Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0D040408.286ON32932915220.0
Skud_4.3878.286ON3363207691e-100
NDAI0J010008.286ON3393217266e-94
KAFR0B053708.286ON3293126952e-89
Suva_2.2898.286ON3353186953e-89
Kpol_1033.168.286ON3213086924e-89
Smik_4.3728.286ON3353196858e-88
TDEL0F041308.286ON3283106831e-87
YDR126W (SWF1)8.286ON3363216823e-87
NCAS0B035908.286ON3293156734e-86
ZYRO0D06600g8.286ON3303146658e-85
TPHA0C010708.286ON3333176659e-85
CAGL0B01991g8.286ON3303096022e-75
Ecym_42828.286ON3403275302e-64
KLTH0G13112g8.286ON3493525302e-64
KNAG0H031108.286ON3313105282e-64
KLLA0F19690g8.286ON3243094952e-59
Kwal_56.236978.286ON3383224859e-58
AGR065W8.286ON3263104787e-57
SAKL0H16434g8.286ON5552864921e-56
NCAS0C029208.389ON374401788e-14
KLLA0D18370g8.389ON355941743e-13
NDAI0G022508.389ON389401726e-13
AGL125C8.389ON367941717e-13
Smik_12.3068.389ON359401691e-12
TPHA0C023608.389ON404501692e-12
TBLA0H009208.389ON3601211672e-12
CAGL0G08217g8.389ON326531672e-12
Skud_12.3218.389ON356401672e-12
KAFR0H019808.389ON361401672e-12
YLR246W (ERF2)8.389ON359401663e-12
Suva_10.3428.389ON356401663e-12
ZYRO0C04092g8.389ON366401663e-12
TDEL0F051308.389ON3591141638e-12
KLTH0F08668g8.389ON358401629e-12
Kwal_23.33028.389ON353401611e-11
SAKL0H13860g8.389ON352401602e-11
Ecym_41788.389ON368931602e-11
KLTH0C10978g6.28ON3771481557e-11
Kwal_56.224596.28ON383401531e-10
Smik_15.1676.28ON378401513e-10
KLLA0C06204g6.28ON377401513e-10
CAGL0E02497g6.28ON376401494e-10
KNAG0A027108.389ON354401486e-10
NDAI0C026506.28ON389431487e-10
YOL003C (PFA4)6.28ON378401479e-10
TDEL0G044106.28ON381621452e-09
NCAS0D021406.28ON376401452e-09
Skud_15.1596.28ON379401442e-09
TPHA0P015603.12ON331401432e-09
Kpol_1037.236.28ON378401433e-09
ZYRO0C07546g6.28ON377371433e-09
Suva_15.1726.28ON398401433e-09
NCAS0E013003.12ON327401423e-09
TBLA0H001503.12ON345601423e-09
TPHA0J003906.28ON380401423e-09
KNAG0F029306.28ON386401423e-09
KAFR0A051306.28ON396421415e-09
Kpol_1014.293.12ON326401397e-09
Ecym_30326.28ON3771451397e-09
ZYRO0C03410g3.12ON327401398e-09
ACL003C6.28ON375591398e-09
TDEL0A003103.12ON329401371e-08
Ecym_20143.12ON339401371e-08
ADL197C3.12ON390401371e-08
NDAI0G013403.12ON335401371e-08
SAKL0C13596g3.12ON333401371e-08
KNAG0K025703.12ON328401352e-08
SAKL0E01518g6.28ON379401344e-08
KLTH0F19580g3.12ON342401301e-07
KAFR0A085903.12ON331401291e-07
Kwal_55.221263.12ON3601951282e-07
KLLA0E02069g3.12ON3251251272e-07
Suva_14.153.12ON330401272e-07
Skud_14.153.12ON336401245e-07
CAGL0D02508g3.12ON332401246e-07
YNL326C (PFA3)3.12ON336401237e-07
Smik_14.63.12ON334401221e-06
TBLA0B004806.28ON377451079e-05
Kpol_1004.575.579ON3621951032e-04
KNAG0C028305.579ON3541021032e-04
KLTH0G04972g5.579ON3671941023e-04
Ecym_41145.579ON372194998e-04
Kwal_47.183665.579ON356100950.002
KAFR0I011105.579ON37040940.003
Smik_4.7375.579ON37840930.004
TBLA0E028305.579ON38642930.004
NCAS0F013905.579ON37460910.007
SAKL0G06160g5.579ON36440910.008
YDR459C (PFA5)5.579ON37440880.019
Skud_4.7345.579ON38092870.024
Suva_2.6345.579ON38840860.029
KLLA0D06149g5.579ON34998850.045
CAGL0K06347g5.579ON35240820.084
NDAI0H018905.579ON40640820.11
