct: 76  RGSRGQYAATGGRSSSNHGTGDLSNRGTSSP-------------PRRRASGRFSEISIDN 122

Query: 121 ILQDTSEIPXXXXXXXXXXXXXXXXXMFDDHLRSSYYNFSKTITPLPPRTSKTSQKLVLI 180
           IL D S++P                 ++D   R       K I  LP RTSKTSQKLVLI
Sbjct: 123 ILSDRSDVPSGRREERGSNSSFDRSMIYD---RLHPQPIRKMINTLPIRTSKTSQKLVLI 179

Query: 181 PEE---PDSRSNSLGRPRSTSSLR----AYPRGDRSRYGIKAKARLPRLTAYHLSEGLNL 233
           PE+   P +R     R + T   R      P+  R         RL R+TAY+L+EG NL
Sbjct: 180 PEDGSVPPTRGALERREQPTFVKRNPTERIPKSSRDH-------RLSRITAYNLAEGFNL 232

Query: 234 KLMSKFLKKYHEVSPRLYDECLYVAYTLPLLPGKDGYRIKSNISKKVIGGKTLIDKMIDA 293
           KL+SKFLK  HEV PRLYDECLY+AYTLPLLPGKDG+R+KSN+SKKV+GGKTLI+K+ID 
Sbjct: 233 KLLSKFLKSTHEVKPRLYDECLYIAYTLPLLPGKDGFRLKSNVSKKVVGGKTLIEKLIDT 292

Query: 294 SEQRDHHYEYYSGVEVLEDANNNYELSTNPVQADTDINNIPDHLPNTMANTDNFNPSEPQ 353
           SEQRDHHYEYYSGVE LEDANNNYEL  +P   D + NN  ++ P      D+F+PSEPQ
Sbjct: 293 SEQRDHHYEYYSGVETLEDANNNYEL--DPTSVDNENNNNSNNNP-----ADSFDPSEPQ 345

Query: 354 YFAEETPSEQKLREQEEQLGLIANXXXXXXXXXELITGKSQHAEIFIFRYGVIVFWNFTE 413
           YFAEETP EQ  RE+ E L +            E      QHAEIF+F YGVIVFWNFTE
Sbjct: 346 YFAEETPKEQLERERSESLHINPGSKPIAVNADE-----DQHAEIFVFHYGVIVFWNFTE 400

Query: 414 AQEKNILGDIAFADYKDLVIRPLDEQDIETEEFHFEYDADTERPRIFNDVITLRSGDHII 473
            +EKN+LGDIAF+DYK+LVIRPLDEQDIE E+FHFEYD DTERPRIFND+ITLRSGDHII
Sbjct: 401 EEEKNLLGDIAFSDYKNLVIRPLDEQDIEIEQFHFEYDKDTERPRIFNDIITLRSGDHII 460

Query: 474 KLTLSHSIAQSSKLSRFESRLEPLLNSVTKLPKRLALYGTLGLTRQQLLKKSGKLFKLRV 533
           +LTLSH+IAQSSKLSRFESR+ P+L +VT+LPKRLALYGTLGL R+QL+KKSGKLFKLRV
Sbjct: 461 ELTLSHAIAQSSKLSRFESRISPILTTVTRLPKRLALYGTLGLKREQLIKKSGKLFKLRV 520

Query: 534 DVNLSSSVLDTPEFFWTFEPSLHPLYVAMREYLEIDERVQVVNDRCMVLLEFFNICVDSV 593
           DVNLSSSVLDTPEFFW+FEPSLHPLYVAMREYLEID+RVQV+NDRCMV LEFF+ICVDS+
Sbjct: 521 DVNLSSSVLDTPEFFWSFEPSLHPLYVAMREYLEIDQRVQVLNDRCMVFLEFFDICVDSI 580

Query: 594 AERNIARVTWWFIIVLILGVLFSLTEILIRYLIIQR 629
           AERNI RVTWWF + +++ V+FSL E+ IRYLII R
Sbjct: 581 AERNIVRVTWWFFVAIVITVIFSLIEVFIRYLIINR 616

>SAKL0F00770g Chr6 complement(66976..68886) [1911 bp, 636 aa] {ON}
           similar to uniprot|P43620 Saccharomyces cerevisiae
           YFR048W RMD8 Cytosolic protein required for sporulation
          Length = 636

 Score =  708 bits (1827), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 374/625 (59%), Positives = 452/625 (72%), Gaps = 21/625 (3%)

Query: 16  KKPLSKRSPSILVTDYRSNRTRKSAPFAGHAADSNSNLEQVRKNLSSYSGGYKSTWXXXX 75
           K  LS+RSPSILVTD RS++ R SAPFAGHAA     L+  R +  S +GG  S++    
Sbjct: 15  KGKLSRRSPSILVTDSRSSKNRMSAPFAGHAA----GLKGGRSD--SGNGGQGSSYARGS 68

Query: 76  XXXXXXXXXXXXXXKPFK--KSFASVNNGRKSRRGSQGRFSDISIDNILQDTSEIPXXXX 133
                                SF+      K  +   G+FSDIS+DNIL D S++P    
Sbjct: 69  TPNAKDSRSTRRLSFSISGDHSFSQQQALSKRSKKQHGKFSDISLDNILSDMSDVPSGRR 128

Query: 134 XXXXXXXXXXXXXMFDDHLRSSYYNFSKTITPLPPRTSKTSQKLVLIPEEPDSRSNSLGR 193
                            H R      +K I PLPPRTSKTS+KLVLIP+E + ++  L  
Sbjct: 129 EERLSLPSYEH---LSAHGRPRVRQHTKMINPLPPRTSKTSEKLVLIPDEQEKQNFLLQN 185

Query: 194 PRSTSSLRAYPRGDRSRYGIKAKARLPRLTAYHLSEGLNLKLMSKFLKKYHEVSPRLYDE 253
            +  SS  A   G++     + +  L R+TAY++++GL+LKL+S+FL++ H+VSPRLYDE
Sbjct: 186 DKRRSSSSARSYGEKMSKEHRDRI-LSRITAYNVADGLSLKLVSQFLRETHDVSPRLYDE 244

Query: 254 CLYVAYTLPLLPGKDGYRIKSNISKKVIGGKTLIDKMIDASEQRDHHYEYYSGVEVLEDA 313
           CLYV Y LPLLPGKDG+RIKSNISKK +GGKTLID++ID SEQRDHHYEYYSGVE +ED 
Sbjct: 245 CLYVPYCLPLLPGKDGFRIKSNISKKTVGGKTLIDRLIDTSEQRDHHYEYYSGVETMEDM 304

Query: 314 NNNYELSTNPVQ-AD-TDINNIPDHLPNTMANTDNFNPSEPQYFAEETPSEQKLREQEEQ 371
           +NNYE+       AD  D  ++PDHLPN   +T +F+PSEPQYFAEETP EQ+ RE+EE 
Sbjct: 305 HNNYEIDEGGANDADRVDSTSVPDHLPNPSTSTASFDPSEPQYFAEETPLEQERREREEH 364

Query: 372 LGLIANXXXXXXXXXELIT-------GKSQHAEIFIFRYGVIVFWNFTEAQEKNILGDIA 424
           L +I+          +           K QHAEIFIF YGVIVFWNFTE QEKNILGDIA
Sbjct: 365 LQIISTNSSTAPSGKQPTKDTKSRDLSKQQHAEIFIFGYGVIVFWNFTEIQEKNILGDIA 424

Query: 425 FADYKDLVIRPLDEQDIETEEFHFEYDADTERPRIFNDVITLRSGDHIIKLTLSHSIAQS 484
           FADYK LVIRPLDEQDIETE+FHFEYD DTERPRIFND+ITLRSGDHIIKLTLSH+IAQS
Sbjct: 425 FADYKSLVIRPLDEQDIETEQFHFEYDMDTERPRIFNDIITLRSGDHIIKLTLSHAIAQS 484

Query: 485 SKLSRFESRLEPLLNSVTKLPKRLALYGTLGLTRQQLLKKSGKLFKLRVDVNLSSSVLDT 544
           +KLSRFESR+ P+L +V+KLPKRLAL+GTLGL R+QLLKKSGKLFKLRVDVNLSSS+LDT
Sbjct: 485 TKLSRFESRISPILGTVSKLPKRLALHGTLGLKREQLLKKSGKLFKLRVDVNLSSSILDT 544

Query: 545 PEFFWTFEPSLHPLYVAMREYLEIDERVQVVNDRCMVLLEFFNICVDSVAERNIARVTWW 604
           P+FFW+ EPSLHPLY+AMREYLEID+RVQV+NDRC V LEFF+ICVDSVAERN+AR+TWW
Sbjct: 545 PDFFWSLEPSLHPLYLAMREYLEIDQRVQVLNDRCKVFLEFFDICVDSVAERNMARITWW 604

Query: 605 FIIVLILGVLFSLTEILIRYLIIQR 629
           FI V+ + VL S+ EIL+RY II++
Sbjct: 605 FIAVIFVSVLVSIAEILVRYFIIKK 629

>Smik_7.368 Chr7 (606969..608948) [1980 bp, 659 aa] {ON} YFR048W
           (REAL)
          Length = 659

 Score =  709 bits (1830), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 392/693 (56%), Positives = 450/693 (64%), Gaps = 114/693 (16%)

Query: 12  KIEQKKP--LSKRSPSILVTDYRSNRTRKSAPFAGHAADSNSNLEQVRKNLSSYSGGYKS 69
           K  Q  P  + KRSPSILVTD R+++ R SAPFAGHAA S  ++E   KNL    G   S
Sbjct: 4   KANQPSPGEMPKRSPSILVTDARTSKNRMSAPFAGHAAGSRKSMEN--KNLVRSQGVRSS 61

Query: 70  TWXXXXXXXXXXXXXXXXXXKPFKKSFASVNNGRKSRRGSQGRFSDISIDNILQDTSEIP 129
                                      +S+ N    RR S GRFSDISIDNIL D S+IP
Sbjct: 62  NIGS-----------------------SSLQNPTHPRRRSSGRFSDISIDNILSDNSDIP 98

Query: 130 XXXXXXXXXXXXXXXXXMFDDHLRSSYYNFS---KTITPLPPRTSKTSQKLVLIPEEPDS 186
                              +D  R+ Y   S   K I PLPPRTSKTSQKLVLIPEE D 
Sbjct: 99  SARREERLSSSS-------NDRPRN-YERLSSRRKMINPLPPRTSKTSQKLVLIPEEDDL 150

Query: 187 R------SNSLGR--PRSTS----SLRAYPRGDRSRYGIKAKARLPRLTAYHLSEGLNLK 234
                  +N+L R  PR  S    S    PR  R +        + R+TAY++++G NL 
Sbjct: 151 SHFQTMPTNALDRQRPRVGSMKPNSFDRLPRHSRDK-------SMARITAYNVADGFNLN 203

Query: 235 LMSKFLKKYHEVSPRLYDECLYVAYTLPLLPGKDGYRIKSNISKKVIGGKTLIDKMIDAS 294
            + KFL + HEVSPRLYDECLYVAYTLPLLPGK G+RIKSNISKK +GGKTLID +ID S
Sbjct: 204 QLYKFLHETHEVSPRLYDECLYVAYTLPLLPGKGGFRIKSNISKKTVGGKTLIDNLIDTS 263

Query: 295 EQRDHHYEYYSGVEVLEDANNNYELSTNPVQADT--DINNIPDHLPNTMANTDNFNPSEP 352
           EQRDHHYEYYSGVE +EDANNNYEL  N     T  D   +PDHLPN +   D+FNP EP
Sbjct: 264 EQRDHHYEYYSGVETVEDANNNYELEANGNNNSTNQDTTIVPDHLPNPVGQQDSFNPMEP 323

Query: 353 QYFAEETP----------SEQKLREQEEQL-GLIANXXXXXXXXXELITGKSQHA----- 396
           Q+FAEETP              L+++E+ + G              +  GK  HA     
Sbjct: 324 QFFAEETPLEIEERERTERINMLKKEEKDIDGSNGEKNDESEPVSYVNDGKDHHAYSACF 383

Query: 397 ---------------------------------------EIFIFRYGVIVFWNFTEAQEK 417
                                                  EIFIF YGVIVFWNFTE QEK
Sbjct: 384 SPPASSASTQSALSSSRDDFNRVYEVHSDNGHDGNDRHAEIFIFHYGVIVFWNFTEIQEK 443

Query: 418 NILGDIAFADYKDLVIRPLDEQDIETEEFHFEYDADTERPRIFNDVITLRSGDHIIKLTL 477
           NILGDI FA YK L+IRPLDEQDIETE+FHFEYD DTERPRIFND++TLRSGDHII+LTL
Sbjct: 444 NILGDITFAGYKSLMIRPLDEQDIETEQFHFEYDRDTERPRIFNDIVTLRSGDHIIELTL 503

Query: 478 SHSIAQSSKLSRFESRLEPLLNSVTKLPKRLALYGTLGLTRQQLLKKSGKLFKLRVDVNL 537
           SH+IAQSSKLSRFESR+ P+L SVTKLPKRLALYGTLGL R+QLLKKSGKLFKLRVDVNL
Sbjct: 504 SHAIAQSSKLSRFESRISPILISVTKLPKRLALYGTLGLKREQLLKKSGKLFKLRVDVNL 563

Query: 538 SSSVLDTPEFFWTFEPSLHPLYVAMREYLEIDERVQVVNDRCMVLLEFFNICVDSVAERN 597
           SS++LDTPEFFW+FEPSLHPLYVAMREYLEID+RVQV+NDRC V LEFF+ICVDSVAERN
Sbjct: 564 SSTILDTPEFFWSFEPSLHPLYVAMREYLEIDQRVQVLNDRCKVFLEFFDICVDSVAERN 623

Query: 598 IARVTWWFIIVLILGVLFSLTEILIRYLIIQRH 630
           +ARVTWWFI+V++ GV+FSLTEI +RY+II RH
Sbjct: 624 MARVTWWFILVILFGVIFSLTEIFVRYVIIHRH 656

>KNAG0D02960 Chr4 (533165..535120) [1956 bp, 651 aa] {ON} Anc_3.568
           YFR048W
          Length = 651

 Score =  699 bits (1803), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/654 (56%), Positives = 447/654 (68%), Gaps = 39/654 (5%)

Query: 6   PSKKTEKIEQKKPLSKRSPSILVTDYRSNRTRKSAPFAGHAADSNSNLEQVRKNLSSYSG 65
           PS   + +  + PL+KRSPSILVTD RS+++R SAPFAGHAA  +       K L     
Sbjct: 3   PSNAGKGVTGRDPLAKRSPSILVTDSRSSQSRSSAPFAGHAASGSMANYHKSKQLQQQ-- 60

Query: 66  GYKSTWXXXXXXXXXXXXXXXXXXKPFKKSFASVNNGRKSRRGSQGRFSDISIDNILQDT 125
             KS                     P   S  S    R  +R S GRFS++S+DNIL + 
Sbjct: 61  --KSVRGGGVGSGSSAGNYGSGARGPSGNSLNSAPGARARKRPS-GRFSNVSMDNILHND 117

Query: 126 SEIPXXXXXXXXXXXXXXXXXMFDD-HLRSSYYNFSKTITPLPPRTSKTSQKLVLIPE-- 182
           S +P                 + +  H  +SY    K I PLP RTSK SQKLVLIPE  
Sbjct: 118 SAVPSGRREQRGSTSSWDRFPVTEILHASNSY---RKMINPLPSRTSKISQKLVLIPEDD 174

Query: 183 ----EPDSRSNSLGRPRSTSSLRAYPRGDRSRYGIKA--------------KARLPRLTA 224
               E  + +   G P    S    P  DR R+  +                  L RLTA
Sbjct: 175 TVNAENGTSTKGSGNPPLRKSRNIGPVLDRKRHSTRMTNLNEFDNESYRFNSGNLSRLTA 234

Query: 225 YHLSEGLNLKLMSKFLKKYHEVSPRLYDECLYVAYTLPLLPGKDGYRIKSNISKKVIGGK 284
           Y+++EG +L ++ +FL+  HEV PRLYD+CLYV Y LPLLPGKDG+RIKSN+SKK +GG 
Sbjct: 235 YNIAEGFDLTMLHRFLQNTHEVHPRLYDDCLYVPYVLPLLPGKDGFRIKSNVSKKAVGGG 294

Query: 285 TLIDKMIDASEQRDHHYEYYSGVEVLEDANNNYELSTNPVQAD--TDINNIPDHLPNTMA 342
           TLIDK+ID SE+RDHHYEYYSGVE LEDANNNYEL       +  +D++ IPDHLP   A
Sbjct: 295 TLIDKLIDTSERRDHHYEYYSGVETLEDANNNYELEATGGHTNEMSDVSVIPDHLPQPTA 354

Query: 343 --NTDNFNPSEPQYFAEETPSEQKLREQEEQLGLIANXXXXXXXXXE------LITGKSQ 394
             N D F+P EPQ+FAEETP EQ+LR++EE   + ++         E      +    + 
Sbjct: 355 GINPDAFDPREPQFFAEETPVEQELRQREEMKSITSDEGTNKRSSRERNLERKVSEDSTD 414

Query: 395 HAEIFIFRYGVIVFWNFTEAQEKNILGDIAFADYKDLVIRPLDEQDIETEEFHFEYDADT 454
           HAE+FIF YGVIVFWNFTE QEKN+LGDI FAD KDL+IRP+DEQDIETEEFHFEYD DT
Sbjct: 415 HAELFIFHYGVIVFWNFTEEQEKNLLGDITFADDKDLMIRPIDEQDIETEEFHFEYDMDT 474

Query: 455 ERPRIFNDVITLRSGDHIIKLTLSHSIAQSSKLSRFESRLEPLLNSVTKLPKRLALYGTL 514
           ERPRIFND++TLRSGDHI+K+TLS++IAQSSKLSRFESR+ PLL++V KLPKRLAL+GTL
Sbjct: 475 ERPRIFNDIVTLRSGDHIVKMTLSYAIAQSSKLSRFESRITPLLSAVMKLPKRLALHGTL 534

Query: 515 GLTRQQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWTFEPSLHPLYVAMREYLEIDERVQV 574
           GL R+QLLKKSGKLFKLRVDVNLSSS+LDTP+FFW+ EPSLHPLY+AMREYLEID+RVQV
Sbjct: 535 GLRREQLLKKSGKLFKLRVDVNLSSSILDTPDFFWSIEPSLHPLYIAMREYLEIDKRVQV 594

Query: 575 VNDRCMVLLEFFNICVDSVAERNIARVTWWFIIVLILGVLFSLTEILIRYLIIQ 628
           VNDRC V LEFF+ICVDSVAERN+ARVTWWF++V+I+GVLFSLTEI IRY II 
Sbjct: 595 VNDRCKVFLEFFDICVDSVAERNMARVTWWFVVVIIIGVLFSLTEITIRYNIIH 648

>KLTH0G00704g Chr7 complement(47865..49712) [1848 bp, 615 aa] {ON}
           similar to uniprot|P43620 Saccharomyces cerevisiae
           YFR048W RMD8 Cytosolic protein required for sporulation
          Length = 615

 Score =  690 bits (1781), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/625 (57%), Positives = 440/625 (70%), Gaps = 37/625 (5%)