ABR203W5.579ON35940810.12
TDEL0A044405.579ON36540800.16
CAGL0M08712g5.626ON76340790.30
ZYRO0D13860g5.579ON365112760.52
ZYRO0C11132g5.626ON75940740.96
KAFR0H005705.626ON75776712.6
Kpol_526.325.626ON77764712.8
Smik_4.5155.626ON76440703.7
YDR264C (AKR1)5.626ON76440686.1
TDEL0A049205.626ON75040686.4
Skud_4.5275.626ON76440676.6
SAKL0C05918g1.199ON87544677.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0D04040
         (329 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0D04040 Chr4 complement(1006179..1007168) [990 bp, 329 aa] {...   590   0.0  
Skud_4.387 Chr4 (675002..676012) [1011 bp, 336 aa] {ON} YDR126W ...   300   e-100
NDAI0J01000 Chr10 (229188..230207) [1020 bp, 339 aa] {ON} Anc_8....   284   6e-94
KAFR0B05370 Chr2 complement(1105534..1106523) [990 bp, 329 aa] {...   272   2e-89
Suva_2.289 Chr2 (498420..499427) [1008 bp, 335 aa] {ON} YDR126W ...   272   3e-89
Kpol_1033.16 s1033 (35544..36509) [966 bp, 321 aa] {ON} (35544.....   271   4e-89
Smik_4.372 Chr4 (664437..665444) [1008 bp, 335 aa] {ON} YDR126W ...   268   8e-88
TDEL0F04130 Chr6 (759451..760437) [987 bp, 328 aa] {ON} Anc_8.28...   267   1e-87
YDR126W Chr4 (703234..704244) [1011 bp, 336 aa] {ON}  SWF1Palmit...   267   3e-87
NCAS0B03590 Chr2 complement(636400..637389) [990 bp, 329 aa] {ON}     263   4e-86
ZYRO0D06600g Chr4 complement(573724..574716) [993 bp, 330 aa] {O...   260   8e-85
TPHA0C01070 Chr3 complement(244556..245557) [1002 bp, 333 aa] {O...   260   9e-85
CAGL0B01991g Chr2 (182894..183886) [993 bp, 330 aa] {ON} similar...   236   2e-75
Ecym_4282 Chr4 complement(608898..609920) [1023 bp, 340 aa] {ON}...   208   2e-64
KLTH0G13112g Chr7 complement(1129318..1130367) [1050 bp, 349 aa]...   208   2e-64
KNAG0H03110 Chr8 complement(584877..585872) [996 bp, 331 aa] {ON...   207   2e-64
KLLA0F19690g Chr6 (1820355..1821329) [975 bp, 324 aa] {ON} simil...   195   2e-59
Kwal_56.23697 s56 complement(665965..666981) [1017 bp, 338 aa] {...   191   9e-58
AGR065W Chr7 (835871..836851) [981 bp, 326 aa] {ON} Syntenic hom...   188   7e-57
SAKL0H16434g Chr8 complement(1447419..1449086) [1668 bp, 555 aa]...   194   1e-56
NCAS0C02920 Chr3 (549815..550939) [1125 bp, 374 aa] {ON} Anc_8.389     73   8e-14
KLLA0D18370g Chr4 complement(1549382..1550449) [1068 bp, 355 aa]...    72   3e-13
NDAI0G02250 Chr7 (503564..504733) [1170 bp, 389 aa] {ON} Anc_8.389     71   6e-13
AGL125C Chr7 complement(473496..474599) [1104 bp, 367 aa] {ON} S...    70   7e-13
Smik_12.306 Chr12 (568353..569432) [1080 bp, 359 aa] {ON} YLR246...    70   1e-12
TPHA0C02360 Chr3 (531446..532660) [1215 bp, 404 aa] {ON} Anc_8.3...    70   2e-12
TBLA0H00920 Chr8 (203681..204763) [1083 bp, 360 aa] {ON} Anc_8.3...    69   2e-12
CAGL0G08217g Chr7 complement(778823..779803) [981 bp, 326 aa] {O...    69   2e-12
Skud_12.321 Chr12 (571368..572438) [1071 bp, 356 aa] {ON} YLR246...    69   2e-12
KAFR0H01980 Chr8 (367846..368931) [1086 bp, 361 aa] {ON} Anc_8.3...    69   2e-12
YLR246W Chr12 (627118..628197) [1080 bp, 359 aa] {ON}  ERF2Subun...    69   3e-12
Suva_10.342 Chr10 (593959..595029) [1071 bp, 356 aa] {ON} YLR246...    69   3e-12