Query: 15  QKKPLSKRSPSILVTDYRSNRTRKSAPFAGHAADSNSNLEQVRKNLSSYSGGYKSTWXXX 74
           ++  +S+RSPSILVTD RS++ R  APFAGHAA         R+   +Y G     +   
Sbjct: 13  RRTSMSRRSPSILVTDARSSKKRIGAPFAGHAAGLRGG-RAAREKSDTYQG-----FSAS 66

Query: 75  XXXXXXXXXXXXXXXKPFKKSFASVNNGRKSRRGSQGRFSDISIDNILQDTSEIPXXXXX 134
                           P ++S A +          QG+FSDISIDNIL D S++P     
Sbjct: 67  SRGSMRGNSASGSDLGPMRRSRAKLRQ--------QGKFSDISIDNILSDVSDVPSGRRE 118

Query: 135 XXXXXXXXXXXXMFDDHLRSSYYNFSKTITPLPPRTSKTSQKLVLIPEEPDSRSNSLG-- 192
                        F  H  SS   ++K I PLPPRTSKTS+KLVLIPE+ D ++N+L   
Sbjct: 119 ERLSISSHEMAP-FAHH--SSPGQYTKLINPLPPRTSKTSKKLVLIPEDSDRKNNALQME 175

Query: 193 RPRSTSSLRAYPRGDRSRYGIKAKARLPRLTAYHLSEGLNLKLMSKFLKKYHEVSPRLYD 252
           R R     R  P G  +         + R+TAY+++EG  +   S FL+  H+VSPRLYD
Sbjct: 176 RRRPLKYNRHDPDGQEN-----YDEEMSRITAYNVAEGFEMSSTSDFLRYTHDVSPRLYD 230

Query: 253 ECLYVAYTLPLLPGKDGYRIKSNISKKVIGGKTLIDKMIDASEQRDHHYEYYSGVEVLED 312
           ECLYV Y LPLLPGKDG+RIKSN+SKK IGGKTLID++ID SEQRDHHYEYYSGVE +ED
Sbjct: 231 ECLYVPYCLPLLPGKDGFRIKSNVSKKTIGGKTLIDRLIDKSEQRDHHYEYYSGVETVED 290

Query: 313 ANNNYELSTNPVQADTDINN---IPDHLPNTMAN-TDNFNPSEPQYFAEETPSEQKLREQ 368
            NNN+ELS +    D + N+    PDHLPN  +N T +F+PSEPQ+FAEE     +  +Q
Sbjct: 291 MNNNFELS-DTAGKDNERNDSLPTPDHLPNNSSNNTASFDPSEPQFFAEEG----RDTDQ 345

Query: 369 EEQLGLIANXXXXXXXXXELI----TGKSQHAEIFIFRYGVIVFWNFTEAQEKNILGDIA 424
            + +  + N         + +    + K QHAEIFIF YGV+VFWNFTE QEKNILGDIA
Sbjct: 346 SKNISAVGNRSQNPYMESQSLENYGSSKQQHAEIFIFSYGVVVFWNFTEIQEKNILGDIA 405

Query: 425 FADYKDLVIRPLDEQDIETEEFHFEYDADTERPRIFNDVITLRSGDHIIKLTLSHSIAQS 484
           FA++ +++IRPLDEQDIETE+FHFEYD + ERPRIFND++TLRSGDHIIKLTLSHSIAQS
Sbjct: 406 FAEHDNMIIRPLDEQDIETEQFHFEYDMNVERPRIFNDIVTLRSGDHIIKLTLSHSIAQS 465

Query: 485 SKLSRFESRLEPLLNSVTKLPKRLALYGTLGLTRQQLLKKSGKLFKLRVDVNLSSSVLDT 544
           +KLSRFESR+ P+L +V+KLPKRLALYGTLGL R+QLLKKSGKLFKLRVDVNLSSSVLDT
Sbjct: 466 TKLSRFESRISPILGTVSKLPKRLALYGTLGLKREQLLKKSGKLFKLRVDVNLSSSVLDT 525

Query: 545 PEFFWTFEPSLHPLYVAMREYLEIDERVQVVNDRCMVLLEFFNICVDSVAERNIARVTWW 604
           PEFFW+FEPSLHPLY+AMREYLEID+RVQV+NDRC V LEFF+ICVDSVAERN+AR+TWW
Sbjct: 526 PEFFWSFEPSLHPLYLAMREYLEIDQRVQVLNDRCKVFLEFFDICVDSVAERNMARITWW 585

Query: 605 FIIVLILGVLFSLTEILIRYLIIQR 629
           FI V+ + VL S+ EI++R  II++
Sbjct: 586 FIAVIFVSVLVSICEIIVRSFIIRQ 610

>Kwal_47.19268 s47 (1163922..1165772) [1851 bp, 616 aa] {ON} YFR048W
           - Hypothetical ORF [contig 344] FULL
          Length = 616

 Score =  685 bits (1768), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 362/633 (57%), Positives = 438/633 (69%), Gaps = 34/633 (5%)

Query: 6   PSKKTEKIEQKKPLSKRSPSILVTDYRSNRTRKSAPFAGHAADSNSNLEQVRKNLSSYSG 65
           P    E   ++  +S+RSPSILVTD RSNR R  APFAGHAA        ++   SS  G
Sbjct: 4   PEDVQEGPGRRTVMSRRSPSILVTDARSNRNRNGAPFAGHAAG-------LQGGRSSKEG 56

Query: 66  ----GYKSTWXXXXXXXXXXXXXXXXXXKPFKKSFASVNNGRKSRRGSQGRFSDISIDNI 121
                 ++                     P ++S        K++   QG+FSDIS+DNI
Sbjct: 57  KDALSQRTAHVSRTSMRRSSSSGSSSDLMPLRRS--------KAKLRQQGKFSDISVDNI 108

Query: 122 LQDTSEIPXXXXXXXXXXXXXXXXXMFDDHLRSSYYNFSKTITPLPPRTSKTSQKLVLIP 181
           L D S++P                       RS+ Y  +K I PLP RTSKTS+KLVLIP
Sbjct: 109 LSDISDVPSGRREERLSTSSQEWSSS--RFGRSAQY--TKLINPLPSRTSKTSKKLVLIP 164

Query: 182 EEPDSRSNSLGRPRSTSSLRAYPRGDRSRYGIKAKA--RLPRLTAYHLSEGLNLKLMSKF 239
           EE D R N           R +PR +++ +  +      L R+TAY+++EG +L L+SKF
Sbjct: 165 EELD-RKNGF-----VQMERRWPRKNKNDFENRENPSEELSRITAYNVAEGFDLDLVSKF 218

Query: 240 LKKYHEVSPRLYDECLYVAYTLPLLPGKDGYRIKSNISKKVIGGKTLIDKMIDASEQRDH 299
           L+  H+VSPRLYDECLYV Y LPLLPGKDG+R+KSN+SKK IGGKTLID++ID SEQRDH
Sbjct: 219 LRNTHDVSPRLYDECLYVPYCLPLLPGKDGFRLKSNVSKKTIGGKTLIDRLIDKSEQRDH 278

Query: 300 HYEYYSGVEVLEDANNNYELS--TNPVQADTDINNIPDHLPNTM-ANTDNFNPSEPQYFA 356
           HYEYYSGVE +ED NNNYEL+  TN      D+   PDHLP+ + +NT +F+PSEPQ+FA
Sbjct: 279 HYEYYSGVETVEDMNNNYELNEVTNKDPDRNDVVPTPDHLPSVINSNTASFDPSEPQFFA 338

Query: 357 EETPSEQKLREQEEQLGLIANXXXXXXXXXELITGKSQHAEIFIFRYGVIVFWNFTEAQE 416
           E    E       ++                  + K +HAEIFIFRYGV+VFWNFTE QE
Sbjct: 339 EGAWGEHPAESSNDRPPHSRTSSPENNSLDGYESSKQRHAEIFIFRYGVVVFWNFTEIQE 398

Query: 417 KNILGDIAFADYKDLVIRPLDEQDIETEEFHFEYDADTERPRIFNDVITLRSGDHIIKLT 476
           KNILGDIAFADY +LVIRPLDEQDIETE FHF+YD + ERPRIFND+ITLRSGDHIIKLT
Sbjct: 399 KNILGDIAFADYDNLVIRPLDEQDIETEHFHFDYDMEVERPRIFNDIITLRSGDHIIKLT 458

Query: 477 LSHSIAQSSKLSRFESRLEPLLNSVTKLPKRLALYGTLGLTRQQLLKKSGKLFKLRVDVN 536
           LSHSIAQS+KLSRFESR+ P+L +V+KLPKRLALYGTLGL R+QLLKKSGKLFKLRVDVN
Sbjct: 459 LSHSIAQSTKLSRFESRISPILGTVSKLPKRLALYGTLGLKREQLLKKSGKLFKLRVDVN 518

Query: 537 LSSSVLDTPEFFWTFEPSLHPLYVAMREYLEIDERVQVVNDRCMVLLEFFNICVDSVAER 596
           LSSSVLDTPEFFW+FEPSLHPLY+AMREYLEID+R QV+NDRC V LEFF+ICVDSVAER
Sbjct: 519 LSSSVLDTPEFFWSFEPSLHPLYLAMREYLEIDQRAQVLNDRCKVFLEFFDICVDSVAER 578

Query: 597 NIARVTWWFIIVLILGVLFSLTEILIRYLIIQR 629
           N+AR+TWWFI V+ + VL S+ EI++R  I++R
Sbjct: 579 NMARITWWFIAVIFVSVLVSIGEIVVRSFIVRR 611

>TPHA0A06010 Chr1 (1359051..1360922) [1872 bp, 623 aa] {ON}
           Anc_3.568 YFR048W
          Length = 623

 Score =  684 bits (1766), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/623 (59%), Positives = 447/623 (71%), Gaps = 51/623 (8%)

Query: 26  ILVTDYRSNRTRKSAPFAGHAA---DSNSNL----EQVRKNLSSYSGGYKSTWXXXXXXX 78
           ILVTD RSNR R +APFA HAA   D NSN        RKN  S +G + S         
Sbjct: 32  ILVTDSRSNRNRINAPFARHAAGLRDRNSNFVGPSADSRKN--SSNGVFAS--------- 80

Query: 79  XXXXXXXXXXXKPFKKSFASVNNGRKSRRGSQGRFSDISIDNILQDTSEIPXXXXXXXXX 138
                          KS   ++   K  +  +GRFS IS+DNIL D+S++P         
Sbjct: 81  --------------PKSHQKLHMNNKHDQVLRGRFSGISVDNILSDSSDVPSGRREERRS 126

Query: 139 XXXXXXXXMFDDHLRSSYYNFSKTITPLPPRTSKTSQKLVLIPEE-PDSR-SNSLG--RP 194
                   +++   +   Y   K +  LP RTSKTSQKLVLIPE+ P S  S+ L   R 
Sbjct: 127 SSSWDRLSVYE---KFKAYPNQKKLNHLPSRTSKTSQKLVLIPEDIPGSEYSSPLSNLRQ 183

Query: 195 RSTSSLRAYPRGDRSRYGIKAKAR--------LPRLTAYHLSEGLNLKLMSKFLKKYHEV 246
           +  SS     R + + Y   +K R        LPRLTAY++++ LNLK +SKFLK+ HEV
Sbjct: 184 KPVSSPIKQSRINSTDYYDSSKIRPHNQNYDDLPRLTAYNIADALNLKSISKFLKETHEV 243

Query: 247 SPRLYDECLYVAYTLPLLPGKDGYRIKSNISKKVIGGKTLIDKMIDASEQRDHHYEYYSG 306
           S RLY+ECLYVAYTLPLL GKDG+RIKSNISKKVIGGKTLID++ID SEQRDHHYEYYSG
Sbjct: 244 SSRLYNECLYVAYTLPLLSGKDGFRIKSNISKKVIGGKTLIDELIDTSEQRDHHYEYYSG 303

Query: 307 VEVLEDANNNYELSTNPVQADTDINNIPDHLPNTMANTDNFNPSEPQYFAEETPSEQKLR 366
           +E  EDA+NNYEL  N + A+ D+  IPDHLP+   +TD FNP +PQYFAEETPSE+KLR
Sbjct: 304 IENPEDASNNYELEANGIPAENDVTVIPDHLPSVTNSTDAFNPGDPQYFAEETPSEKKLR 363

Query: 367 EQEEQLGLIANXXXXXXXXXELITGKSQHAEIFIFRYGVIVFWNFTEAQEKNILGDIAFA 426
           E++E++ +             L+T + QHAEIFIF YGVIVFWNF E QEKNILGD+AFA
Sbjct: 364 EKKEEIQI----NQKVNKAISLLTDEDQHAEIFIFHYGVIVFWNFQEIQEKNILGDVAFA 419

Query: 427 DYKDLVIRPLDEQDIETEEFHFEYDADTERPRIFNDVITLRSGDHIIKLTLSHSIAQSSK 486
           D K+L+ RPL E+DIE E+FHF YD  TERP IFND ITLRSGDHI+KLTLSH+IAQSSK
Sbjct: 420 DSKNLLTRPLSEEDIEIEQFHFAYDRHTERPSIFNDTITLRSGDHIMKLTLSHAIAQSSK 479

Query: 487 LSRFESRLEPLLNSVTKLPKRLALYGTLGLTRQQLLKKSGKLFKLRVDVNLSSSVLDTPE 546
           LSRFESR+ P+L+S+TKLPKRLALYGTLGL R+QLLK+SGKLFKLRVDVNLSSSVLDTPE
Sbjct: 480 LSRFESRVTPILHSITKLPKRLALYGTLGLKREQLLKRSGKLFKLRVDVNLSSSVLDTPE 539

Query: 547 FFWTFEPSLHPLYVAMREYLEIDERVQVVNDRCMVLLEFFNICVDSVAERNIARVTWWFI 606
           FFW+ EPSLHPLY+AMREYLEID+RVQV+NDRCMV LEFF+ICVDSVAER+I RVTWWF+
Sbjct: 540 FFWSLEPSLHPLYIAMREYLEIDQRVQVLNDRCMVFLEFFDICVDSVAERSIVRVTWWFV 599

Query: 607 IVLILGVLFSLTEILIRYLIIQR 629
            V+I+ V+FSL EI IRY++I +
Sbjct: 600 FVIIICVIFSLIEIFIRYILINK 622

>KLLA0A00715g Chr1 complement(69861..71636) [1776 bp, 591 aa] {ON}
           weakly similar to uniprot|P43620 Saccharomyces
           cerevisiae YFR048W RMD8 Cytosolic protein required for
           sporulation
          Length = 591

 Score =  663 bits (1711), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 354/612 (57%), Positives = 425/612 (69%), Gaps = 54/612 (8%)

Query: 26  ILVTDYRSNRTRKSAPFAGHAADSNSNLEQVRKNLSSYSGGYKSTWXXXXXXXXXXXXXX 85
           ILVTD RSN+ R SAPFAGHAA    N+  V ++ +S  G   S                
Sbjct: 24  ILVTDARSNKNRPSAPFAGHAAGMR-NVSSVPRSAASSGGKTDSKGSRVRRRGYDMHGD- 81

Query: 86  XXXXKPFKKSFASVNNGRKSRRGSQGRFSDISIDNILQDTSEIPXXXXXXXXXXXXXXXX 145
                  KKS +S             RFSD+S+DN+L D S++P                
Sbjct: 82  -------KKSISS-------------RFSDVSMDNLLLDVSDVPSGRRQERLSTSSYD-- 119

Query: 146 XMFDDHLRSSYYNFSKTITPLPPRTSKTSQKLVLIPEEP-DSRSNSLGRPRSTSSLRAYP 204
            MF  + R    + +K I PLP RTSKTSQKLVLIP+E  DSR+ +  R R+  + RA  
Sbjct: 120 -MFPRN-RQRGTHITKMINPLPTRTSKTSQKLVLIPDEAHDSRNINQFRKRANKTQRA-- 175

Query: 205 RGDRSRYGIKAKARLPRLTAYHLSEGLNLKLMSKFLKKYHEVSPRLYDECLYVAYTLPLL 264
               S+  +  +  LPR+TAY+++EG NL L S F+K+ H+V PRLYDECLYV YTLPLL
Sbjct: 176 -KSSSKTKMDKEVDLPRITAYNVAEGFNLSLTSTFMKQTHDVLPRLYDECLYVPYTLPLL 234

Query: 265 PGKDGYRIKSNISKKVIGGKTLIDKMIDASEQRDHHYEYYSGVEVLEDANNNYELSTNPV 324
           PGKDG+RIKSNISKK  GGK++ID +ID SE+RDHHYEY+SGVE LED NNNYEL    V
Sbjct: 235 PGKDGFRIKSNISKKTQGGKSIIDYLIDTSERRDHHYEYFSGVETLEDVNNNYELDEGGV 294

Query: 325 QADTDINNIPDHLPNTMANTD-NFNPSEPQYFAEETPSEQKLREQEEQLGLIANXXXXXX 383
             + +  N PDHLPN   NT  +F+PSEPQYFAEE  +E +L    E             
Sbjct: 295 TNNLNAENTPDHLPNPPVNTSVSFDPSEPQYFAEENNAEAELEAFNE------------- 341

Query: 384 XXXELITGKS-----QHAEIFIFRYGVIVFWNFTEAQEKNILGDIAFADYKDLVIRPLDE 438
                I GK+     QHAEIFIF YGV+VFWNFTE QEKNILGDI+F+ YK++V++PLDE
Sbjct: 342 -----INGKTSLFQQQHAEIFIFSYGVVVFWNFTEIQEKNILGDISFSSYKNMVLKPLDE 396

Query: 439 QDIETEEFHFEYDADTERPRIFNDVITLRSGDHIIKLTLSHSIAQSSKLSRFESRLEPLL 498
           QDIE E FHFEYD DTERPRIFND++TLRSGDH+  LTLSH+IAQS KLSRFE+R+ P+ 
Sbjct: 397 QDIEIESFHFEYDMDTERPRIFNDIVTLRSGDHLTALTLSHAIAQSVKLSRFEARIVPIF 456

Query: 499 NSVTKLPKRLALYGTLGLTRQQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWTFEPSLHPL 558
            SV+KLPKRLALYGTLGL R+QLLKKSGKLFKLRVDVNLSSSVLDTPEFFW+FEPSLH L
Sbjct: 457 GSVSKLPKRLALYGTLGLKREQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWSFEPSLHSL 516

Query: 559 YVAMREYLEIDERVQVVNDRCMVLLEFFNICVDSVAERNIARVTWWFIIVLILGVLFSLT 618
           Y AMREYLEID RVQV+NDRC V LEFF+ICVDS+AERN+AR+TWWFI ++ + VL S+ 
Sbjct: 517 YQAMREYLEIDPRVQVLNDRCKVFLEFFDICVDSIAERNMARITWWFITIIFISVLISIV 576

Query: 619 EILIRYLIIQRH 630
           EIL+RY II++H
Sbjct: 577 EILVRYFIIKKH 588

>Ecym_2598 Chr2 (1162883..1164691) [1809 bp, 602 aa] {ON} similar to
           Ashbya gossypii AFR265C
          Length = 602

 Score =  650 bits (1677), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/637 (54%), Positives = 426/637 (66%), Gaps = 63/637 (9%)

Query: 14  EQKKPLSKRSPSILVTDYRSNRTRKSAPFAGHAADSNSNLEQVRKNLSSYSGGYKSTWXX 73
           + +  +S+RSPSILVTD RS + R SAPFAG+A      +  +   +     G       
Sbjct: 9   QSRNMMSRRSPSILVTDSRSTKKRPSAPFAGNANTRRDKVGNIFPTVIENHSG------- 61