ZYRO0C04092g Chr3 complement(320634..321734) [1101 bp, 366 aa] {...    69   3e-12
TDEL0F05130 Chr6 complement(961887..962966) [1080 bp, 359 aa] {O...    67   8e-12
KLTH0F08668g Chr6 (750644..751720) [1077 bp, 358 aa] {ON} simila...    67   9e-12
Kwal_23.3302 s23 (234749..235810) [1062 bp, 353 aa] {ON} YLR246W...    67   1e-11
SAKL0H13860g Chr8 (1185970..1187028) [1059 bp, 352 aa] {ON} simi...    66   2e-11
Ecym_4178 Chr4 (375346..376452) [1107 bp, 368 aa] {ON} similar t...    66   2e-11
KLTH0C10978g Chr3 complement(905760..906893) [1134 bp, 377 aa] {...    64   7e-11
Kwal_56.22459 s56 (138563..139714) [1152 bp, 383 aa] {ON} YOL003...    64   1e-10
Smik_15.167 Chr15 complement(289180..290316) [1137 bp, 378 aa] {...    63   3e-10
KLLA0C06204g Chr3 complement(548912..550045) [1134 bp, 377 aa] {...    63   3e-10
CAGL0E02497g Chr5 complement(241355..242485) [1131 bp, 376 aa] {...    62   4e-10
KNAG0A02710 Chr1 (294783..295847) [1065 bp, 354 aa] {ON} Anc_8.3...    62   6e-10
NDAI0C02650 Chr3 (614101..615270) [1170 bp, 389 aa] {ON} Anc_6.28      62   7e-10
YOL003C Chr15 complement(321858..322994) [1137 bp, 378 aa] {ON} ...    61   9e-10
TDEL0G04410 Chr7 complement(800085..801230) [1146 bp, 381 aa] {O...    60   2e-09
NCAS0D02140 Chr4 complement(398924..400054) [1131 bp, 376 aa] {O...    60   2e-09
Skud_15.159 Chr15 complement(281485..282624) [1140 bp, 379 aa] {...    60   2e-09
TPHA0P01560 Chr16 (318550..319545) [996 bp, 331 aa] {ON} Anc_3.1...    60   2e-09
Kpol_1037.23 s1037 complement(51397..52533) [1137 bp, 378 aa] {O...    60   3e-09
ZYRO0C07546g Chr3 complement(574411..575544) [1134 bp, 377 aa] {...    60   3e-09
Suva_15.172 Chr15 complement(296325..297521) [1197 bp, 398 aa] {...    60   3e-09
NCAS0E01300 Chr5 complement(250120..251103) [984 bp, 327 aa] {ON...    59   3e-09
TBLA0H00150 Chr8 complement(13169..14206) [1038 bp, 345 aa] {ON}...    59   3e-09
TPHA0J00390 Chr10 (88587..89729) [1143 bp, 380 aa] {ON} Anc_6.28...    59   3e-09
KNAG0F02930 Chr6 complement(557052..558212) [1161 bp, 386 aa] {O...    59   3e-09
KAFR0A05130 Chr1 complement(1019919..1021109) [1191 bp, 396 aa] ...    59   5e-09
Kpol_1014.29 s1014 (48992..49972) [981 bp, 326 aa] {ON} (48992.....    58   7e-09
Ecym_3032 Chr3 (63354..64487) [1134 bp, 377 aa] {ON} similar to ...    58   7e-09
ZYRO0C03410g Chr3 (265684..266667) [984 bp, 327 aa] {ON} similar...    58   8e-09
ACL003C Chr3 complement(352024..353151) [1128 bp, 375 aa] {ON} S...    58   8e-09
TDEL0A00310 Chr1 complement(54006..54995) [990 bp, 329 aa] {ON} ...    57   1e-08
Ecym_2014 Chr2 complement(19723..20742) [1020 bp, 339 aa] {ON} s...    57   1e-08
ADL197C Chr4 complement(350991..352163) [1173 bp, 390 aa] {ON} S...    57   1e-08
NDAI0G01340 Chr7 (301254..302261) [1008 bp, 335 aa] {ON} Anc_3.12      57   1e-08
SAKL0C13596g Chr3 (1198957..1199958) [1002 bp, 333 aa] {ON} simi...    57   1e-08
KNAG0K02570 Chr11 (511867..512853) [987 bp, 328 aa] {ON} Anc_3.1...    57   2e-08
SAKL0E01518g Chr5 (113669..114808) [1140 bp, 379 aa] {ON} simila...    56   4e-08
KLTH0F19580g Chr6 (1586776..1587804) [1029 bp, 342 aa] {ON} simi...    55   1e-07
KAFR0A08590 Chr1 (1722408..1723403) [996 bp, 331 aa] {ON} Anc_3....    54   1e-07
Kwal_55.22126 s55 (1121936..1123018) [1083 bp, 360 aa] {ON} YNL3...    54   2e-07
KLLA0E02069g Chr5 complement(195185..196162) [978 bp, 325 aa] {O...    54   2e-07
Suva_14.15 Chr14 complement(23560..24552) [993 bp, 330 aa] {ON} ...    54   2e-07
Skud_14.15 Chr14 complement(20841..21851) [1011 bp, 336 aa] {ON}...    52   5e-07
CAGL0D02508g Chr4 (256760..257758) [999 bp, 332 aa] {ON} similar...    52   6e-07
YNL326C Chr14 complement(27337..28347) [1011 bp, 336 aa] {ON}  P...    52   7e-07
Smik_14.6 Chr14 complement(11864..12868) [1005 bp, 334 aa] {ON} ...    52   1e-06
TBLA0B00480 Chr2 (93291..94424) [1134 bp, 377 aa] {ON} Anc_6.28 ...    46   9e-05
Kpol_1004.57 s1004 complement(123368..124456) [1089 bp, 362 aa] ...    44   2e-04
KNAG0C02830 Chr3 complement(563740..564804) [1065 bp, 354 aa] {O...    44   2e-04
KLTH0G04972g Chr7 complement(404787..405890) [1104 bp, 367 aa] {...    44   3e-04
Ecym_4114 Chr4 complement(238112..239230) [1119 bp, 372 aa] {ON}...    43   8e-04
Kwal_47.18366 s47 (796220..797290) [1071 bp, 356 aa] {ON} YDR459...    41   0.002
KAFR0I01110 Chr9 (214426..215538) [1113 bp, 370 aa] {ON} Anc_5.5...    41   0.003
Smik_4.737 Chr4 complement(1303557..1304693) [1137 bp, 378 aa] {...    40   0.004
TBLA0E02830 Chr5 (700364..701524) [1161 bp, 386 aa] {ON} Anc_5.5...    40   0.004
NCAS0F01390 Chr6 complement(275879..277003) [1125 bp, 374 aa] {O...    40   0.007
SAKL0G06160g Chr7 complement(514850..515944) [1095 bp, 364 aa] {...    40   0.008
YDR459C Chr4 complement(1382319..1383443) [1125 bp, 374 aa] {ON}...    39   0.019
Skud_4.734 Chr4 complement(1302386..1303528) [1143 bp, 380 aa] {...    38   0.024
Suva_2.634 Chr2 complement(1134492..1135658) [1167 bp, 388 aa] {...    38   0.029
KLLA0D06149g Chr4 (527705..528754) [1050 bp, 349 aa] {ON} simila...    37   0.045
CAGL0K06347g Chr11 complement(624046..625104) [1059 bp, 352 aa] ...    36   0.084
NDAI0H01890 Chr8 complement(458111..459331) [1221 bp, 406 aa] {O...    36   0.11 
ABR203W Chr2 (782704..783783) [1080 bp, 359 aa] {ON} Syntenic ho...    36   0.12 
TDEL0A04440 Chr1 complement(795121..796218) [1098 bp, 365 aa] {O...    35   0.16 
CAGL0M08712g Chr13 (866454..868745) [2292 bp, 763 aa] {ON} simil...    35   0.30 
ZYRO0D13860g Chr4 complement(1171732..1172829) [1098 bp, 365 aa]...    34   0.52 
ZYRO0C11132g Chr3 complement(861388..863667) [2280 bp, 759 aa] {...    33   0.96 
KAFR0H00570 Chr8 (100639..102912) [2274 bp, 757 aa] {ON} Anc_5.6...    32   2.6  
Kpol_526.32 s526 complement(77926..80259) [2334 bp, 777 aa] {ON}...    32   2.8  
Smik_4.515 Chr4 complement(928882..931176) [2295 bp, 764 aa] {ON...    32   3.7  
YDR264C Chr4 complement(996029..998323) [2295 bp, 764 aa] {ON}  ...    31   6.1  
TDEL0A04920 Chr1 complement(867970..870222) [2253 bp, 750 aa] {O...    31   6.4  
Skud_4.527 Chr4 complement(938779..941073) [2295 bp, 764 aa] {ON...    30   6.6  
SAKL0C05918g Chr3 complement(558911..561538) [2628 bp, 875 aa] {...    30   7.4  