Query: 74  XXXXXXXXXXXXXXXXKPFKKSFASVNNGR------KSRRGSQGRFSDISIDNILQDTSE 127
                               K  AS++ GR       +RR  QG+FSD+S+D+IL + S+
Sbjct: 62  --------------------KRIASLS-GRDYIPKHSTRRARQGKFSDVSMDSILSEMSD 100

Query: 128 IPXXXXXXXXXXXXXXXXXMFDDHLRSSYYNFSKTITPLPPRTSKTSQKLVLIPEEPDSR 187
           +P                      LR   YN  K I PLP RTSKTS+K VLIPEE   +
Sbjct: 101 VPSGRREERLSSSSYDSYD----RLRPLQYN--KMINPLPSRTSKTSEKFVLIPEEGSKK 154

Query: 188 SNSLGRPRSTSSLRAYPRGDRSRYGIKAKAR---LPRLTAYHLSEGLNLKLMSKFLKKYH 244
                  RS  +  +         GI  +AR   LP L AY+++EG NLKL SKFLK+ H
Sbjct: 155 FAQGFNKRSIYNADSD--------GIFKEARSHGLPSLMAYNVAEGFNLKLASKFLKETH 206

Query: 245 EVSPRLYDECLYVAYTLPLLPGKDGYRIKSNISKKVIGGKTLIDKMIDASEQRDHHYEYY 304
           +VSPR YDECLYV Y LPLLPGK+G+R++SNISK+ IGGKTL+D++ID SEQRDHHYEYY
Sbjct: 207 DVSPRRYDECLYVPYCLPLLPGKNGFRLRSNISKQTIGGKTLMDRLIDTSEQRDHHYEYY 266

Query: 305 SGVEVLEDANNNYELSTNPVQADTDINNIPDHLPNTMANTDNFNPSEPQYFAEETPSEQK 364
           SGVE +ED  NN+E+S      D +    PDHL + ++N++ FNP EPQYFAEE   E  
Sbjct: 267 SGVETVEDMRNNFEISEISNSRDAEGLRSPDHL-SGISNSEAFNPGEPQYFAEEMSMEAN 325

Query: 365 LREQEE-QLG----------LIANXXXXXXXXXELITGKSQHAEIFIFRYGVIVFWNFTE 413
                E  LG                       +    + QHAEIFIF YGV+VFWNFTE
Sbjct: 326 SDSSSELALGNKIFKSKPADQHHQQQQQQQQQQQQQQQQQQHAEIFIFNYGVVVFWNFTE 385

Query: 414 AQEKNILGDIAFADYKDLVIRPLDEQDIETEEFHFEYDADTERPRIFNDVITLRSGDHII 473
            QEKNILGDIAF+D K++VIRPLDEQDIE E+FHFEYD +TERPRIFND+ITLRSGDHII
Sbjct: 386 IQEKNILGDIAFSDMKNMVIRPLDEQDIEIEQFHFEYDMETERPRIFNDIITLRSGDHII 445

Query: 474 KLTLSHSIAQSSKLSRFESRLEPLLNSVTKLPKRLALYGTLGLTRQQLLKKSGKLFKLRV 533
           KLTLSH+IAQS+KLSRFE R+ P+L +V+KLPKRLALYGTLGL R+QLLKKSGKLFKLRV
Sbjct: 446 KLTLSHAIAQSTKLSRFEKRISPILGTVSKLPKRLALYGTLGLKREQLLKKSGKLFKLRV 505

Query: 534 DVNLSSSVLDTPEFFWTFEPSLHPLYVAMREYLEIDERVQVVNDRCMVLLEFFNICVDSV 593
           DVNLSSSVLDTPEFFW+FEPSLHPLY AMREYLEID RVQV+N+RC V LEFF+ICV+S+
Sbjct: 506 DVNLSSSVLDTPEFFWSFEPSLHPLYTAMREYLEIDTRVQVLNERCKVFLEFFDICVNSI 565

Query: 594 AERNIARVTWWFIIVLILGVLFSLTEILIRYLIIQRH 630
           AER++AR+TWW + V+ L VL S+ EIL+RY II+RH
Sbjct: 566 AERDMARITWWLVTVIFLSVLVSIAEILVRYFIIRRH 602

>AFR265C Chr6 complement(910790..912565) [1776 bp, 591 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YFR048W
           (RMD8)
          Length = 591

 Score =  649 bits (1673), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/611 (56%), Positives = 415/611 (67%), Gaps = 56/611 (9%)

Query: 19  LSKRSPSILVTDYRSNRTRKSAPFAGHAADSNSNLEQVRKNLSSYSGGYKSTWXXXXXXX 78
           +S+RSPSILVTD RS + R SAPFAG+A          R++    +GG   T        
Sbjct: 20  MSRRSPSILVTDARSTKKRSSAPFAGNA--------NTRRD---KTGGSMPT-------- 60

Query: 79  XXXXXXXXXXXKPFKKSFASVNNGRKSRRGSQGRFSDISIDNILQDTSEIPXXXXXXXXX 138
                       P          G  S R  QG+FS++S+DNIL + S++P         
Sbjct: 61  -VIENRAGRRMGPMGGREFMPKAG--SGRTRQGKFSEVSMDNILSEMSDVPSGRRQERLS 117

Query: 139 XXXXXXXXMFDDHLRSSYYNFSKTITPLPPRTSKTSQKLVLIPEEPDSRSNSLGRPRSTS 198
                    F+   R ++YN  KTI PLP RTSKTS+K VLIP+E   R       RS S
Sbjct: 118 SSS------FEYERRPAHYN--KTIRPLPSRTSKTSEKFVLIPDENVKRFAQGFHKRSAS 169

Query: 199 SLRAYPRGDRSRYGIKAKARLPRLTAYHLSEGLNLKLMSKFLKKYHEVSPRLYDECLYVA 258
            + +        YG    A LP +TAY+++EG NL L S+FLK+ H VS R YDECLYV 
Sbjct: 170 RVFS-----ELSYGEHNTAGLPSITAYNVAEGFNLNLASQFLKETHNVSIRRYDECLYVP 224

Query: 259 YTLPLLPGKDGYRIKSNISKKVIGGKTLIDKMIDASEQRDHHYEYYSGVEVLEDANNNYE 318
           Y LPLLPGKDG+RI+SN+SKK++GGKTLID++ID SEQRDHHYEYYSGVE +ED +NN+E
Sbjct: 225 YCLPLLPGKDGFRIRSNVSKKMVGGKTLIDRLIDTSEQRDHHYEYYSGVETVEDMHNNFE 284

Query: 319 LSTNPVQADTDINNIPDHLPNTMANTDNFNPSEPQYFAEET------PSEQKLREQEEQL 372
           ++ N    D D     DHL    +N  +F+PSEPQ+FAEE       P +    EQ E+ 
Sbjct: 285 INENGNGRDPDGLRNADHLAPLSSNMQSFDPSEPQFFAEELSEIGLHPIQDSSSEQHER- 343

Query: 373 GLIANXXXXXXXXXELITGKSQHAEIFIFRYGVIVFWNFTEAQEKNILGDIAFADYKDLV 432
                         E +    QHAEIFIF YGVIVFWNFTE +EKNILGDIAF+  K++V
Sbjct: 344 --------------EKVLDAQQHAEIFIFNYGVIVFWNFTELEEKNILGDIAFSGMKNMV 389

Query: 433 IRPLDEQDIETEEFHFEYDADTERPRIFNDVITLRSGDHIIKLTLSHSIAQSSKLSRFES 492
            RPLDEQDIE E+FHFEYD DTERPRIFND+ITLRSGDHIIKLTLSH+IAQS+KLSRFE 
Sbjct: 390 TRPLDEQDIEIEQFHFEYDMDTERPRIFNDIITLRSGDHIIKLTLSHAIAQSTKLSRFEK 449

Query: 493 RLEPLLNSVTKLPKRLALYGTLGLTRQQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWTFE 552
           R+ P+L +V+KLPKRLALYGTLGL R+QLLKKSGKLFKLRVDVNLSSSVLDTPEFFW+FE
Sbjct: 450 RITPILGTVSKLPKRLALYGTLGLKREQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWSFE 509

Query: 553 PSLHPLYVAMREYLEIDERVQVVNDRCMVLLEFFNICVDSVAERNIARVTWWFIIVLILG 612
           PSLHPLY AMREYLEID RVQV+NDRC V LEFF+ICV+S+AE+++AR+TWW +IV+ + 
Sbjct: 510 PSLHPLYTAMREYLEIDPRVQVLNDRCKVFLEFFDICVNSIAEKDMARITWWLVIVIFIS 569

Query: 613 VLFSLTEILIR 623
           VL S  EIL R
Sbjct: 570 VLVSTAEILAR 580

>KAFR0J00170 Chr10 complement(27714..29537) [1824 bp, 607 aa] {ON}
           Anc_3.568 YFR048W
          Length = 607

 Score =  634 bits (1634), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/639 (54%), Positives = 432/639 (67%), Gaps = 54/639 (8%)

Query: 6   PSKKTEKIEQKKP-LSKRSPSILVTDYRSNRTRKSAPFAGHAA-DSNSNLE--QVRKNLS 61
           P+++       +P + KRSPSILVTD RS++ R SAPFAGHAA  +NS+++    R    
Sbjct: 5   PNRQNRNGSSTQPSMPKRSPSILVTDSRSSKNRMSAPFAGHAAFGTNSSVDPRTGRPPQG 64

Query: 62  SYSGGYKSTWXXXXXXXXXXXXXXXXXXKPFKKSFASVNNGRKSRRGSQGRFSDISIDNI 121
           +++ G  +                    +P       +NN R  R+   G+FSDIS+DNI
Sbjct: 65  AFNDGNSTKMY-----------------RP-----KVINNTRIRRQ--PGKFSDISLDNI 100

Query: 122 LQDTSEIPXXXXXXXXXXXXXXXXXMFDDHLRSSYYNFSKTITPLPPRTSKTSQKLVLIP 181
           L D SE+P                 + ++ L +S     K + PLP RTSK SQKLVLIP
Sbjct: 101 LADNSEVPSGRREERRSNSSWDRFPIGNERLHASSLK-KKMMNPLPTRTSKISQKLVLIP 159

Query: 182 EEPDSRSNSLGRPRSTSSLRAYPRGDRSRYG------IKAKARLPRLTAYHLSEGLNLKL 235
           EE       L + R  + L+      R   G       K    LPRLTAY+++EG NLK+
Sbjct: 160 EE------ELQKGRKANFLKEQSHTKRPSLGNIEYNFKKTVNNLPRLTAYNIAEGFNLKV 213

Query: 236 MSKFLKKYHEVSPRLYDECLYVAYTLPLLPGKDGYRIKSNISKKVIGGKTLIDKMIDASE 295
           +S FL++ H+VSPRLYD+CLYV Y LPLLPG+DG+R+KSNISK+++GGKTLID++ID SE
Sbjct: 214 LSNFLEETHDVSPRLYDDCLYVPYILPLLPGRDGFRVKSNISKRIVGGKTLIDRLIDTSE 273

Query: 296 QRDHHYEYYSGVE----VLEDANNNYELSTNPVQADTDINNIPDHLPNTMANTDNFNPSE 351
           QRDHHYE++SGVE       D  NN     N  Q +T+     D L     N D F+PSE
Sbjct: 274 QRDHHYEFFSGVEDEVNSGPDTRNNPHDKLNVNQVNTEELGPTDMLSINAVNQDVFDPSE 333

Query: 352 PQYFAEETPSEQKLREQEEQLGLIANXXXXXXXXXELITGKSQHAEIFIFRYGVIVFWNF 411
           PQ+FAE++ ++       E   L ++           +  + QHAEIFIF YGVIVFWNF
Sbjct: 334 PQFFAEDSATQTMDTSNVENSSLTSSRQAN-------LEEEDQHAEIFIFHYGVIVFWNF 386

Query: 412 TEAQEKNILGDIAF-ADYKDLVIRPLDEQDIETEEFHFEYDADT-ERPRIFNDVITLRSG 469
           TE QEKN+L DI+F  D K LV++PLDEQDIETEEFHFEY+ D  ERPRIFND+ITLRS 
Sbjct: 387 TEMQEKNVLADISFFEDTKRLVLKPLDEQDIETEEFHFEYNKDNNERPRIFNDIITLRSH 446

Query: 470 DHIIKLTLSHSIAQSSKLSRFESRLEPLLNSVTKLPKRLALYGTLGLTRQQLLKKSGKLF 529
           DH+IKLTLS++IAQSSKLSRFESR+ PL  +V KLPKRLAL+GTLG+ R+QLLKKSGKLF
Sbjct: 447 DHMIKLTLSYAIAQSSKLSRFESRISPLFTAVIKLPKRLALFGTLGMKREQLLKKSGKLF 506

Query: 530 KLRVDVNLSSSVLDTPEFFWTFEPSLHPLYVAMREYLEIDERVQVVNDRCMVLLEFFNIC 589
           KLRVDVNLSS++LDTP FFW+ EPSLHPLYVAMREYLEID+RVQVVNDRC V LEFF+IC
Sbjct: 507 KLRVDVNLSSNILDTPGFFWSIEPSLHPLYVAMREYLEIDKRVQVVNDRCKVFLEFFDIC 566

Query: 590 VDSVAERNIARVTWWFIIVLILGVLFSLTEILIRYLIIQ 628
           VDSVAE+NIARVT WF++V+I+GVLFS TEI++RY II 
Sbjct: 567 VDSVAEKNIARVTLWFLVVIIVGVLFSFTEIVVRYNIIH 605

>Suva_12.9 Chr12 complement(11366..13345) [1980 bp, 659 aa] {ON}
           YFR048W (REAL)
          Length = 659

 Score =  444 bits (1141), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 201/240 (83%), Positives = 226/240 (94%)

Query: 391 GKSQHAEIFIFRYGVIVFWNFTEAQEKNILGDIAFADYKDLVIRPLDEQDIETEEFHFEY 450
           G  +HAEIFIF YGVIVFWNFTE QEKNILGDI FADYK+L+IRPLDEQDIETE+FHFEY
Sbjct: 417 GNDRHAEIFIFHYGVIVFWNFTEIQEKNILGDITFADYKNLMIRPLDEQDIETEQFHFEY 476

Query: 451 DADTERPRIFNDVITLRSGDHIIKLTLSHSIAQSSKLSRFESRLEPLLNSVTKLPKRLAL 510
           D+DTERPRIFND++TLRSGDHII+LTLSH+IAQSSKLSRFESR+ P+L SVTKLPKRLAL
Sbjct: 477 DSDTERPRIFNDIVTLRSGDHIIELTLSHAIAQSSKLSRFESRISPILISVTKLPKRLAL 536

Query: 511 YGTLGLTRQQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWTFEPSLHPLYVAMREYLEIDE 570
           YGTLGL R+QLLKKSGKLFKLRVDVNLSS++LDTPEFFW+FEPSLHPLYVAMREYLEID+
Sbjct: 537 YGTLGLKREQLLKKSGKLFKLRVDVNLSSTILDTPEFFWSFEPSLHPLYVAMREYLEIDQ 596

Query: 571 RVQVVNDRCMVLLEFFNICVDSVAERNIARVTWWFIIVLILGVLFSLTEILIRYLIIQRH 630
           RVQV+NDRC V LEFF+ICVDSVAERN+ARVTWWFI+V++ GV+FSL EI +RY+II RH
Sbjct: 597 RVQVLNDRCKVFLEFFDICVDSVAERNMARVTWWFILVILFGVIFSLAEIFVRYIIIHRH 656

 Score =  312 bits (799), Expect = 7e-97,   Method: Compositional matrix adjust.
 Identities = 188/374 (50%), Positives = 226/374 (60%), Gaps = 42/374 (11%)

Query: 12  KIEQKKP--LSKRSPSILVTDYRSNRTRKSAPFAGHAADSNSNLEQVRKNLSSYSGGYKS 69
           K  Q  P  + KRSPSILVTD RS+R R SAPFAGHAA S  ++E   K++   S G +S
Sbjct: 4   KANQPSPGEMPKRSPSILVTDARSSRNRISAPFAGHAAGSRKSMEN--KSVER-SQGIRS 60

Query: 70  TWXXXXXXXXXXXXXXXXXXKPFKKSFASVNNGRKSRRGSQGRFSDISIDNILQDTSEIP 129
           +                    P   +          RR S GRFSDISIDNIL D SEIP
Sbjct: 61  S---------------NAGPSPMMPAHP--------RRRSSGRFSDISIDNILSDNSEIP 97

Query: 130 XXXXXXXXXXXXXXXXXMFDDHLRSSYYNFSKTITPLPPRTSKTSQKLVLIPEEPDSRS- 188
                             ++  L S      K I PLPPRTSKTSQKLVLIPEE D    
Sbjct: 98  SARREERLSSSSSDRPRYYE-RLNSR----RKMINPLPPRTSKTSQKLVLIPEEDDLNQF 152

Query: 189 -----NSLGRPRSTSSLRAYPRGDRSRYGIKAKARLPRLTAYHLSEGLNLKLMSKFLKKY 243
                N+L R R           DR    ++ K  + R+TAY++++G NL L+ +FL+  
Sbjct: 153 RNMPHNALDRQRPKVGSTKSSSHDRMPRHLREKP-MARITAYNVADGFNLNLLYRFLEDT 211

Query: 244 HEVSPRLYDECLYVAYTLPLLPGKDGYRIKSNISKKVIGGKTLIDKMIDASEQRDHHYEY 303
           HEVSPRLYDECLYVAYTLPLLPGK G+RIKSNISKK +GGKTLID +ID SEQRDHHYEY
Sbjct: 212 HEVSPRLYDECLYVAYTLPLLPGKGGFRIKSNISKKTVGGKTLIDNLIDTSEQRDHHYEY 271

Query: 304 YSGVEVLEDANNNYELSTNPVQADT--DINNIPDHLPNTMANTDNFNPSEPQYFAEETPS 361
           YSGVE +EDANNNYEL T+     T  D   +PDHLPN +   D+FNP EPQ+FAEETP 
Sbjct: 272 YSGVETVEDANNNYELETSGGNNSTSQDTVTVPDHLPNPVGQQDSFNPMEPQFFAEETPL 331

Query: 362 EQKLREQEEQLGLI 375
           EQ+ RE+ E++ ++
Sbjct: 332 EQEKRERIERMNML 345

>YFR048W Chr6 (246146..248134) [1989 bp, 662 aa] {ON}  RMD8Cytosolic
           protein required for sporulation
          Length = 662

 Score =  443 bits (1140), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 202/240 (84%), Positives = 226/240 (94%)

Query: 391 GKSQHAEIFIFRYGVIVFWNFTEAQEKNILGDIAFADYKDLVIRPLDEQDIETEEFHFEY 450
           G  +HAEIFIF YGVIVFWNFTE QEKNILGDI FADYK+L+IRPLDEQDIETE+FHFEY
Sbjct: 420 GNDRHAEIFIFHYGVIVFWNFTEIQEKNILGDITFADYKNLMIRPLDEQDIETEQFHFEY 479