>TBLA0D04040 Chr4 complement(1006179..1007168) [990 bp, 329 aa] {ON}
           Anc_8.286 YDR126W
          Length = 329

 Score =  590 bits (1522), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/329 (88%), Positives = 290/329 (88%)

Query: 1   MGFGTFXXXXXXXXXXXXFISPFFKNTPFISIYYKYAYEPVVQDNKKYRWKFHIVPIFYI 60
           MGFGTF            FISPFFKNTPFISIYYKYAYEPVVQDNKKYRWKFHIVPIFYI
Sbjct: 1   MGFGTFLVVLVILQILILFISPFFKNTPFISIYYKYAYEPVVQDNKKYRWKFHIVPIFYI 60

Query: 61  TLFIYLVINFYAKVEPLIHDKLTYFERXXXXXXXXXXXXXXXXXXMLINPDTALMYSNDS 120
           TLFIYLVINFYAKVEPLIHDKLTYFER                  MLINPDTALMYSNDS
Sbjct: 61  TLFIYLVINFYAKVEPLIHDKLTYFERFFFIPISIISTPFFGIITMLINPDTALMYSNDS 120

Query: 121 IKKYAYDRILYFPDTECKTCKVEKPARSKHCAVCDQCILVNDHHCVWVNNCIGRGNXXXX 180
           IKKYAYDRILYFPDTECKTCKVEKPARSKHCAVCDQCILVNDHHCVWVNNCIGRGN    
Sbjct: 121 IKKYAYDRILYFPDTECKTCKVEKPARSKHCAVCDQCILVNDHHCVWVNNCIGRGNFLYF 180

Query: 181 XXXXXDNTLFMSYASMRLLEITLNFRRAGENVPRDVMTLDILCGCFLFICGTFSYMQLLI 240
                DNTLFMSYASMRLLEITLNFRRAGENVPRDVMTLDILCGCFLFICGTFSYMQLLI
Sbjct: 181 YLFLFDNTLFMSYASMRLLEITLNFRRAGENVPRDVMTLDILCGCFLFICGTFSYMQLLI 240

Query: 241 VKDGMTTNEKDKWYTIQCLMEDKKLVKSSDNNWYISFVNDQGETEFYSTNAYDHKKYQLT 300
           VKDGMTTNEKDKWYTIQCLMEDKKLVKSSDNNWYISFVNDQGETEFYSTNAYDHKKYQLT
Sbjct: 241 VKDGMTTNEKDKWYTIQCLMEDKKLVKSSDNNWYISFVNDQGETEFYSTNAYDHKKYQLT 300

Query: 301 EYKVIDNVEDIPNIYDKGSLWKNFKDFCE 329
           EYKVIDNVEDIPNIYDKGSLWKNFKDFCE
Sbjct: 301 EYKVIDNVEDIPNIYDKGSLWKNFKDFCE 329

>Skud_4.387 Chr4 (675002..676012) [1011 bp, 336 aa] {ON} YDR126W
           (REAL)
          Length = 336

 Score =  300 bits (769), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 142/320 (44%), Positives = 201/320 (62%), Gaps = 14/320 (4%)

Query: 21  SPFFKNTPFISIYYKYAYEPVVQDNKKYRWKFHIVPIFYITLFIYLVINFYAKVEPLIHD 80
           SP FK+T   S  Y+  ++P V D++KYRWKFH+VP+FY ++++YLV  ++AKVEPLI +
Sbjct: 20  SPVFKSTWPFSTLYRRVFQPFVSDDQKYRWKFHLVPLFYTSIYLYLVYTYHAKVEPLIKN 79

Query: 81  KLTYFERXXXXXXXXXXXXXXXXXXMLINPDTALMYSNDSIKKYAYDRILYFPDTECKTC 140
            L   ER                  M+   + + ++   S +KY YD ++Y+PD +C TC
Sbjct: 80  DLFLLERILIGPIIILPPVALGILAMVTKAEDSNVHRPGSTEKYPYDYLIYYPDVQCSTC 139

Query: 141 KVEKPARSKHCAVCDQCILVNDHHCVWVNNCIGRGNXXXXXXXXXDNTLFMSYASMRLLE 200
           ++ KPARS+HC++C++CILV DHHC+WVNNCIG+GN          N + MSYA +RL  
Sbjct: 140 RITKPARSRHCSICNRCILVADHHCIWVNNCIGKGNYIQFYLFLISNIVSMSYAFLRLCS 199

Query: 201 ITLNFRRAGENVPRDVMTLDILCGCFLFICGTFSYMQLLIVKDGMTTNEKDKWYTIQCLM 260
           I+L   ++   +PR V+TL ILCGCF  IC  F+Y+QL IV++GMTTNE+DKWYTIQ  M
Sbjct: 200 ISL---KSSTALPRAVLTLSILCGCFTIICAIFTYLQLAIVREGMTTNEQDKWYTIQEYM 256

Query: 261 EDKKLVKSSDNN---WYISFVNDQGETE--------FYSTNAYDHKKYQLTEYKVIDNVE 309
            + KLV+S +++   W++         E        FYSTNAYDHK+Y L  Y  I +  
Sbjct: 257 REGKLVRSLNDDPQSWFLKLTEKGDAAEPLQDQQGTFYSTNAYDHKRYILMHYITIKDAS 316

Query: 310 DIPNIYDKGSLWKNFKDFCE 329
           +I N+YDKG+   NF D  +
Sbjct: 317 EITNVYDKGTFLANFTDLIQ 336

>NDAI0J01000 Chr10 (229188..230207) [1020 bp, 339 aa] {ON} Anc_8.286
           YDR126W
          Length = 339

 Score =  284 bits (726), Expect = 6e-94,   Method: Compositional matrix adjust.
 Identities = 142/321 (44%), Positives = 200/321 (62%), Gaps = 14/321 (4%)