Query: 451 DADTERPRIFNDVITLRSGDHIIKLTLSHSIAQSSKLSRFESRLEPLLNSVTKLPKRLAL 510
           D DTERPRIFND++TLRSGDHII+LTLSH+IAQSSKLSRFESR+ P+L SVTKLPKRLAL
Sbjct: 480 DRDTERPRIFNDIVTLRSGDHIIELTLSHAIAQSSKLSRFESRISPILISVTKLPKRLAL 539

Query: 511 YGTLGLTRQQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWTFEPSLHPLYVAMREYLEIDE 570
           YGTLGL R+QLLKKSGKLFKLRVDVNLSS++LDTPEFFW+FEPSLHPLYVAMREYLEID+
Sbjct: 540 YGTLGLKREQLLKKSGKLFKLRVDVNLSSTILDTPEFFWSFEPSLHPLYVAMREYLEIDQ 599

Query: 571 RVQVVNDRCMVLLEFFNICVDSVAERNIARVTWWFIIVLILGVLFSLTEILIRYLIIQRH 630
           RVQV+NDRC V LEFF+ICVDSVAERN+ARVTWWFI+V++ GV+FSLTEI +RY+II RH
Sbjct: 600 RVQVLNDRCKVFLEFFDICVDSVAERNMARVTWWFILVILFGVIFSLTEIFVRYVIIHRH 659

 Score =  310 bits (793), Expect = 5e-96,   Method: Compositional matrix adjust.
 Identities = 186/375 (49%), Positives = 231/375 (61%), Gaps = 43/375 (11%)

Query: 12  KIEQKKP--LSKRSPSILVTDYRSNRTRKSAPFAGHAADSNSNLEQVRKNLSSYSGGYKS 69
           K  Q  P  + KRSPSILVTD R+++ R SAPFAGHAA S  N+E       + S G +S
Sbjct: 4   KANQPSPGEMPKRSPSILVTDARTSKNRMSAPFAGHAAGSRKNMENAG---VTKSQGVRS 60

Query: 70  TWXXXXXXXXXXXXXXXXXXKPFKKSFASVNNGRKSRRGSQGRFSDISIDNILQDTSEIP 129
           +                    P + SF         RR S GRFSDISIDNIL D S+IP
Sbjct: 61  S---------------AIGPSPLQ-SFT------HPRRRSSGRFSDISIDNILSDNSDIP 98

Query: 130 XXXXXXXXXXXXXXXXXMFDDHLRSSYYNFSKTITPLPPRTSKTSQKLVLIPEEPDSR-- 187
                             ++  L S      K I PLPPRTSKTSQKLVLIPE+ +    
Sbjct: 99  SARREERLSSSSSDRPRQYE-RLSSR----RKMINPLPPRTSKTSQKLVLIPEDDNLNHF 153

Query: 188 ----SNSLGRPR-STSSLRAYPRGDRSRYGIKAKARLPRLTAYHLSEGLNLKLMSKFLKK 242
               +N+L R R    S+++       RY  K K+ + R+TAY++++G NL  + KFL++
Sbjct: 154 QTLPTNALDRQRPKVGSMKSNSFDRLPRYS-KEKS-MARITAYNVADGFNLNQLYKFLQE 211

Query: 243 YHEVSPRLYDECLYVAYTLPLLPGKDGYRIKSNISKKVIGGKTLIDKMIDASEQRDHHYE 302
            HEVSPRLYDECLYVAYTLPLLPGK G+RIKSN+SKK +GGKTLID +ID SEQRDHHYE
Sbjct: 212 THEVSPRLYDECLYVAYTLPLLPGKGGFRIKSNLSKKTMGGKTLIDNLIDTSEQRDHHYE 271

Query: 303 YYSGVEVLEDANNNYELST--NPVQADTDINNIPDHLPNTMANTDNFNPSEPQYFAEETP 360
           YYSGVE +EDANNNYEL T  N   A+ D   +PDHLPN +   D+FNP EPQ+FAEETP
Sbjct: 272 YYSGVETVEDANNNYELETSGNNNNANQDTTTVPDHLPNPVGQQDSFNPMEPQFFAEETP 331

Query: 361 SEQKLREQEEQLGLI 375
            E + RE+ E++ ++
Sbjct: 332 LEIEKRERTERINML 346

>Skud_6.139 Chr6 (241140..243125) [1986 bp, 661 aa] {ON} YFR048W
           (REAL)
          Length = 661

 Score =  441 bits (1135), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 201/240 (83%), Positives = 225/240 (93%)

Query: 391 GKSQHAEIFIFRYGVIVFWNFTEAQEKNILGDIAFADYKDLVIRPLDEQDIETEEFHFEY 450
           G  +HAEIFIF YGVIVFWNFTE QEKNILGDI FADY++L IRPLDEQDIETE+FHFEY
Sbjct: 419 GNDRHAEIFIFHYGVIVFWNFTEIQEKNILGDITFADYRNLTIRPLDEQDIETEQFHFEY 478

Query: 451 DADTERPRIFNDVITLRSGDHIIKLTLSHSIAQSSKLSRFESRLEPLLNSVTKLPKRLAL 510
           D DTERPRIFND++TLRSGDHII+LTLSH+IAQSSKLSRFESR+ P+L SVTKLPKRLAL
Sbjct: 479 DRDTERPRIFNDIVTLRSGDHIIELTLSHAIAQSSKLSRFESRISPILISVTKLPKRLAL 538

Query: 511 YGTLGLTRQQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWTFEPSLHPLYVAMREYLEIDE 570
           YGTLGL R+QLLKKSGKLFKLRVDVNLSS++LDTPEFFW+FEPSLHPLYVAMREYLEID+
Sbjct: 539 YGTLGLKREQLLKKSGKLFKLRVDVNLSSTILDTPEFFWSFEPSLHPLYVAMREYLEIDQ 598

Query: 571 RVQVVNDRCMVLLEFFNICVDSVAERNIARVTWWFIIVLILGVLFSLTEILIRYLIIQRH 630
           RVQV+NDRC V LEFF+ICVDSVAERN+ARVTWWFI+V++ GV+FSLTEI +RY+II RH
Sbjct: 599 RVQVLNDRCKVFLEFFDICVDSVAERNMARVTWWFILVILFGVIFSLTEICVRYVIIHRH 658

 Score =  310 bits (794), Expect = 5e-96,   Method: Compositional matrix adjust.
 Identities = 184/380 (48%), Positives = 223/380 (58%), Gaps = 53/380 (13%)

Query: 12  KIEQKKP--LSKRSPSILVTDYRSNRTRKSAPFAGHAADSNSNLEQVRKNLSSYSGGYKS 69
           K  Q  P  + KRSPSILVTD R+++ R SAPFAGHAA S   +E   K+L+   G   S
Sbjct: 4   KANQPSPGEMPKRSPSILVTDARTSKKRMSAPFAGHAAGSRKTMEN--KDLARSQGARSS 61

Query: 70  TWXXXXXXXXXXXXXXXXXXKPFKKSFASVNNGRKSRRGSQGRFSDISIDNILQDTSEIP 129
                                      + + N    RR S GRFSDISIDNIL D S IP
Sbjct: 62  NIGP-----------------------SPLLNQPHPRRRSSGRFSDISIDNILSDNSGIP 98

Query: 130 XXXXXXXXXXXXXXXXXMFDDHLRSSYYNFSKTITPLPPRTSKTSQKLVLIPEEPDSR-- 187
                             ++        +  K I PLPPRTSKTSQKLVLIPE+ D    
Sbjct: 99  SARREERLSSSSSDRPRHYE-----RLNSHRKMINPLPPRTSKTSQKLVLIPEDDDLNHF 153

Query: 188 ----SNSLGRPRS------TSSLRAYPRGDRSRYGIKAKARLPRLTAYHLSEGLNLKLMS 237
               + +L R R       T+S    PR  R +        + R+TAY++++G NL  + 
Sbjct: 154 KTMPTKALDRQRPKVGSMRTNSFDRLPRHSREK-------SMARITAYNVADGFNLNHLY 206

Query: 238 KFLKKYHEVSPRLYDECLYVAYTLPLLPGKDGYRIKSNISKKVIGGKTLIDKMIDASEQR 297
           KFL+  HEVSPRLYDECLYVAYTLPLLPGK G+RIKSNISKK +GGKTLID +ID SEQR
Sbjct: 207 KFLQDTHEVSPRLYDECLYVAYTLPLLPGKGGFRIKSNISKKTVGGKTLIDNLIDTSEQR 266

Query: 298 DHHYEYYSGVEVLEDANNNYELSTNPVQADT--DINNIPDHLPNTMANTDNFNPSEPQYF 355
           DHHYEYYSGVE +EDANNNYEL TN     T  D   +PDHLPN +   D+FNP EPQ+F
Sbjct: 267 DHHYEYYSGVETVEDANNNYELETNGGNNTTNQDTTIVPDHLPNPVGQQDSFNPMEPQFF 326

Query: 356 AEETPSEQKLREQEEQLGLI 375
           AEETPSE + RE+ E++ ++
Sbjct: 327 AEETPSEIENRERTERINML 346

>Suva_4.252 Chr4 (445183..446475) [1293 bp, 430 aa] {ON} YDL001W
           (REAL)
          Length = 430

 Score =  175 bits (444), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 93/244 (38%), Positives = 153/244 (62%), Gaps = 12/244 (4%)

Query: 389 ITGKSQHAEIFIFRYGVIVFWNFTEAQEKNILGDIAFADYKDLVIRPLDEQDIETEEFHF 448
           I    +H ++FIF YGV+V W FTE +EK  L DI   + + L      E+DI+ EEF++
Sbjct: 196 IIVSDKHPDLFIFEYGVVVMWGFTEREEKAFLNDIEKFEKEKLA-----EEDIQVEEFNY 250

Query: 449 EYDADTERPRIFNDVITLRSG-DHIIKLTLSHSIAQSSKLSRFESRLEPLLNSVTKLPKR 507
            Y   + +PRI+ND ITLR G ++++KL++SH+IAQS K+S FE  ++  +     +P+ 
Sbjct: 251 -YVTKSYQPRIYNDFITLRDGSNYMVKLSISHAIAQSVKISLFEELVDNTIEDTQDIPQE 309

Query: 508 LALYGTLGLTRQQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWTFEPSLHPLYVAMREYLE 567
           +A  G + ++++ ++K  G+LF LR+++NL  SVLD+PE  W+ EP L P+Y A R YLE
Sbjct: 310 IAYSGKVSMSKEDIMKSIGELFILRININLHGSVLDSPEIMWS-EPQLEPIYQATRGYLE 368

Query: 568 IDERVQVVNDRCMVLLEFFNICVDSVAERNIARVTWWFIIVLILG--VLFSLTEILIRYL 625
           I++RV ++N R  V+ +   +  + +   +   +   FI++L++G  VL S+  I++  L
Sbjct: 369 INQRVSLLNQRLEVISDLLQMLKEQLGHSHEEYLE--FIVILLVGVEVLISVINIVVDML 426

Query: 626 IIQR 629
             QR
Sbjct: 427 ASQR 430

 Score = 58.9 bits (141), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 52/102 (50%), Gaps = 11/102 (10%)

Query: 169 RTSKTSQKLVLIPEEPDSRSNS----LGRPRSTSSLRAY----PRGDRSRYGIKAKARLP 220
           RTS+T+QKL L+PEEP  R +     L      S +        R D  + G   +  LP
Sbjct: 69  RTSRTAQKLKLLPEEPFQRDDEGLTDLKNQEVYSQVNRIKDKPARRDAEKLGKAHRHLLP 128

Query: 221 RLTAYHLSEGLNLKLMSKFLK---KYHEVSPRLYDECLYVAY 259
           R TAY  S   N+K + ++LK   K H   P+L+DECLY  +
Sbjct: 129 RSTAYCTSSSYNMKELIRWLKDCRKIHHTHPKLFDECLYTPF 170

>YDL001W Chr4 (447984..449276) [1293 bp, 430 aa] {ON}
           RMD1Cytoplasmic protein required for sporulation
          Length = 430

 Score =  173 bits (438), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 92/243 (37%), Positives = 152/243 (62%), Gaps = 12/243 (4%)

Query: 389 ITGKSQHAEIFIFRYGVIVFWNFTEAQEKNILGDIAFADYKDLVIRPLDEQDIETEEFHF 448
           I    +H ++FIF YGV+V W FTE +EK  L DI   + + L      E+DI+ EEF++
Sbjct: 196 IIVSDKHPDLFIFEYGVVVMWGFTEREEKAFLNDIEKFEKEKLA-----EEDIQVEEFNY 250

Query: 449 EYDADTERPRIFNDVITLRSG-DHIIKLTLSHSIAQSSKLSRFESRLEPLLNSVTKLPKR 507
            Y   + +PRI+ND ITLR G ++++KL++SH+IAQS K+S FE  ++  +     +P+ 
Sbjct: 251 -YVTKSYQPRIYNDFITLRDGSNYMVKLSISHAIAQSVKISLFEELVDNTIEDTQDIPQE 309

Query: 508 LALYGTLGLTRQQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWTFEPSLHPLYVAMREYLE 567
           +A  G + ++++ ++K  G+LF LR+++NL  SVLD+PE  W+ EP L P+Y A R YLE
Sbjct: 310 IAYSGKVSMSKEDIMKSIGELFILRININLHGSVLDSPEIMWS-EPQLEPIYQATRGYLE 368

Query: 568 IDERVQVVNDRCMVLLEFFNICVDSVAERNIARVTWWFIIVLILG--VLFSLTEILIRYL 625
           I++RV ++N R  V+ +   +  + +   +   +   FI++L++G  VL S+  I++  L
Sbjct: 369 INQRVSLLNQRLEVISDLLQMLKEQLGHSHEEYLE--FIVILLVGVEVLISVINIVVDML 426

Query: 626 IIQ 628
             Q
Sbjct: 427 ASQ 429

 Score = 58.2 bits (139), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 37/104 (35%), Positives = 52/104 (50%), Gaps = 15/104 (14%)

Query: 169 RTSKTSQKLVLIPEEPDSRSNSLGRPRSTSSLRAY----------PRGDRSRYGIKAKAR 218
           RTS+T+QKL L+PEEP  R +   R     +   Y           R D  + G   +  
Sbjct: 69  RTSRTAQKLKLLPEEPFQRDSE--RLTDLKNQEVYSQVNRIKDKPARRDAEKLGKAHRHL 126

Query: 219 LPRLTAYHLSEGLNLKLMSKFLK---KYHEVSPRLYDECLYVAY 259
           LPR TAY  +   N+K + ++LK   K H   P+L+DECLY  +
Sbjct: 127 LPRSTAYCTASSYNMKELVRWLKDCRKLHHTHPKLFDECLYTPF 170

>Smik_4.235 Chr4 (427186..428481) [1296 bp, 431 aa] {ON} YDL001W
           (REAL)
          Length = 431

 Score =  172 bits (436), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 91/243 (37%), Positives = 152/243 (62%), Gaps = 12/243 (4%)

Query: 389 ITGKSQHAEIFIFRYGVIVFWNFTEAQEKNILGDIAFADYKDLVIRPLDEQDIETEEFHF 448
           I    +H ++FIF YGV+V W FTE +EK  L DI   + + L      E+DI+ EEF++
Sbjct: 197 IIVSDKHPDLFIFEYGVVVMWGFTEREEKAFLNDIEKFEKEKLA-----EEDIQVEEFNY 251

Query: 449 EYDADTERPRIFNDVITLRSG-DHIIKLTLSHSIAQSSKLSRFESRLEPLLNSVTKLPKR 507
            Y   + +PRI+ND ITLR G ++++KL++SH+IAQS K+S FE  ++  +     +P+ 
Sbjct: 252 -YVTKSYQPRIYNDFITLRDGSNYMVKLSISHAIAQSVKISLFEELVDNTIEDTQDIPQE 310

Query: 508 LALYGTLGLTRQQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWTFEPSLHPLYVAMREYLE 567
           +A  G + ++++ ++K  G+LF LR+++NL  S+LD+PE  W+ EP L P+Y A R YLE
Sbjct: 311 IAYSGKVSMSKEDIMKSIGELFILRININLHGSILDSPEIMWS-EPQLEPIYQATRGYLE 369

Query: 568 IDERVQVVNDRCMVLLEFFNICVDSVAERNIARVTWWFIIVLILG--VLFSLTEILIRYL 625
           I++RV ++N R  V+ +   +  + +   +   +   FI++L++G  VL S+  I++  L
Sbjct: 370 INQRVSLLNQRLEVISDLLQMLKEQLGHSHEEYLE--FIVILLVGVEVLISVINIVVDML 427

Query: 626 IIQ 628
             Q
Sbjct: 428 ASQ 430

 Score = 58.5 bits (140), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 37/102 (36%), Positives = 56/102 (54%), Gaps = 11/102 (10%)

Query: 169 RTSKTSQKLVLIPEEPDSR-SNSLGRPRS------TSSLRAYP-RGDRSRYGIKAKARLP 220
           RTS+T+QKL L+PEEP  R  + L   ++       + ++  P R D  + G   +  LP
Sbjct: 70  RTSRTAQKLKLLPEEPFQRDGDGLTELKNQEVYSQVNRIKDKPARRDAEKLGKAHRHLLP 129

Query: 221 RLTAYHLSEGLNLKLMSKFLK---KYHEVSPRLYDECLYVAY 259
           R TAY  +   N+K + ++LK   K H   P+L+DECLY  +
Sbjct: 130 RSTAYCTASSYNMKELIRWLKDSRKLHHTHPKLFDECLYTPF 171

>Skud_4.253 Chr4 (439498..440790) [1293 bp, 430 aa] {ON} YDL001W
           (REAL)
          Length = 430

 Score =  172 bits (436), Expect = 8e-47,   Method: Compositional matrix adjust.
 Identities = 92/243 (37%), Positives = 151/243 (62%), Gaps = 12/243 (4%)

Query: 389 ITGKSQHAEIFIFRYGVIVFWNFTEAQEKNILGDIAFADYKDLVIRPLDEQDIETEEFHF 448
           I    +H ++FIF YGV+V W FTE +EK  L DI   + + L      E+DI+ EEF++
Sbjct: 196 IIVSDKHPDLFIFEYGVVVMWGFTEREEKAFLNDIEKFEKEKLA-----EEDIQVEEFNY 250

Query: 449 EYDADTERPRIFNDVITLRSG-DHIIKLTLSHSIAQSSKLSRFESRLEPLLNSVTKLPKR 507
            Y   + +PRI+ND ITLR G ++++KL++SH+IAQS K+S FE  ++  +     +P+ 
Sbjct: 251 -YVTKSYQPRIYNDFITLRDGSNYMVKLSISHAIAQSVKISLFEELVDNTIEDTQDIPQE 309

Query: 508 LALYGTLGLTRQQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWTFEPSLHPLYVAMREYLE 567
           +A  G + + ++ ++K  G+LF LR+++NL  SVLD+PE  W+ EP L P+Y A R YLE
Sbjct: 310 IAYSGKVSMGKEDIMKSIGELFILRININLHGSVLDSPEIMWS-EPQLEPIYQATRGYLE 368

Query: 568 IDERVQVVNDRCMVLLEFFNICVDSVAERNIARVTWWFIIVLILG--VLFSLTEILIRYL 625
           I++RV ++N R  V+ +   +  + +   +   +   FI++L++G  VL S+  I++  L
Sbjct: 369 INQRVSLLNQRLEVISDLLQMLKEQLGHSHEEYLE--FIVILLVGVEVLISVINIVVDML 426

Query: 626 IIQ 628
             Q
Sbjct: 427 ASQ 429

 Score = 57.8 bits (138), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 37/102 (36%), Positives = 52/102 (50%), Gaps = 11/102 (10%)

Query: 169 RTSKTSQKLVLIPEEPDSRSNS----LGRPRSTSSLRAY----PRGDRSRYGIKAKARLP 220
           RTS+T+QKL L+PEEP  R +     L      S +        R D  + G   +  LP
Sbjct: 69  RTSRTAQKLKLLPEEPFQRDDEGLTDLKNQEVYSQVNRIKDKPARRDAEKLGKAHRHLLP 128

Query: 221 RLTAYHLSEGLNLKLMSKFLK---KYHEVSPRLYDECLYVAY 259
           R TAY  +   N+K + ++LK   K H   P+L+DECLY  +
Sbjct: 129 RSTAYCTASSYNMKELIRWLKDCRKIHHTHPKLFDECLYTPF 170

>NCAS0A10120 Chr1 (2022090..2023361) [1272 bp, 423 aa] {ON}
           Anc_3.209
          Length = 423

 Score =  170 bits (431), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 86/230 (37%), Positives = 147/230 (63%), Gaps = 8/230 (3%)

Query: 394 QHAEIFIFRYGVIVFWNFTEAQEKNILGDIAFADYKDLVIRPLDEQDIETEEFHFEYDAD 453
           +H+E+FIF YGV+V W FTE +EK  L D+   + + L      ++DI+ EEF++ Y   
Sbjct: 194 KHSELFIFEYGVVVMWGFTEREEKCFLTDLERFEKEKLA-----DEDIQVEEFNY-YVTK 247

Query: 454 TERPRIFNDVITLRSG-DHIIKLTLSHSIAQSSKLSRFESRLEPLLNSVTKLPKRLALYG 512
           + +PRI+ND ITLR G ++++KL++SH+IAQS K+S FE  ++  +     +P+ +A  G
Sbjct: 248 SYQPRIYNDFITLRDGSNYMVKLSISHAIAQSVKISLFEELVDNTIEDTQDIPQEIASSG 307

Query: 513 TLGLTRQQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWTFEPSLHPLYVAMREYLEIDERV 572
            + ++++ ++K  G+LF LR+++NL  SVLD+PE  W+ EP L P+Y A R YLEI++RV
Sbjct: 308 KVSMSKEDIMKSIGELFILRININLHGSVLDSPEIMWS-EPQLEPIYQATRGYLEINQRV 366

Query: 573 QVVNDRCMVLLEFFNICVDSVAERNIARVTWWFIIVLILGVLFSLTEILI 622
            ++N R  V+ +   +  + +   +   + +  II++ + VL S+  I +
Sbjct: 367 ALLNQRLEVISDLLQMLKEQLGHSHEEYLEFIVIILVGVEVLISVINIAV 416

 Score = 57.8 bits (138), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 40/122 (32%), Positives = 59/122 (48%), Gaps = 13/122 (10%)

Query: 152 LRSSYYNFSKT----ITPLPPRTSKTSQKLVLIPEEP--DSRSNSLGRPRSTSSLRAY-- 203
           +RSS    +K+     T    RTS+T+QKL L+PEEP  D R    G     S +     
Sbjct: 41  IRSSSTGLNKSNTSSTTTGAQRTSRTTQKLKLLPEEPFNDKRKQPNGDNTVYSQVNRITD 100

Query: 204 --PRGDRSRYGIKAKARLPRLTAYHLSEGLNLKLMSKFL---KKYHEVSPRLYDECLYVA 258
              R D  + G   +  LPR T Y  +   N++ + ++L   +K H   P+L+DECLY  
Sbjct: 101 MPARKDAEKLGKAHRHLLPRATGYCTASSYNMRDLIRWLRDSRKIHHTHPKLFDECLYTP 160

Query: 259 YT 260
           + 
Sbjct: 161 FV 162

>TBLA0A00170 Chr1 (16781..18298) [1518 bp, 505 aa] {ON} Anc_3.209
           YDL001W
          Length = 505

 Score =  170 bits (431), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 87/235 (37%), Positives = 147/235 (62%), Gaps = 8/235 (3%)

Query: 389 ITGKSQHAEIFIFRYGVIVFWNFTEAQEKNILGDIAFADYKDLVIRPLDEQDIETEEFHF 448
           I    +  ++FIF YGVIV W F E +E+ +L DI   + + L      E+DI+ EEF++
Sbjct: 271 INVSDKQPDLFIFEYGVIVMWGFIEREEQALLADIERFEREKLA-----EEDIQIEEFNY 325

Query: 449 EYDADTERPRIFNDVITLRSG-DHIIKLTLSHSIAQSSKLSRFESRLEPLLNSVTKLPKR 507
            Y   + +PRI+ND ITLR G ++++KL++SH+IAQS K+S FE  ++  +     +P+ 
Sbjct: 326 -YVTQSYQPRIYNDFITLRDGSNYMVKLSISHAIAQSVKISLFEELVDNTIEDTQGIPQE 384

Query: 508 LALYGTLGLTRQQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWTFEPSLHPLYVAMREYLE 567
           +AL G + ++++ ++K  G+LF LR+++NL  SVLD+PE  W+ EP L P+Y A R YLE
Sbjct: 385 IALSGKVSMSKEDIMKSIGELFILRININLHGSVLDSPEIMWS-EPQLEPIYQATRGYLE 443

Query: 568 IDERVQVVNDRCMVLLEFFNICVDSVAERNIARVTWWFIIVLILGVLFSLTEILI 622
           I++RV ++N R  V+ +   +  + +   +   + +  I+++ + VL SL  I +
Sbjct: 444 INQRVALLNQRLEVISDLLQMLKEQLGHSHEEYLEFIVIVLVGVEVLISLINIAV 498

 Score = 53.1 bits (126), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 36/115 (31%), Positives = 55/115 (47%), Gaps = 13/115 (11%)

Query: 158 NFSKTITPLPPRTSKTSQKLVLIPEEPDSRSNSLGRPRSTSSLRAY----------PRGD 207
           N SK     P RTS+T++KL L+PE P   + +  +         Y           R D
Sbjct: 131 NKSKNGRMGPQRTSRTARKLKLLPEGPFQMTPAEFQTDIFPEQEVYSQVNRITDKNARRD 190

Query: 208 RSRYGIKAKARLPRLTAYHLSEGLNLKLMSKFLK---KYHEVSPRLYDECLYVAY 259
             + G   +  LPR TAY  +   N++ +  +LK   K H+ +P+L+DECLY  +
Sbjct: 191 AEKLGKAHRHLLPRTTAYCTASSYNMRGLIHWLKETKKAHQTTPKLFDECLYTPF 245

>TDEL0D04130 Chr4 (760040..761356) [1317 bp, 438 aa] {ON} Anc_3.209
           YDL001W
          Length = 438

 Score =  168 bits (426), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 88/237 (37%), Positives = 148/237 (62%), Gaps = 12/237 (5%)

Query: 389 ITGKSQHAEIFIFRYGVIVFWNFTEAQEKNILGDIAFADYKDLVIRPLDEQDIETEEFHF 448
           I    +  E++IF YGVIV W FTE +EK  L D+   + + L      E+D++ EEF++
Sbjct: 204 INVSDKQPELYIFEYGVIVLWGFTEREEKAFLNDLERFEKEKLA-----EEDVQVEEFNY 258

Query: 449 EYDADTERPRIFNDVITLRSG-DHIIKLTLSHSIAQSSKLSRFESRLEPLLNSVTKLPKR 507
            Y   + +PRI+ND ITLR G +++IKL++SH+IAQS K+S FE  ++  +     +P+ 
Sbjct: 259 -YVTQSYQPRIYNDFITLRDGSNYMIKLSISHAIAQSVKISLFEELVDNTIEDTQDIPQE 317

Query: 508 LALYGTLGLTRQQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWTFEPSLHPLYVAMREYLE 567
           +A  G + ++++ ++K  G+LF LR+++NL  SVLD+PE  W+ EP L P+Y A R YLE
Sbjct: 318 IACSGKVSMSKEDIMKSIGELFILRININLHGSVLDSPEIMWS-EPQLEPIYHATRGYLE 376

Query: 568 IDERVQVVNDRCMVLLEFFNICVDSVAERNIARVTWWFIIVLILG--VLFSLTEILI 622
           I++RV ++N R  V+ +   +  + +   +   +   FI++L++G  VL ++  I +
Sbjct: 377 INQRVALLNQRLEVISDLLQMLKEQLGHSHEEYLE--FIVILLVGMEVLIAVVNIAV 431

 Score = 62.4 bits (150), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 49/152 (32%), Positives = 72/152 (47%), Gaps = 16/152 (10%)

Query: 169 RTSKTSQKLVLIPEEPDSRSNSLGRPR------STSSLRAYP-RGDRSRYGIKAKARLPR 221
           RTS+T+QKL L+PEEP  R   +   R        S +   P R D  + G   +  LPR
Sbjct: 78  RTSRTAQKLKLLPEEPFQRDEEMQELRDRDVYSQVSRITDKPARRDAEKLGKGHRHLLPR 137

Query: 222 LTAYHLSEGLNLKLMSKFLK---KYHEVSPRLYDECLYVAYTLPLLPGKDGYRIKSNISK 278
            TAY  +   ++K + K+LK   K H   P+L+DECLY  +      G   +  +  I  
Sbjct: 138 ATAYCTASSYHMKELIKWLKDCRKIHHTHPKLFDECLYTPFMYNDWRGDKRFEHEDVIRL 197

Query: 279 KVIGGKTLIDKMIDASEQRDHHYEYYSGVEVL 310
              GG+      I+ S+++   Y +  GV VL
Sbjct: 198 DDEGGE------INVSDKQPELYIFEYGVIVL 223

>SAKL0C11286g Chr3 complement(1012631..1013917) [1287 bp, 428 aa]
           {ON} highly similar to uniprot|Q05210 Saccharomyces
           cerevisiae YDL001W RMD1 Cytoplasmic protein required for
           sporulation
          Length = 428

 Score =  168 bits (425), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 85/235 (36%), Positives = 148/235 (62%), Gaps = 8/235 (3%)

Query: 389 ITGKSQHAEIFIFRYGVIVFWNFTEAQEKNILGDIAFADYKDLVIRPLDEQDIETEEFHF 448
           I    +  ++FIF YGVIV W FTE +EK +L D+   + + L      E+D++ E+F++
Sbjct: 194 INVSDKQPDLFIFEYGVIVMWGFTEREEKALLNDVEKFEKEKLA-----EEDVQVEQFNY 248

Query: 449 EYDADTERPRIFNDVITLRSG-DHIIKLTLSHSIAQSSKLSRFESRLEPLLNSVTKLPKR 507
            Y   + +PRI+ND ITLR G +++IKL++SH+IAQS K+S FE  ++  +     +P+ 
Sbjct: 249 -YITQSYQPRIYNDFITLRDGSNYMIKLSISHAIAQSVKISLFEELVDNTIEDTQDIPQE 307

Query: 508 LALYGTLGLTRQQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWTFEPSLHPLYVAMREYLE 567
           +A  G + ++++ ++K  G+LF LR+++NL  SVLD+PE  W+ EP L P+Y A R YLE
Sbjct: 308 IASSGKVSMSKEDIMKSIGELFILRININLHGSVLDSPEIMWS-EPQLEPIYQATRGYLE 366

Query: 568 IDERVQVVNDRCMVLLEFFNICVDSVAERNIARVTWWFIIVLILGVLFSLTEILI 622
           I++RV ++N R  V+ +   +  + +   +   + +  I+++ + VL S+  I++
Sbjct: 367 INQRVALLNQRLEVISDLLQMLKEQLGHSHEEYLEFIIIVLVGVEVLISVINIIV 421

 Score = 54.3 bits (129), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 35/103 (33%), Positives = 53/103 (51%), Gaps = 10/103 (9%)

Query: 167 PPRTSKTSQKLVLIPEEPDSRSN---SLGRPRSTSSLRAY----PRGDRSRYGIKAKARL 219
           P RTS+T+QKL L+PEEP  R +    L      S +        R D  + G   +  L
Sbjct: 66  PQRTSRTAQKLKLLPEEPFQRKDEELELVDKDVYSQVNRITDKPARRDAEKLGKGHRHLL 125

Query: 220 PRLTAYHLSEGLNLKLMSKFL---KKYHEVSPRLYDECLYVAY 259
           PR+TAY  +   ++K + ++L   K+ H    +L+DECLY  +
Sbjct: 126 PRVTAYCTASSYSMKELIRWLKDCKRIHHTHTKLFDECLYTPF 168

>Kpol_1045.58 s1045 (139327..140670) [1344 bp, 447 aa] {ON}
           (139329..140672) [1344 nt, 448 aa]
          Length = 447

 Score =  168 bits (426), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 86/235 (36%), Positives = 147/235 (62%), Gaps = 8/235 (3%)

Query: 389 ITGKSQHAEIFIFRYGVIVFWNFTEAQEKNILGDIAFADYKDLVIRPLDEQDIETEEFHF 448
           I    +  ++FIF YGV+V W FTE +EK  L DI   + + L      E+D++ EEF++
Sbjct: 211 INVSDKQPDVFIFEYGVVVMWGFTEREEKAFLNDIEKFEKEKLA-----EEDVQVEEFNY 265

Query: 449 EYDADTERPRIFNDVITLR-SGDHIIKLTLSHSIAQSSKLSRFESRLEPLLNSVTKLPKR 507
            Y  ++ +PRI+ND ITLR + +++IKL++SH +AQS K+S FE  ++  +     +P+ 
Sbjct: 266 -YITESYQPRIYNDFITLRDASNYMIKLSISHGLAQSVKISLFEELVDNTIEDTQDIPQE 324

Query: 508 LALYGTLGLTRQQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWTFEPSLHPLYVAMREYLE 567
           +A  G + ++++ ++K  G+LF LR+++NL  SVLD+PE  W+ EP L P+Y AMR YLE
Sbjct: 325 IASSGKVSMSKEDIMKSIGELFILRININLHGSVLDSPEIMWS-EPQLEPIYQAMRGYLE 383

Query: 568 IDERVQVVNDRCMVLLEFFNICVDSVAERNIARVTWWFIIVLILGVLFSLTEILI 622
           I++RV ++N R  V+ +   +  + +   +   + +  II++ + VL S+  I +
Sbjct: 384 INQRVALLNQRLEVISDLLQMLKEQLGHSHEEYLEFIVIILVGVEVLVSIINIAV 438

 Score = 56.2 bits (134), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 37/107 (34%), Positives = 52/107 (48%), Gaps = 21/107 (19%)

Query: 169 RTSKTSQKLVLIPEEPDSRSNSLGRPRSTSSLR-------------AYPRGDRSRYGIKA 215
           RTS+T+QKL L+PEEP         P +  +LR                R D  + G   
Sbjct: 84  RTSRTAQKLKLLPEEPFKID-----PENLIALRDQDVYTQVNRITDKNARRDAEKLGKAH 138

Query: 216 KARLPRLTAYHLSEGLNLKLMSKFL---KKYHEVSPRLYDECLYVAY 259
           +  LPR TAY  +   N++ + K+L   KK H   P+L+DECLY  +
Sbjct: 139 RHLLPRTTAYCTASSYNMRGLIKWLKDSKKAHHTHPKLFDECLYTPF 185

>NDAI0A07350 Chr1 complement(1671549..1673117) [1569 bp, 522 aa]
           {ON} Anc_3.209
          Length = 522

 Score =  169 bits (429), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 87/237 (36%), Positives = 147/237 (62%), Gaps = 8/237 (3%)

Query: 387 ELITGKSQHAEIFIFRYGVIVFWNFTEAQEKNILGDIAFADYKDLVIRPLDEQDIETEEF 446
           E+     ++ ++FIF YGVIV W FTE +EK  L D+   + + L      E+DI+ EEF
Sbjct: 285 EISVSDKRYPDLFIFEYGVIVMWGFTEREEKRFLNDLEKFEKEKLA-----EEDIQIEEF 339

Query: 447 HFEYDADTERPRIFNDVITLRSG-DHIIKLTLSHSIAQSSKLSRFESRLEPLLNSVTKLP 505
           ++ Y   + +PRI+ND ITLR G +++ KL++SH+IAQS K+S FE  ++  +     +P
Sbjct: 340 NY-YVTKSYQPRIYNDFITLRDGSNYMTKLSISHAIAQSVKISLFEELVDNTIEDTQDIP 398

Query: 506 KRLALYGTLGLTRQQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWTFEPSLHPLYVAMREY 565
           + +A  G + +T+++++K  G+LF LR+++NL  SVLD+PE  W+ EP L P+Y A R Y
Sbjct: 399 QEIASSGKVSMTKEEIMKSIGELFILRININLHGSVLDSPEIMWS-EPQLEPIYQATRGY 457

Query: 566 LEIDERVQVVNDRCMVLLEFFNICVDSVAERNIARVTWWFIIVLILGVLFSLTEILI 622
           LEI++RV ++N R  V+ +   +  + +   +   + +  I ++ + V+ SL  I +
Sbjct: 458 LEINQRVALLNQRLEVISDLLQMLKEQLGHSHEEYLEFIVIFLVAVEVIISLVNIAV 514

 Score = 48.5 bits (114), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 35/126 (27%), Positives = 55/126 (43%), Gaps = 34/126 (26%)

Query: 169 RTSKTSQKLVLIPEEP-------DSRS--------------NSLGRPRSTSSLRAY---- 203
           R+S+TSQKL L+P+EP        +R+              N  GR R   +   Y    
Sbjct: 106 RSSRTSQKLKLLPDEPFLDYDNSGNRASGNDVGGYITGIVNNKTGRNRVGGNEEVYSQVN 165

Query: 204 ------PRGDRSRYGIKAKARLPRLTAYHLSEGLNLKLMSKFLKKYHEV---SPRLYDEC 254
                  R D  + G   +  LPR T Y  +   N++ + ++L+ +  V    P+L+DEC
Sbjct: 166 KIMDKPARKDAEKLGKAHRHLLPRTTGYCTASSYNMRELIRWLRDFSGVYHTHPKLFDEC 225

Query: 255 LYVAYT 260
           LY  + 
Sbjct: 226 LYTPFV 231

>KNAG0K01490 Chr11 (310336..311553) [1218 bp, 405 aa] {ON} Anc_3.209
           YDL001W
          Length = 405

 Score =  166 bits (421), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 84/234 (35%), Positives = 147/234 (62%), Gaps = 8/234 (3%)

Query: 389 ITGKSQHAEIFIFRYGVIVFWNFTEAQEKNILGDIAFADYKDLVIRPLDEQDIETEEFHF 448
           I    +  ++F+F YGV+V W FTE +EK  L DI   + + L      ++D++ EEF++
Sbjct: 172 INVSDKQPDLFVFEYGVVVMWGFTEREEKAFLSDIDRFEKEKLA-----DEDVQVEEFNY 226

Query: 449 EYDADTERPRIFNDVITLRSG-DHIIKLTLSHSIAQSSKLSRFESRLEPLLNSVTKLPKR 507
            Y   + +PRI+ND ITLR G ++++KL+++H+IAQS K+S FE  ++  +     +P+ 
Sbjct: 227 -YVTQSYQPRIYNDFITLRDGSNYMVKLSIAHAIAQSVKISFFEELVDNTIEDTQDIPQE 285