Query: 19  FISPFFKNTPFISIYYKYAYEPVVQDNKKYRWKFHIVPIFYITLFIYLVINFYAKVEPLI 78
            +SP +KN    SIYY++ ++P+VQD+ +YRWK+H+VP FY+TLFIYL   +Y KVEPLI
Sbjct: 19  LLSPRYKNRSPFSIYYRHVFQPIVQDSHRYRWKYHLVPFFYLTLFIYLTYCYYTKVEPLI 78

Query: 79  HDKLTYFERXXXXXXXXXXXXXXXXXXMLINPDTALMYSNDS--IKKYAYDRILYFPDTE 136
             +L + E                   M+  P+T     N    + +Y YD I+Y+P+ E
Sbjct: 79  ASQLYFIEVWIWIPFMIFSPVIFGILTMVTIPNTVNNRRNQEKVLYRYPYDEIMYYPNIE 138

Query: 137 CKTCKVEKPARSKHCAVCDQCILVNDHHCVWVNNCIGRGNXXXXXXXXXDNTLFMSYASM 196
           C+TC + KPARSKHC +C+ CIL+ DHHC+WVNNCIG GN          N + M+Y+ +
Sbjct: 139 CRTCGIVKPARSKHCEICNSCILLCDHHCLWVNNCIGEGNYLYFYSFLLCNCITMTYSFI 198

Query: 197 RLLEITLNFRRAGENVPRDVMTLDILCGCFLFICGTFSYMQLLIVKDGMTTNEKDKWYTI 256
           RL    L + +      R+++TL ILCG F  IC  F+++QL +VKDGMTTNE+DKW+T+
Sbjct: 199 RLF---LMYCQGHAPSSRNILTLLILCGSFAVICAGFTFLQLQLVKDGMTTNEQDKWFTL 255

Query: 257 QCLMEDKKLVKSSDNN-WYISFVND------QGETEFYSTNAYDHKKYQLT--EYKVIDN 307
           Q  M D KL+++ D N W+I+  ND        +T FYSTNAYDH+ Y L+  EY ++++
Sbjct: 256 QEYMRDGKLIRTKDENKWFIANPNDDATITINADTIFYSTNAYDHEGYHLSSDEYTIVED 315

Query: 308 VEDIPNIYDKGSLWKNFKDFC 328
              I N+YD G  + N KDFC
Sbjct: 316 PRQITNLYDSGDFFTNLKDFC 336

>KAFR0B05370 Chr2 complement(1105534..1106523) [990 bp, 329 aa] {ON}
           Anc_8.286 YDR126W
          Length = 329

 Score =  272 bits (695), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 125/312 (40%), Positives = 193/312 (61%), Gaps = 5/312 (1%)

Query: 20  ISPFFKNTPFISIYYKYAYEPVVQDNKKYRWKFHIVPIFYITLFIYLVINFYAKVEPLIH 79
           +SP  K     S YY+  + P ++D++KY+WK+H+VPIFY+TL+ Y+V+ ++ K+ P+I 
Sbjct: 20  LSPTLKEFWLFSFYYQRIFVPFLKDDRKYKWKYHLVPIFYVTLYTYMVLLYFTKLNPIIK 79

Query: 80  DKLTYFERXXXXXXXXXXXXXXXXXXMLINPDTALMYSNDSIKKYAYDRILYFPDTECKT 139
            +LT  ER                  M I P+++L +++   + + +D ++++P+T C T
Sbjct: 80  SQLTILERWVIIPFSLLISLLSGILTMRIRPESSLGFNSSPYQDFEFDSLIFYPNTFCST 139

Query: 140 CKVEKPARSKHCAVCDQCILVNDHHCVWVNNCIGRGNXXXXXXXXXDNTLFMSYASMRLL 199
           C++EKPARSKHC +C++C+L++DHHC+W NNCIG GN          NTL + YA +R++
Sbjct: 140 CRLEKPARSKHCNICNRCVLLSDHHCIWANNCIGLGNYQYFYTFLVSNTLLLGYAFLRII 199