Query: 508 LALYGTLGLTRQQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWTFEPSLHPLYVAMREYLE 567
           +AL G + +T+++++K  G+LF LR+++NL  SVLD+PE  W+ EP L P+Y A R YLE
Sbjct: 286 IALSGKVSMTKEEIMKSIGELFILRININLHGSVLDSPEIMWS-EPQLEPIYQATRGYLE 344

Query: 568 IDERVQVVNDRCMVLLEFFNICVDSVAERNIARVTWWFIIVLILGVLFSLTEIL 621
           I++RV ++N R  V+ +   +  + +   +   + +  II++ + V+ SL  + 
Sbjct: 345 INQRVALLNQRLEVISDLLQMLKEQLGHSHEEYLEFIVIILVGVEVVISLVNVF 398

 Score = 60.5 bits (145), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 49/166 (29%), Positives = 73/166 (43%), Gaps = 28/166 (16%)

Query: 167 PPRTSKTSQKLVLIPEEPDSRSNS------LGRPRSTSS-------------LRAYPRGD 207
           P RTS+T+QKL L+PEEP  R NS       G   ST +             L    R D
Sbjct: 32  PQRTSRTAQKLKLLPEEPFQRGNSSDTGTRTGGGASTLTPVDRDVYSQVDRILDKPARRD 91

Query: 208 RSRYGIKAKARLPRLTAYHLSEGLNLKLMSKFL---KKYHEVSPRLYDECLYVAYTLPLL 264
             + G   +  LPR TAY  +   N++ + ++    KK H    RL+DECLY  +     
Sbjct: 92  AEKLGKAHRHLLPRCTAYCTASSYNMRELIRWFKDSKKVHHTHARLFDECLYTPFMYTDW 151

Query: 265 PGKDGYRIKSNISKKVIGGKTLIDKMIDASEQRDHHYEYYSGVEVL 310
            G   +  +  I     GG+      I+ S+++   + +  GV V+
Sbjct: 152 RGDKRFEHEDVIRLDAEGGE------INVSDKQPDLFVFEYGVVVM 191

>CAGL0M10483g Chr13 complement(1049771..1051069) [1299 bp, 432 aa]
           {ON} highly similar to uniprot|Q03441 Saccharomyces
           cerevisiae YDL001w
          Length = 432

 Score =  167 bits (422), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 84/207 (40%), Positives = 134/207 (64%), Gaps = 8/207 (3%)

Query: 389 ITGKSQHAEIFIFRYGVIVFWNFTEAQEKNILGDIAFADYKDLVIRPLDEQDIETEEFHF 448
           I    +H +IFIF YGVIV W FTE +EK  L D+   + + L      E+DI+ EEF++
Sbjct: 198 INVSDKHPDIFIFEYGVIVLWGFTEREEKAFLNDLEKFEKEKLA-----EEDIQIEEFNY 252

Query: 449 EYDADTERPRIFNDVITLRSG-DHIIKLTLSHSIAQSSKLSRFESRLEPLLNSVTKLPKR 507
            Y   + +PRI+ND ITLR G +++IKL++SH+IAQS K+S FE  ++  +     +P+ 
Sbjct: 253 -YVTQSYQPRIYNDFITLRDGSNYMIKLSISHAIAQSVKISLFEELVDNTIEDTQDIPQE 311

Query: 508 LALYGTLGLTRQQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWTFEPSLHPLYVAMREYLE 567
           +A  G + +++++++K  G+LF LR+++NL  SVLD+PE  W+ EP L P+Y A R YLE
Sbjct: 312 IASSGKVSMSKEEIMKSIGELFILRININLHGSVLDSPEIMWS-EPQLEPIYQATRGYLE 370

Query: 568 IDERVQVVNDRCMVLLEFFNICVDSVA 594
           I++RV ++N R  V+ +   +  + + 
Sbjct: 371 INQRVALLNQRLEVISDLLQMLKEQLG 397

 Score = 56.6 bits (135), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 36/101 (35%), Positives = 51/101 (50%), Gaps = 10/101 (9%)

Query: 169 RTSKTSQKLVLIPEEPDSRSNSLG--RPRSTSS-----LRAYPRGDRSRYGIKAKARLPR 221
           RTS+T+QKL L+PEE   R   +   R R   S          R D  + G   +  LPR
Sbjct: 72  RTSRTAQKLKLLPEEAFHRDEEVSELRDRDVYSQVNRITDKNARRDAEKLGKAHRHLLPR 131

Query: 222 LTAYHLSEGLNLKLMSKFLK---KYHEVSPRLYDECLYVAY 259
            T+Y  +   N+K + ++LK   K H   P+L+DECLY  +
Sbjct: 132 CTSYCTASSYNMKDLIRWLKDSKKTHHTHPKLFDECLYTPF 172

>AEL004W Chr5 (630125..631552) [1428 bp, 475 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDL001W (RMD1)
          Length = 475

 Score =  167 bits (424), Expect = 9e-45,   Method: Compositional matrix adjust.
 Identities = 90/240 (37%), Positives = 149/240 (62%), Gaps = 18/240 (7%)

Query: 389 ITGKSQHAEIFIFRYGVIVFWNFTEAQEKNILGDIAFADYKDLVIRPLDEQDIETEEFHF 448
           I    +  ++FIF YGV+V W FTE +EK  L D+   + + L      E+D++ EEF++
Sbjct: 241 INVSDKQPDLFIFEYGVVVMWGFTEREEKAFLNDLERFEKEKLA-----EEDVQVEEFNY 295

Query: 449 EYDADTERPRIFNDVITLRSG-DHIIKLTLSHSIAQSSKLSRFESRLEPLLNSVTKLPKR 507
            Y   + +PRI+ND ITLR G +++IKL++SH+I+QS K+S FE  ++  +     +P+ 
Sbjct: 296 -YITQSYQPRIYNDFITLRDGSNYMIKLSISHAISQSVKISLFEELVDNTIEDTQDIPQE 354

Query: 508 LALYGTLGLTRQQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWTFEPSLHPLYVAMREYLE 567
           +A  G + +++  ++K  G+LF LR+++NL  SVLD+PE  W+ EP L P+Y A R YLE
Sbjct: 355 IASSGKVSMSKADIMKSIGELFILRININLHGSVLDSPEIMWS-EPQLEPIYQATRGYLE 413

Query: 568 IDERVQVVNDRCMVLLEFFNICVDSVA---ERNIARVTWWFIIVLILG--VLFSLTEILI 622
           I++RV ++N R  V+ +   +  + +    E N+      FI++L+LG  VL S+  I++
Sbjct: 414 INQRVALLNQRLEVVSDLLQMLKEQLGHSHEENLE-----FIVILLLGVEVLISVVNIIV 468

 Score = 63.5 bits (153), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 39/104 (37%), Positives = 57/104 (54%), Gaps = 11/104 (10%)

Query: 167 PPRTSKTSQKLVLIPEEPDSRS-----NSLGRPRSTSSLRAY---PRGDRSRYGIKAKAR 218
           P RTS+T+QKL L+PEEP  RS     +S+ R   +   R      R D  + G   +  
Sbjct: 112 PQRTSRTAQKLKLLPEEPFQRSQEQEDDSVDREVYSQVNRITDKPARRDAEKLGKSHRHL 171

Query: 219 LPRLTAYHLSEGLNLKLMSKFL---KKYHEVSPRLYDECLYVAY 259
           LPR+TAY  +   N+K + ++L   K+ H   P+L+DECLY  +
Sbjct: 172 LPRVTAYCTASSYNMKELVRWLKDCKRTHHTHPKLFDECLYTPF 215

>Ecym_5293 Chr5 (595331..596764) [1434 bp, 477 aa] {ON} similar to
           Ashbya gossypii AEL004W
          Length = 477

 Score =  167 bits (423), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 89/235 (37%), Positives = 148/235 (62%), Gaps = 18/235 (7%)

Query: 394 QHAEIFIFRYGVIVFWNFTEAQEKNILGDIAFADYKDLVIRPLDEQDIETEEFHFEYDAD 453
           +  ++FIF YGV+V W FTE +EK  L D+   + + L      E+D++ EEF++ Y   
Sbjct: 246 KQPDLFIFEYGVVVMWGFTEREEKAFLNDVEKFEKEKLA-----EEDVQVEEFNY-YVTQ 299

Query: 454 TERPRIFNDVITLRSG-DHIIKLTLSHSIAQSSKLSRFESRLEPLLNSVTKLPKRLALYG 512
           + +PRI+ND ITLR G +++IKL++SH+I+QS K+S FE  ++  +     +P+ +A  G
Sbjct: 300 SYQPRIYNDFITLRDGSNYMIKLSISHAISQSVKISLFEELVDNTIEDTQDIPQEIASSG 359

Query: 513 TLGLTRQQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWTFEPSLHPLYVAMREYLEIDERV 572
            + +++  ++K  G+LF LR+++NL  SVLD+PE  W+ EP L P+Y A R YLEI++RV
Sbjct: 360 KVSMSKADIMKSIGELFILRININLHGSVLDSPEIMWS-EPQLEPIYQATRGYLEINQRV 418

Query: 573 QVVNDRCMVLLEFFNICVDSVA---ERNIARVTWWFIIVLILG--VLFSLTEILI 622
            ++N R  V+ +   +  + +    E N+      FI++L++G  VL SL  I++
Sbjct: 419 ALLNQRLEVVSDLLQMLKEQLGHSHEENLE-----FIVILLVGVEVLISLINIIV 468

 Score = 62.0 bits (149), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 42/121 (34%), Positives = 61/121 (50%), Gaps = 13/121 (10%)

Query: 150 DHLRSSYYNFSKTITPLPPRTSKTSQKLVLIPEEPDSR-----SNSLGRPRSTSSLRAY- 203
           DH++ +  N + T    P RTS+T+QKL L+PEEP  R      + + R   +   R   
Sbjct: 97  DHVKPT--NNTATTKLGPQRTSRTAQKLKLLPEEPFQRIREQDCDIIDRDVYSQVNRITD 154

Query: 204 --PRGDRSRYGIKAKARLPRLTAYHLSEGLNLKLMS---KFLKKYHEVSPRLYDECLYVA 258
              R D  + G   +  LPR TAY  +   N+K +    K+ KK H   P+L+DECLY  
Sbjct: 155 KPARRDAEKLGKSQRHLLPRATAYCTASSYNMKELVRWLKYCKKTHHTHPKLFDECLYTP 214

Query: 259 Y 259
           +
Sbjct: 215 F 215

>KLTH0G16544g Chr7 complement(1435479..1436705) [1227 bp, 408 aa]
           {ON} similar to uniprot|Q05210 Saccharomyces cerevisiae
           YDL001W RMD1 Cytoplasmic protein required for
           sporulation
          Length = 408

 Score =  166 bits (419), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 86/238 (36%), Positives = 147/238 (61%), Gaps = 8/238 (3%)

Query: 389 ITGKSQHAEIFIFRYGVIVFWNFTEAQEKNILGDIAFADYKDLVIRPLDEQDIETEEFHF 448
           I    +  ++FIF YGVIV W FTE +EK  L D+   + + L      E+D++ E+F++
Sbjct: 174 INVSDKQPDLFIFEYGVIVMWGFTEREEKAFLNDVEKFEKEKLA-----EEDVQVEQFNY 228

Query: 449 EYDADTERPRIFNDVITLRSG-DHIIKLTLSHSIAQSSKLSRFESRLEPLLNSVTKLPKR 507
            Y   + +PRI+ND ITLR G ++++KL++SH+IAQS K+S FE  ++  +     +P++
Sbjct: 229 -YITQSYQPRIYNDFITLRDGSNYMVKLSISHAIAQSVKISLFEELVDNTIEDTQDIPQQ 287

Query: 508 LALYGTLGLTRQQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWTFEPSLHPLYVAMREYLE 567
           +A  G + + +  ++K  G+LF LR+++NL  SVLD+PE  W+ EP L P+Y A R YLE
Sbjct: 288 IASSGKVSMGKADIMKSIGELFILRININLHGSVLDSPEIMWS-EPQLEPIYHATRGYLE 346

Query: 568 IDERVQVVNDRCMVLLEFFNICVDSVAERNIARVTWWFIIVLILGVLFSLTEILIRYL 625
           I++RV ++N R  V+ +   +  + +   +   + +  I+++ + VL SL  I++  L
Sbjct: 347 INQRVALLNQRLEVISDLLQMLKEQLGHSHEEYLEFIIIVLVGVEVLISLINIVVDLL 404

 Score = 60.8 bits (146), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 54/102 (52%), Gaps = 11/102 (10%)

Query: 169 RTSKTSQKLVLIPEEPDSRSNSLGRPRSTSSLRAY--------PRGDRSRYGIKAKARLP 220
           RTS+T+QKL L+PEEP +R   L    +   + +          R D  + G   +  LP
Sbjct: 47  RTSRTAQKLKLLPEEPFNRPEDLLLGNADRDVYSQVNRITDTPARRDAEKLGKGQRHLLP 106

Query: 221 RLTAYHLSEGLNLKLMSKFL---KKYHEVSPRLYDECLYVAY 259
           R+TAY  S   N+K + ++L   KK H   P+L+DECL+  +
Sbjct: 107 RVTAYCTSSAYNMKELVRWLKGCKKAHHTHPKLFDECLFTPF 148

>KAFR0F02500 Chr6 complement(484705..486105) [1401 bp, 466 aa] {ON}
           Anc_3.209 YDL001W
          Length = 466

 Score =  166 bits (421), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 86/242 (35%), Positives = 150/242 (61%), Gaps = 8/242 (3%)

Query: 389 ITGKSQHAEIFIFRYGVIVFWNFTEAQEKNILGDIAFADYKDLVIRPLDEQDIETEEFHF 448
           I    +  ++FIF YGVIV W FTE +EK  L DI   + + L      E+D++ EEF++
Sbjct: 232 INVSDKQPDLFIFEYGVIVMWGFTEREEKAFLNDIERFEKEKLA-----EEDVQVEEFNY 286

Query: 449 EYDADTERPRIFNDVITLRSG-DHIIKLTLSHSIAQSSKLSRFESRLEPLLNSVTKLPKR 507
            Y   + +PRI+ND ITLR+G +++ KL++SH+IAQS K+S FE  ++  +     +P++
Sbjct: 287 -YVTQSYQPRIYNDFITLRNGSNYMTKLSISHAIAQSVKISLFEELVDNTIEDTEDIPQQ 345

Query: 508 LALYGTLGLTRQQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWTFEPSLHPLYVAMREYLE 567
           +A  G + ++++ +++  G+LF LR+++NL  SVLD+P+  W+ EP L P+Y A R YLE
Sbjct: 346 IASSGKVSMSKEDIMRSIGELFILRININLHGSVLDSPDIMWS-EPQLEPIYQATRGYLE 404

Query: 568 IDERVQVVNDRCMVLLEFFNICVDSVAERNIARVTWWFIIVLILGVLFSLTEILIRYLII 627
           I++RV+++N R  V+ +   +  + +       + +  II++ + VL S+  I +  +  
Sbjct: 405 INQRVELLNQRLEVVSDLLQMLKEQLGHSQEEYLEFIVIILVGVEVLISVINIAVDMIAN 464

Query: 628 QR 629
           +R
Sbjct: 465 KR 466

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 33/106 (31%), Positives = 54/106 (50%), Gaps = 15/106 (14%)

Query: 169 RTSKTSQKLVLIPEEPDSRSNSL--GRPRSTSSLRAY----------PRGDRSRYGIKAK 216
           RTS+T+QKL L+PEE  ++ +S+  G   +      Y           R D  + G   +
Sbjct: 101 RTSRTAQKLKLLPEEAFAKESSIDSGITVNDEDREVYSQVNRIKDKPARIDAQKLGKAHR 160

Query: 217 ARLPRLTAYHLSEGLNLKLMSKFL---KKYHEVSPRLYDECLYVAY 259
             LPR TAY  +   N++ + +++   KK H   P+L+DECL+  +
Sbjct: 161 HLLPRCTAYCTASSYNMRELIRWIKNSKKIHFTHPKLFDECLFTPF 206

>Kwal_27.11001 s27 complement(593288..594514) [1227 bp, 408 aa] {ON}
           YDL001W - Hypothetical ORF [contig 32] FULL
          Length = 408

 Score =  165 bits (417), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 86/238 (36%), Positives = 148/238 (62%), Gaps = 8/238 (3%)

Query: 389 ITGKSQHAEIFIFRYGVIVFWNFTEAQEKNILGDIAFADYKDLVIRPLDEQDIETEEFHF 448
           I    +  ++FIF YGV+V W FTE +EK  L D+   + + L      E+D++ E+F++
Sbjct: 174 INVSDKQPDLFIFEYGVVVMWGFTEREEKAFLNDLEKFEKEKLA-----EEDVQLEQFNY 228

Query: 449 EYDADTERPRIFNDVITLRSG-DHIIKLTLSHSIAQSSKLSRFESRLEPLLNSVTKLPKR 507
            Y   + +PRI+ND ITLR G +++IKL++SH+IAQS K+S FE  ++  +     +P++
Sbjct: 229 -YITQSYQPRIYNDFITLRDGSNYMIKLSISHAIAQSVKISLFEELVDNTIEDTQDIPQQ 287

Query: 508 LALYGTLGLTRQQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWTFEPSLHPLYVAMREYLE 567
           +A  G + + ++ ++K  G+LF LR+++NL  SVLD+PE  W+ EP L P+Y A R YLE
Sbjct: 288 IASSGKVSMGKEDIMKSIGELFILRININLHGSVLDSPEIMWS-EPQLEPIYHATRGYLE 346

Query: 568 IDERVQVVNDRCMVLLEFFNICVDSVAERNIARVTWWFIIVLILGVLFSLTEILIRYL 625
           I++RV ++N R  V+ +   +  + +   +   + +  I+++ + VL SL  I++  L
Sbjct: 347 INQRVALLNQRLEVISDLLQMLKEQLGHSHEEYLEFIIIVLVGVEVLVSLINIIVDLL 404

 Score = 63.9 bits (154), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 39/109 (35%), Positives = 57/109 (52%), Gaps = 21/109 (19%)

Query: 167 PPRTSKTSQKLVLIPEEPDSRS-------------NSLGRPRSTSSLRAYPRGDRSRYGI 213
           P RTS+T+QKL L+PEEP +R              + +GR   T +     R D  + G 
Sbjct: 45  PQRTSRTTQKLKLLPEEPFNRQQDELLSSTDREVYSQVGRITDTPA-----RRDAEKLGK 99

Query: 214 KAKARLPRLTAYHLSEGLNLKLMSKFL---KKYHEVSPRLYDECLYVAY 259
             +  LPR+TAY  S   N+K + ++L   KK H   P+L+DECL+  +
Sbjct: 100 GQRHLLPRVTAYCTSSSYNMKELIRWLKDCKKVHHTHPKLFDECLFTPF 148

>TPHA0P00550 Chr16 complement(110346..111686) [1341 bp, 446 aa] {ON}
           Anc_3.209 YDL001W
          Length = 446

 Score =  165 bits (418), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 84/235 (35%), Positives = 145/235 (61%), Gaps = 8/235 (3%)

Query: 389 ITGKSQHAEIFIFRYGVIVFWNFTEAQEKNILGDIAFADYKDLVIRPLDEQDIETEEFHF 448
           I    +  ++FIF YGV+V W FTE +EK  L DI   + + L      E+DI+ EEF++
Sbjct: 212 INVSDKQPDVFIFEYGVVVLWGFTEREEKEFLNDIEKYEKEKLA-----EEDIQIEEFNY 266

Query: 449 EYDADTERPRIFNDVITLRSG-DHIIKLTLSHSIAQSSKLSRFESRLEPLLNSVTKLPKR 507
            Y  ++ +PRI+ND ITLR G +++ KL++SH+++QS K+S FE  L+  +     +P+ 
Sbjct: 267 -YVTESYQPRIYNDFITLRDGSNYMTKLSISHALSQSVKISLFEELLDNTIEDTQDIPQE 325

Query: 508 LALYGTLGLTRQQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWTFEPSLHPLYVAMREYLE 567
           +A  G + ++++ ++K  G+LF LR+++NL  S+LD+PE  W+ EP L P+Y A R YLE
Sbjct: 326 IASSGKVSMSKEDIMKSIGELFILRININLHGSILDSPEIMWS-EPQLEPIYQATRGYLE 384

Query: 568 IDERVQVVNDRCMVLLEFFNICVDSVAERNIARVTWWFIIVLILGVLFSLTEILI 622
           I++RV ++N R  V+ +   +  + +       + +  I+++ + VL S+  I +
Sbjct: 385 INQRVALLNQRLEVVSDLLQMLKEQLGHTQEEYLEFIVIVLVGVEVLLSVINISV 439

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 46/169 (27%), Positives = 78/169 (46%), Gaps = 27/169 (15%)

Query: 158 NFSKTITPLPPRTSKTSQKLVLIPEEP-------------DSRSNSLGRPRSTSSLRAYP 204
           N +K +     RTS+T+QKL L+PEEP             +   + + R +  S+     
Sbjct: 74  NKNKHVRSGAQRTSRTTQKLKLLPEEPYDLDHNNFPDLPENEVYSQVNRIKDKSA----- 128

Query: 205 RGDRSRYGIKAKARLPRLTAYHLSEGLNLKLMSKFLK-KYHEV--SPRLYDECLYVAYTL 261
           R D  + G   +  LPR+TA+  +   N++ + ++LK   H+    P+L+DECLY  +  
Sbjct: 129 RRDAEKLGKAHRHLLPRVTAFCTASSYNMRGLIRWLKDSKHQFRSHPKLFDECLYTPFIY 188

Query: 262 PLLPGKDGYRIKSNISKKVIGGKTLIDKMIDASEQRDHHYEYYSGVEVL 310
               G   Y  +  I     GG+      I+ S+++   + +  GV VL
Sbjct: 189 TDSRGDKRYEREDFIRFDDEGGE------INVSDKQPDVFIFEYGVVVL 231

>ZYRO0A04400g Chr1 (359271..360647) [1377 bp, 458 aa] {ON} similar
           to uniprot|Q05210 Saccharomyces cerevisiae YDL001W RMD1
           Cytoplasmic protein required for sporulation
          Length = 458

 Score =  164 bits (416), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 84/226 (37%), Positives = 143/226 (63%), Gaps = 10/226 (4%)

Query: 389 ITGKSQHAEIFIFRYGVIVFWNFTEAQEKNILGDIAFADYKDLVIRPLDEQDIETEEFHF 448
           I    +  ++F+F YGV+V W FTE +EK  L DI   + + L      E+D++ EEF++
Sbjct: 224 INVSDKQPDLFVFEYGVVVLWGFTEREEKAFLNDIEGFEKEKLA-----EEDVQIEEFNY 278

Query: 449 EYDADTERPRIFNDVITLR-SGDHIIKLTLSHSIAQSSKLSRFESRLEPLLNSVTKLPKR 507
            Y   + +PRI+ND ITLR + +++IKL++SH+IAQS K+S FE  ++  +     +P+ 
Sbjct: 279 -YVTQSYQPRIYNDFITLRDASNYMIKLSISHAIAQSVKISLFEELVDNTIEDTQDIPQE 337

Query: 508 LALYGTLGLTRQQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWTFEPSLHPLYVAMREYLE 567
           +A  G + ++++ ++K  G+LF LR+++NL  SVLD+PE  W+ EP L P+Y A R YLE
Sbjct: 338 IASSGKVSMSKEDIMKSIGELFILRININLHGSVLDSPEIMWS-EPQLEPIYQATRGYLE 396

Query: 568 IDERVQVVNDRCMVLLEFFNICVDSVAERNIARVTWWFIIVLILGV 613
           I++RV ++N R  V+ +   +  + +   +   +   FI++L++GV
Sbjct: 397 INQRVALLNQRLEVVSDLLQMLKEQLGHSHEEYLE--FIVILLVGV 440

 Score = 58.9 bits (141), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 41/111 (36%), Positives = 59/111 (53%), Gaps = 12/111 (10%)

Query: 160 SKTITPLPPRTSKTSQKLVLIPEEP---DSRSNSLGRPRSTSS----LRAYP-RGDRSRY 211
           +K I     RTS+T+QKL L+PEEP   D  S  L R R   S    +   P R D  + 
Sbjct: 89  NKQIRTGAQRTSRTAQKLKLLPEEPFQRDEESLDL-RDRDVYSQVNRITDKPARRDAEKL 147

Query: 212 GIKAKARLPRLTAYHLSEGLNLKLMSKFL---KKYHEVSPRLYDECLYVAY 259
           G   +  LPR TAY  + G +++ + ++L   KK H   P+L+DEC+Y  +
Sbjct: 148 GKSHRHLLPRATAYCTASGYSMRELVRWLKECKKIHHTHPKLFDECIYTPF 198

>KLLA0E17381g Chr5 complement(1540387..1541721) [1335 bp, 444 aa]
           {ON} similar to uniprot|Q05210 Saccharomyces cerevisiae
           YDL001W RMD1 Cytoplasmic protein required for
           sporulation
          Length = 444

 Score =  162 bits (410), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 81/207 (39%), Positives = 133/207 (64%), Gaps = 8/207 (3%)

Query: 389 ITGKSQHAEIFIFRYGVIVFWNFTEAQEKNILGDIAFADYKDLVIRPLDEQDIETEEFHF 448
           I+   +  ++FIF YGVIV W FTE +EK  L D+   + + L      E+D++ E+F++
Sbjct: 210 ISTSDKQPDLFIFEYGVIVMWGFTEREEKAFLRDLERFEKEKLA-----EEDVQVEQFNY 264

Query: 449 EYDADTERPRIFNDVITLRSG-DHIIKLTLSHSIAQSSKLSRFESRLEPLLNSVTKLPKR 507
            Y   + +PRI+ND ITLR G +++IKL++SH+IAQS K+S FE  ++  +     +P+ 
Sbjct: 265 -YITQSYQPRIYNDFITLRDGSNYMIKLSISHAIAQSVKISLFEELVDNTIEDTQDIPQE 323

Query: 508 LALYGTLGLTRQQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWTFEPSLHPLYVAMREYLE 567
           +A  G + ++++ ++K  G+LF LR+++NL  SVLD+PE  W+ EP L P+Y A R YLE
Sbjct: 324 IASSGKVSMSKEDIMKSIGELFILRININLHGSVLDSPEIMWS-EPQLEPIYQATRGYLE 382

Query: 568 IDERVQVVNDRCMVLLEFFNICVDSVA 594
           I++RV +VN R  V+ +   +  + + 
Sbjct: 383 INQRVALVNQRLEVISDLLQMLKEQLG 409

 Score = 53.9 bits (128), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 54/103 (52%), Gaps = 10/103 (9%)

Query: 167 PPRTSKTSQKLVLIPEEPDSRSNSLGRPR------STSSLRAYP-RGDRSRYGIKAKARL 219
           P RTS+ +QKL L+P+E   R N    P+        + +   P R D  + G   +  L
Sbjct: 82  PQRTSRKAQKLKLLPDEAFERINEDDAPQDRDVYSQVNRITDKPARRDAEKLGKNQRHLL 141

Query: 220 PRLTAYHLSEGLNLKLMSKFL---KKYHEVSPRLYDECLYVAY 259
           PR+TAY  +    +K + ++L   K+++   P+L+DECLY  +
Sbjct: 142 PRVTAYCTASLYKMKELIRWLKDCKRFNHTHPKLFDECLYTPF 184

>YDR282C Chr4 complement(1023511..1024755) [1245 bp, 414 aa] {ON}
           Putative protein of unknown function
          Length = 414

 Score = 81.6 bits (200), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 63/250 (25%), Positives = 113/250 (45%), Gaps = 41/250 (16%)

Query: 404 GVIVFWNFTEAQEKNILGDIAFADYKDLVIRPLDEQDIETEEFHF---EYDADTERPRIF 460
           G IV W F+E+  +N +  I     K   + PL+ +D ETE+  +   E + D ++    
Sbjct: 161 GSIVSWGFSESSVRNCIVPIV----KAASLNPLNGEDFETEDMDYVEIEGEQDFDKLSSL 216

Query: 461 NDVITLR-------SGDHII------------KLTLSHSIAQSSKLSRFESRLEPLLNSV 501
           ++ +T R       SGD II            K   S  +++S+ L+  E  +E  ++  
Sbjct: 217 DNKVTPRIACESFLSGDLIIINSLDSDQGMLDKAAFSSGLSRSTNLAVLEEAMEKHISKT 276

Query: 502 TKLPKRLALYGTLGLTRQQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWTFEPSLHPLYVA 561
             + + ++    L L     LK  G+LF +R  +NL S +++TP+ +W+ EP L  ++  
Sbjct: 277 RTITENISKGTKLNLRSSDALKSIGRLFLIRGKLNLYSELIETPDLYWS-EPQLEEIFKN 335

Query: 562 MREYLEIDERVQVVN-------DRCMVLLEFFNICVDSVAERNIARVTWWFIIVLILGVL 614
           +  YL+I  R+ ++N       D C  L+   N       ERN   + W  I ++   + 
Sbjct: 336 VSRYLDIGPRINILNSKLDYSTDECRALISLLN-------ERNSTFLEWIIIYLIAFELC 388

Query: 615 FSLTEILIRY 624
           F +     +Y
Sbjct: 389 FEIYHFYQKY 398

>Skud_4.545 Chr4 complement(966078..967319) [1242 bp, 413 aa] {ON}
           YDR282C (REAL)
          Length = 413

 Score = 81.3 bits (199), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 67/250 (26%), Positives = 112/250 (44%), Gaps = 41/250 (16%)

Query: 404 GVIVFWNFTEAQEKNILGDIAFADYKDLVIRPLDEQDIETEEFHF---EYDADTERPRIF 460
           G IV W F E+  +N +  +     K   I PL E+D ETE+  +   E   D E+    
Sbjct: 161 GSIVGWGFGESTVRNKIVPLV----KAASINPLSEEDFETEDMDYVELEKKKDLEKLFSG 216

Query: 461 NDVITLR-------SGDHII------------KLTLSHSIAQSSKLSRFESRLEPLLNSV 501
           N  +TL+       SGD I+            K   S  +++S+ L+  E  +E  ++  
Sbjct: 217 NKNVTLKTVDQSFLSGDLILINSLDSDQGMLDKAAFSSGLSRSTNLAVLEEAMERHISKT 276

Query: 502 TKLPKRLALYGTLGLTRQQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWTFEPSLHPLYVA 561
             + + ++   TL L     LK  G+LF +R  +NL S +++TP+ +W+ EP L  ++  
Sbjct: 277 RTITENISKGTTLKLKSSDALKSIGRLFLIRGKLNLYSELIETPDLYWS-EPQLELIFKN 335

Query: 562 MREYLEIDERVQVVN-------DRCMVLLEFFNICVDSVAERNIARVTWWFIIVLILGVL 614
           +  YL+I  R+ ++N       D C  L+   N       ER    + W  I ++   + 
Sbjct: 336 VSRYLDIVPRINILNSKLDYSTDECRALISLLN-------ERKGTFLEWIIIYLIAFELC 388

Query: 615 FSLTEILIRY 624
           F L  +  RY
Sbjct: 389 FELFHLYQRY 398

>Ecym_4743 Chr4 complement(1450271..1451371) [1101 bp, 366 aa] {ON}
           similar to Ashbya gossypii AAL122C
          Length = 366

 Score = 79.0 bits (193), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 68/266 (25%), Positives = 122/266 (45%), Gaps = 31/266 (11%)

Query: 387 ELITGKSQH----AEIFIFRY-GVIVFWNFTEA-QEKNILGDIAFADYKDLVIRPLDEQD 440
           E++T K  H     ++ I R  G +V W   E+ Q +NIL  +  A      I PL E+ 
Sbjct: 96  EIVTFKYFHDGHQGDVMIIRQNGTVVAWGLDESSQMENILPLVDEAR-----INPLKEKQ 150

Query: 441 IETEEFHFEYDADTERPRIFNDVI-------TLRSGDHII------------KLTLSHSI 481
            E+E+  +     TE     +D+        +   GD I+            K  LS  +
Sbjct: 151 YESEDLDYVELDTTESWTQLHDITNRGEANESFVEGDLIVINSISANHGMLDKAALSGGL 210

Query: 482 AQSSKLSRFESRLEPLLNSVTKLPKRLALYGTLGLTRQQLLKKSGKLFKLRVDVNLSSSV 541
           ++S++LS  E+ LE  +    K  + L+    L  T   +L+ +G+LF +R ++NL S +
Sbjct: 211 SRSTRLSVLEAALESHIAKTKKFTELLSSGKKLNFTENHILESTGRLFLIRGNLNLYSEL 270

Query: 542 LDTPEFFWTFEPSLHPLYVAMREYLEIDERVQVVNDRCMVLLEFFNICVDSVAERNIARV 601
           ++TP+ +W+ EP L  LY  +   L+I  R+ ++N +     +     +  + E+   ++
Sbjct: 271 IETPDLYWS-EPDLEKLYEKISRNLDIQPRITILNKKLDYATDESRALLSVLNEKKSTKL 329

Query: 602 TWWFIIVLILGVLFSLTEILIRYLII 627
            W  I ++ + V F L     +Y  I
Sbjct: 330 EWIIIWLISVEVCFELFHFYEKYKTI 355

>Suva_2.448 Chr2 complement(788042..789295) [1254 bp, 417 aa] {ON}
           YDR282C (REAL)
          Length = 417

 Score = 79.0 bits (193), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 64/256 (25%), Positives = 113/256 (44%), Gaps = 45/256 (17%)

Query: 404 GVIVFWNFTEAQEKNILGDIAFADYKDLVIRPLDEQDIETEEFHFE-----------YDA 452
           G IV W F E+  ++ +  +     +   I PL ++D ETE+  +            +  
Sbjct: 161 GSIVSWGFGESTVRDKIVPLV----EGASINPLAKEDFETEDMDYVELAKKQDLEKFFSG 216

Query: 453 DTE-RPRIFNDVITLRSGDHII------------KLTLSHSIAQSSKLSRFESRLEPLLN 499
           + E +PR  N+  +  SGD I+            K   S  +++S+ L+  E  LE  ++
Sbjct: 217 NNEVKPRFVNE--SFLSGDLILINSLDADQGMLDKAAFSSGLSRSTNLAVLEEALEKHIS 274

Query: 500 SVTKLPKRLALYGTLGLTRQQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWTFEPSLHPLY 559
               + + ++    L L     LK  G+LF +R  +NL S + +TP+ +W+ EP L  ++
Sbjct: 275 KTRTITENISKGTKLNLKSSDALKSIGRLFLIRGKLNLYSELTETPDLYWS-EPQLEEIF 333

Query: 560 VAMREYLEIDERVQVVN-------DRCMVLLEFFNICVDSVAERNIARVTWWFIIVLILG 612
             +  YL+I  R+ ++N       D C  L+   N       ERN A + W  I ++   
Sbjct: 334 KKVSRYLDIGPRINILNSKLDYSTDECRALISLLN-------ERNGAFLEWIIIYLIAFE 386

Query: 613 VLFSLTEILIRYLIIQ 628
           + F +     RY + Q
Sbjct: 387 LCFEVYHFYQRYYLPQ 402

>KLTH0G06622g Chr7 (527870..529048) [1179 bp, 392 aa] {ON} similar
           to uniprot|Q05648 Saccharomyces cerevisiae YDR282C
           Hypothetical ORF
          Length = 392

 Score = 75.1 bits (183), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 73/268 (27%), Positives = 121/268 (45%), Gaps = 38/268 (14%)

Query: 387 ELITGK----SQHAEIFIF-RYGVIVFWNFTEA-QEKNILGDIAFADYKDLVIRPLDEQD 440
           E+IT K      H++I +    G +V W   E+   +NIL  I         + PL E+ 
Sbjct: 124 EIITFKYFYNGCHSDIMVLGNSGTVVAWGLEESFVFENILPLIEHGR-----VNPLTEEC 178

Query: 441 IETEEFHF---EYDADTERPRIFNDVITLRS-------GDHII------------KLTLS 478
           +E+E+  F   E   D E+ R     IT RS       GD II            K   S
Sbjct: 179 VESEDLDFLQVENAEDLEKVR----QITNRSAPESFVEGDLIIVNAIDSDLGLLDKAAFS 234

Query: 479 HSIAQSSKLSRFESRLEPLLNSVTKLPKRLALYGTLGLTRQQLLKKSGKLFKLRVDVNLS 538
             +++S++L+  E  LE  +    K  + L+    L LT  ++L+ +G LF +R  +NL 
Sbjct: 235 SGMSRSTRLAVLEHLLEAHIEKSRKFTELLSQGKKLSLTESEVLQSTGSLFLIRGKLNLY 294

Query: 539 SSVLDTPEFFWTFEPSLHPLYVAMREYLEIDERVQVVNDRCMVLLEFFNICVDSVAERNI 598
           S +++TP+ +W+ EP L  +Y  M   L+I  R+ ++N +     E     +  + E+  
Sbjct: 295 SELIETPDLYWS-EPQLERIYKQMSRSLDIQPRISILNTKLDYATEESRAFMAVLNEKKS 353

Query: 599 ARVTWWFIIVLILGVLFSLTEILIRYLI 626
             + W  I ++ + V F L     RY +
Sbjct: 354 THLEWIIIYLITVEVFFELHHYYERYWV 381

>Kwal_23.5643 s23 complement(1249364..1250488) [1125 bp, 374 aa]
           {ON} YDR282C - Hypothetical ORF [contig 11] FULL
          Length = 374

 Score = 73.9 bits (180), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 72/267 (26%), Positives = 121/267 (45%), Gaps = 30/267 (11%)

Query: 387 ELITGKSQH----AEIFIF-RYGVIVFWNFTEA-QEKNILGDIAFADYKDLVIRPLDEQD 440
           E++T K  H    ++I I    G +V W   E+   +NIL  I  A      I PL E  
Sbjct: 110 EIVTFKYFHNGYRSDIMILGNSGTVVSWGIDESFTLENILPLIQSAR-----INPLAENA 164

Query: 441 IETEEFHF---EYDADTERPR-----------IFNDVITLRSGD----HIIKLTLSHSIA 482
           +E+E+  +   E   D ER R           +  D+I + S D     + K   S  I+
Sbjct: 165 MESEDLDYLEIESIEDLERVRHTLSRSVDGSFVEGDLIVVNSIDPELGLLDKAAFSSGIS 224

Query: 483 QSSKLSRFESRLEPLLNSVTKLPKRLALYGTLGLTRQQLLKKSGKLFKLRVDVNLSSSVL 542
           +S++L+  E  LE  +    K  + L+    L LT   +L+ +G LF +R  +NL S + 
Sbjct: 225 RSTRLAILEELLEAHIEKTRKFTENLSDGKRLNLTESMVLRSTGSLFLIRGKLNLYSELT 284

Query: 543 DTPEFFWTFEPSLHPLYVAMREYLEIDERVQVVNDRCMVLLEFFNICVDSVAERNIARVT 602
           +TP+ +W+ EP L  +Y  M   L+I  R+ ++N +     E     +  + E+    + 
Sbjct: 285 ETPDLYWS-EPQLERIYKQMSRSLDIQPRIAILNTKLDYATEESRAFMAVLNEKKGTHLE 343

Query: 603 WWFIIVLILGVLFSLTEILIRYLIIQR 629
           W  I ++ + V F L     RY + ++
Sbjct: 344 WIIIYLITVEVCFELHHYYERYWLDEK 370

>SAKL0G10582g Chr7 (900403..901554) [1152 bp, 383 aa] {ON} similar
           to uniprot|Q05648 Saccharomyces cerevisiae YDR282C
           Hypothetical ORF
          Length = 383

 Score = 73.2 bits (178), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 59/235 (25%), Positives = 109/235 (46%), Gaps = 15/235 (6%)

Query: 404 GVIVFWNFTE-AQEKNILGDIAFADYKDLVIRPLDEQD---------IETEEFHFEYDAD 453
           G +V W F E    +NIL  I+ A    L  +  + +D         IE E+        
Sbjct: 146 GSVVSWGFDETCLTENILPLISPARVNPLAPKQFESEDMDYVELENSIELEQLKSVTHKI 205

Query: 454 TERPRIFNDVITLRSGDH----IIKLTLSHSIAQSSKLSRFESRLEPLLNSVTKLPKRLA 509
            +   I  D+I + S D     + K   S  +++S++L+  E  LE  +    +  + L+
Sbjct: 206 DDGSFIEGDLIVINSTDSEQGLLDKAAFSSGMSRSTRLAVLEGALETHIEKTREFTELLS 265

Query: 510 LYGTLGLTRQQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWTFEPSLHPLYVAMREYLEID 569
           +   L LT   +LK +G+LF +R  +NL S +++TP+ +W+ EP L  +Y  + + L+I 
Sbjct: 266 VGKKLNLTESDVLKYTGRLFLMRGKLNLYSELIETPDLYWS-EPRLEKIYKQISKNLDIH 324

Query: 570 ERVQVVNDRCMVLLEFFNICVDSVAERNIARVTWWFIIVLILGVLFSLTEILIRY 624
            R+ ++N +     +     +  + E+   R+ W  I ++ + V F L     +Y
Sbjct: 325 PRITILNTKLDYATDESRALMAVLNEKKSTRLEWIIIYLITIEVCFELYHFYEKY 379

>Smik_4.531 Chr4 complement(955033..956277) [1245 bp, 414 aa] {ON}
           YDR282C (REAL)
          Length = 414

 Score = 73.2 bits (178), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 63/256 (24%), Positives = 111/256 (43%), Gaps = 47/256 (18%)

Query: 404 GVIVFWNFTEAQEKNILGDIAFADYKDLVIRPLDEQDIETEEFHF-EYDADTERPRIFN- 461
           G IV W F E+  +N +  +  A      I PL  Q+ ETE+  + E + + +  + FN 
Sbjct: 161 GSIVSWGFDESSVRNKIVPLIEA----ASINPLSAQNFETEDMDYVELEKNQDLEKYFNR 216

Query: 462 ----------------DVITLRSGDH----IIKLTLSHSIAQSSKLSRFESRLEPLLNSV 501
                           D+I + S D     + K   S  +++S+ L+  E  +E  +   
Sbjct: 217 NSKLTPKNADQSFLCGDLILINSLDSDQGMLDKAAFSSGLSRSTNLAVLEEAMEKHILKT 276

Query: 502 TKLPKRLALYGTLGLTRQQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWTFEPSLHPLYVA 561
             + + ++    L L     LK  G+LF +R  +NL S +++TP+ +W+ EP L  ++  
Sbjct: 277 RTITENISRGTKLNLKSSDALKSIGRLFLIRGKLNLYSELIETPDLYWS-EPQLEEIFKN 335

Query: 562 MREYLEIDERVQVVN-------DRCMVLLEFFNICVDSVAERNIARVTWWFIIVLILGVL 614
           +  YL+I  R+ ++N       D C  L+   N       ERN   + W  I ++   + 
Sbjct: 336 VSRYLDIAPRINILNSKLDYSTDECRALISLLN-------ERNSTFLEWIIIYLIAFELC 388

Query: 615 FSLTEILIRYLIIQRH 630
           F +      Y   Q+H
Sbjct: 389 FEI------YHFYQKH 398

>Kpol_1033.6 s1033 complement(11719..12930) [1212 bp, 403 aa] {ON}
           complement(11719..12930) [1212 nt, 404 aa]
          Length = 403

 Score = 72.8 bits (177), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 67/240 (27%), Positives = 105/240 (43%), Gaps = 39/240 (16%)

Query: 404 GVIVFWNFTE-AQEKNILGDIAFADYKDLVIRPLDEQDIETEEFHF-EYDAD-------- 453
           G +V W F E     NIL  I  A     +I PL     E+E+  F E D +        
Sbjct: 154 GSVVSWGFDENTLTNNILPLIESA-----IINPLVPDKYESEDLDFIELDNEDETTLKLL 208

Query: 454 -----TERPRIFNDVITLRSGDH----IIKLTLSHSIAQSSKLSRFESRLEPLLNSVTKL 504
                 E   I  DVI + S D     + K   S  I++S+ L+  ES LE  +N    +
Sbjct: 209 PSGDANEASFIAEDVIVINSIDQTSGLLDKAAFSSGISRSTSLAVLESALEEHINRSRII 268

Query: 505 PKRLALYGTLGLTRQQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWTFEPSLHPLYVAMRE 564
            + ++    + L  +  LK  G+LF +R  +NL S +++TP+ +W+ EP L  +Y  + +
Sbjct: 269 TESVSNGKKMNLNERDFLKSIGRLFLIRGKLNLYSEIIETPDLYWS-EPQLEKIYKNVSK 327

Query: 565 YLEIDERVQVVN-------DRCMVLLEFFNICVDSVAERNIARVTWWFIIVLILGVLFSL 617
           YL++  R+ ++N       D    LL   N       ER    + W  I ++   V F L
Sbjct: 328 YLDVVPRINILNSKLDYSTDESRALLAVLN-------ERKSTFLEWIIIYLIAFEVCFEL 380

>KLLA0C11165g Chr3 complement(957421..958491) [1071 bp, 356 aa] {ON}
           similar to uniprot|Q05648 Saccharomyces cerevisiae
           YDR282C Hypothetical ORF
          Length = 356

 Score = 72.4 bits (176), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 53/227 (23%), Positives = 109/227 (48%), Gaps = 14/227 (6%)

Query: 404 GVIVFWNFTEAQEKN-ILGDIAFADYKDLVIRPLDEQDIETEEFHFEYDADT-------- 454
           G IV W F E   ++ IL  ++ A    L+    + +D++  E   E D +         
Sbjct: 107 GSIVSWGFNETVMRDEILPLVSTARVNSLLDSQYESEDLDYVELENEDDMNNLKRDYSIN 166

Query: 455 ERPRIFNDVITLRSGDH----IIKLTLSHSIAQSSKLSRFESRLEPLLNSVTKLPKRLAL 510
           +   + N++I +   +H    + K   S  I++S++L+  E  L+  +    +  + L+ 
Sbjct: 167 DESCVTNELIIINGVEHEKALLDKAAFSSGISRSTRLAVLEVALDAHIEKTREFTESLSR 226

Query: 511 YGTLGLTRQQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWTFEPSLHPLYVAMREYLEIDE 570
              L ++ + +L+ +G+LF +R  +NL S +++TP+ +W+ EP L  LY  +   L+I  
Sbjct: 227 GKKLNISEKAVLQSTGRLFLMRGKLNLYSELIETPDLYWS-EPQLEKLYRQISRNLDIQP 285

Query: 571 RVQVVNDRCMVLLEFFNICVDSVAERNIARVTWWFIIVLILGVLFSL 617
           R+ ++N +     +     +  + E+   R+ W  I ++ + V F L
Sbjct: 286 RISILNTKLDYATDEARALMAVLNEKKGTRLEWIIIYLITVEVCFEL 332

>AAL122C Chr1 complement(132431..133531) [1101 bp, 366 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR282C
          Length = 366

 Score = 72.0 bits (175), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 60/243 (24%), Positives = 114/243 (46%), Gaps = 16/243 (6%)

Query: 398 IFIFRYGVIVFWNFTEAQEK-NILGDIAFADYKDLVIRPLDEQDIETEEFHFEYD----- 451
           + I + G +V W F EA  K +IL  I  A    L     + +D++  E   + +     
Sbjct: 113 MVIGQNGSVVSWGFDEASHKQHILPLIDGARTNPLPQSLYESEDLDYVEIESKEEWSQIS 172

Query: 452 -----ADTERPRIFNDVITL--RSGDH--IIKLTLSHSIAQSSKLSRFESRLEPLLNSVT 502
                +  E+  I  D+I +   SGD   + K   S  I++S+ L+  E  +E  + S  
Sbjct: 173 SLVNVSGLEQSFIKEDLIVVDRTSGDKDMLDKAAFSSGISRSTMLAVLERNMEAHIESTR 232

Query: 503 KLPKRLALYGTLGLTRQQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWTFEPSLHPLYVAM 562
              + L+    L +T  ++LK +G+LF +R  +NL S +++TP+ +W+ EP+L  +Y  +
Sbjct: 233 SFTELLSKGNRLNITEAEILKSTGRLFLMRGKLNLYSELIETPDLYWS-EPTLETIYKQV 291

Query: 563 REYLEIDERVQVVNDRCMVLLEFFNICVDSVAERNIARVTWWFIIVLILGVLFSLTEILI 622
              L++  R+ ++N +     +     +  + E+   R+ W  I ++ + V F L     
Sbjct: 292 SRNLDVPARISILNKKLDYATDESRALMSVLNEKKSTRLEWIIIYLITVEVCFELHHFYE 351

Query: 623 RYL 625
           R+ 
Sbjct: 352 RFF 354

>TPHA0D01710 Chr4 complement(356399..357559) [1161 bp, 386 aa] {ON}
           Anc_5.291 YDR282C
          Length = 386

 Score = 66.6 bits (161), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 61/252 (24%), Positives = 112/252 (44%), Gaps = 26/252 (10%)

Query: 387 ELITGKSQH----AEIFIFR-YGVIVFWNFTEAQEKNILGDIAFADYKDLVIRPLDEQDI 441
           E+IT K  H     +I +    G ++ W   E +    L D       +  I PLDE   
Sbjct: 124 EIITFKYIHEGEKTDIMVLADNGSVISWGLNEKE----LLDNFIPILSEARINPLDESKY 179

Query: 442 ETEEFHF-EYDADTERPR-----------IFNDVITLRSGD----HIIKLTLSHSIAQSS 485
           ETE+  F E +      +           I +D++ + S D     + K   S  IA+S+
Sbjct: 180 ETEDIDFIEIENSKALSKNMESHLHNGSYIMDDLLIVNSIDPELGLLDKAAFSSGIARST 239

Query: 486 KLSRFESRLEPLLNSVTKLPKRLALYGTLGLTRQQLLKKSGKLFKLRVDVNLSSSVLDTP 545
            L+  E+ LE        + ++ +    + L  +  L   GKLF +R  +NL S++++TP
Sbjct: 240 SLAVLEAALEEHTQKSRIITEKFSRGIQINLKEKHFLTSIGKLFLIRGRLNLYSNIIETP 299

Query: 546 EFFWTFEPSLHPLYVAMREYLEIDERVQVVNDRCMVLLEFFNICVDSVAERNIARVTWWF 605
           + +W+ EP L  +Y  +  +L+I  R+ ++N +     +   + +  + E+    + W  
Sbjct: 300 DLYWS-EPRLEKIYKNVSHFLDIAPRINILNSKLDYCTDHSRMLLSVLNEKKGTFLEWII 358

Query: 606 IIVLILGVLFSL 617
           I ++ + V F L
Sbjct: 359 IYLITVEVCFEL 370

>CAGL0H01045g Chr8 complement(98818..99903) [1086 bp, 361 aa] {ON}
           similar to uniprot|Q05648 Saccharomyces cerevisiae
           YDR282c
          Length = 361

 Score = 65.9 bits (159), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 44/171 (25%), Positives = 86/171 (50%), Gaps = 19/171 (11%)

Query: 458 RIFNDVITLRSGDH----IIKLTLSHSIAQSSKLSRFESRLEPLLNSVTKLPKRLALYGT 513
           R+  DVI + S +     + K   S  +++S+ L+  E+ +E  +++   + ++++    
Sbjct: 182 RLIGDVILINSIEKSEGILDKAAFSSGLSRSTALAVLENAMERHISNTRIITEKISTGIK 241

Query: 514 LGLTRQQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWTFEPSLHPLYVAMREYLEIDERVQ 573
           L +     LK  G+LF +R  +NL S +++TP+ +W+ EP L  ++  +  YL+I  R+ 
Sbjct: 242 LKVKESDALKSIGRLFLIRGRLNLYSELIETPDLYWS-EPELEIIFKDVSRYLDISPRIN 300

Query: 574 VVN-------DRCMVLLEFFNICVDSVAERNIARVTWWFIIVLILGVLFSL 617
           ++N       D C  +L   N       ERN + + W  I ++   V+F L
Sbjct: 301 ILNSKLDYSTDECRAILSLLN-------ERNSSFLEWIIIYLITFEVIFEL 344

>ZYRO0G16478g Chr7 complement(1349497..1350702) [1206 bp, 401 aa]
           {ON} similar to uniprot|Q05648 Saccharomyces cerevisiae
           YDR282C Hypothetical ORF
          Length = 401

 Score = 63.5 bits (153), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 57/247 (23%), Positives = 110/247 (44%), Gaps = 20/247 (8%)

Query: 404 GVIVFWNFTEAQ-EKNILGDIAFADYKDLVIRPLDEQDIETEEFHFEYDADT-------- 454
           G I+ W F EA   +NIL  +  A    L     + +D++  E   +   ++        
Sbjct: 147 GSIICWGFDEATVNQNILKLVEDARTNPLNPDEFESEDMDYVELENKLQLESVQLESANH 206

Query: 455 ------ERPRIFNDVITLRSGD----HIIKLTLSHSIAQSSKLSRFESRLEPLLNSVTKL 504
                 E   +  D+I + S D     + K   S   ++S+KL+  E+ +E  +     +
Sbjct: 207 AAVKYLETSLLVGDLILINSTDPGAGLLHKAAFSSGFSRSTKLAVLENAMERHIVETRII 266

Query: 505 PKRLALYGTLGLTRQQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWTFEPSLHPLYVAMRE 564
            ++++    L L R   LK  G+LF +R  +NL S +++TP+ +W+ EP L  ++    +
Sbjct: 267 TEKVSKGVRLNLKRGDALKSIGRLFLIRGKLNLYSELIETPDLYWS-EPQLEKIFKETSK 325

Query: 565 YLEIDERVQVVNDRCMVLLEFFNICVDSVAERNIARVTWWFIIVLILGVLFSLTEILIRY 624
           YL+I  R+ ++N +     E     +  ++E+N   +    I ++   + F L     RY
Sbjct: 326 YLDIGPRINILNSKLDYSTEETRALMGVLSEKNSTVLELIIIYLIAFELCFELYHFYERY 385

Query: 625 LIIQRHQ 631
            +  + Q
Sbjct: 386 WLDSKSQ 392

>TDEL0E03360 Chr5 (635665..636882) [1218 bp, 405 aa] {ON} Anc_5.291
           YDR282C
          Length = 405

 Score = 62.0 bits (149), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 43/180 (23%), Positives = 87/180 (48%), Gaps = 19/180 (10%)

Query: 461 NDVITLRSGD----HIIKLTLSHSIAQSSKLSRFESRLEPLLNSVTKLPKRLALYGTLGL 516
            D+I + S D     + K   S  +A+S+ L+  E+ +E  ++    + ++++    L L
Sbjct: 227 GDLIVINSTDPDSGMLYKAAYSSGLARSTSLAVLENSMEAHISRTRIITEKISRGVKLNL 286

Query: 517 TRQQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWTFEPSLHPLYVAMREYLEIDERVQVVN 576
              + L+  G+LF +R  +NL S +++TP+ +W+ EP L  ++     YL+I  R+ ++N
Sbjct: 287 NEGEALRSIGRLFLIRGRLNLYSELIETPDLYWS-EPLLERIFKQTSRYLDIGPRINILN 345

Query: 577 -------DRCMVLLEFFNICVDSVAERNIARVTWWFIIVLILGVLFSLTEILIRYLIIQR 629
                  D C  L+         ++E+    + W  I ++ L ++F +     RY +  R
Sbjct: 346 TKLDYSTDECRALMGV-------LSEKKGTFLEWIIIYLISLEIIFEIYHFYERYYLDTR 398

>KAFR0E01530 Chr5 complement(309332..310423) [1092 bp, 363 aa] {ON}
           Anc_5.291 YDR282C
          Length = 363

 Score = 58.2 bits (139), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 49/233 (21%), Positives = 105/233 (45%), Gaps = 24/233 (10%)

Query: 404 GVIVFWNFTEAQEKNILGDIAFADYKDLVIRPLDEQDIETEEFHFEYDADTERPRIFNDV 463
           G  V W      E+N+L        ++  I PL E + E E+  +     +E      D+
Sbjct: 119 GATVSWGI----EENVLRSEIIPLIENACINPLSENEFEIEDMDYIELRKSEDLSFVQDI 174

Query: 464 I------TLRSGDHII------------KLTLSHSIAQSSKLSRFESRLEPLLNSVTKLP 505
                  +   GD I+            K+  S  +++S+ L+  E+++E  +    K+ 
Sbjct: 175 CDREDDNSFLLGDLIMINSVGPLYGVMDKVAFSSGLSRSTMLAVLENKMETHIKETRKVT 234

Query: 506 KRLALYGT-LGLTRQQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWTFEPSLHPLYVAMRE 564
           ++++   T   +  + +L+  G+LF +R  +NL S +++TP+ +W+ E  L  ++  +  
Sbjct: 235 EKISKGVTNTKMKEKDVLRFIGRLFMIRGQLNLYSELIETPDLYWS-ETQLEEIFKKISN 293

Query: 565 YLEIDERVQVVNDRCMVLLEFFNICVDSVAERNIARVTWWFIIVLILGVLFSL 617
           YL++  R+ ++N +     E   + +  + ER  + + W  I ++   + F L
Sbjct: 294 YLDMKPRISILNSKLDYSTEECRLLISLLNERKSSFLEWIIIYLIAFELFFEL 346

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.134    0.386 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 63,582,281
Number of extensions: 2769155
Number of successful extensions: 10829
Number of sequences better than 10.0: 80
Number of HSP's gapped: 11002
Number of HSP's successfully gapped: 116
Length of query: 631
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 515
Effective length of database: 40,180,143
Effective search space: 20692773645
Effective search space used: 20692773645
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 69 (31.2 bits)