Query: 200 EITLNFRRAGENVPRDVMTLDILCGCFLFICGTFSYMQLLIVKDGMTTNEKDKWYTIQCL 259
            +T     +    P  V+T  IL G F  I   F+Y+Q  +V DGMTTNEKDKW+TIQ  
Sbjct: 200 LLT---AYSDIGFPNIVLTFLILSGAFFAILLVFTYLQFALVYDGMTTNEKDKWFTIQEF 256

Query: 260 MEDKKLVKSSDNNWYISFVNDQG--ETEFYSTNAYDHKKYQLTEYKVIDNVEDIPNIYDK 317
           M + +L+++ +  W I+   +     T FYSTNAYDH  Y    ++ I + ++IPNIYDK
Sbjct: 257 MREGRLIRTDNGQWLIAHPEEPAGQATRFYSTNAYDHTIYCPVNFRPITHHDEIPNIYDK 316

Query: 318 GSLWKNFKDFCE 329
           GS  KN K+ C+
Sbjct: 317 GSFLKNLKELCK 328

>Suva_2.289 Chr2 (498420..499427) [1008 bp, 335 aa] {ON} YDR126W
           (REAL)
          Length = 335

 Score =  272 bits (695), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 142/318 (44%), Positives = 196/318 (61%), Gaps = 14/318 (4%)

Query: 21  SPFFKNTPFISIYYKYAYEPVVQDNKKYRWKFHIVPIFYITLFIYLVINFYAKVEPLIHD 80
           SP FK+T   S +Y+  ++P V D+ KYRWKFH+VP+FY ++++YLV  ++ +VEPLI +
Sbjct: 20  SPVFKSTWPFSTFYRRVFQPFVTDDHKYRWKFHLVPLFYTSIYLYLVFTYHTRVEPLIKN 79

Query: 81  KLTYFERXXXXXXXXXXXXXXXXXXMLINPDTALMYSNDSIKKYAYDRILYFPDTECKTC 140
           +L   ER                  M+   + +  +   S +KY YD +LY+P  +C TC
Sbjct: 80  ELFLLERILIVPIIILPPVVLGILAMVTKAEDSNNHKLGSTEKYPYDYLLYYPGVKCSTC 139

Query: 141 KVEKPARSKHCAVCDQCILVNDHHCVWVNNCIGRGNXXXXXXXXXDNTLFMSYASMRLLE 200
           +  K ARSKHC++C++C+LV DHHC+WVNNCIG+GN          N   MSYA +RL  
Sbjct: 140 RTIKAARSKHCSICNRCVLVADHHCIWVNNCIGKGNYLQFYLFLFSNIFSMSYAFLRLYF 199

Query: 201 ITLNFRRAGENVPRDVMTLDILCGCFLFICGTFSYMQLLIVKDGMTTNEKDKWYTIQCLM 260
           I+ N   +   +PR V+TL ILCGCF  IC  F+Y+QL IVK+GMTTNE+DKWYTIQ  M
Sbjct: 200 ISFN---STAVLPRAVLTLTILCGCFTIICAIFTYLQLAIVKEGMTTNEQDKWYTIQEYM 256

Query: 261 EDKKLVKSSDNN---WYISFV--NDQGE------TEFYSTNAYDHKKYQLTEYKVIDNVE 309
            + KLV+S D++   W++ F    D G+        FYSTNAYDH +Y+L  Y  I +  
Sbjct: 257 REGKLVRSLDDDSRSWFLKFTEKGDTGQPLQDQHVTFYSTNAYDHHRYRLKHYTTIKDAS 316

Query: 310 DIPNIYDKGSLWKNFKDF 327
           +I NIYDKG+   N  D 
Sbjct: 317 EITNIYDKGTFLANLVDL 334

>Kpol_1033.16 s1033 (35544..36509) [966 bp, 321 aa] {ON}
           (35544..36509) [966 nt, 322 aa]
          Length = 321

 Score =  271 bits (692), Expect = 4e-89,   Method: Compositional matrix adjust.
 Identities = 133/308 (43%), Positives = 188/308 (61%), Gaps = 7/308 (2%)

Query: 21  SPFFKNTPFISIYYKYAYEPVVQDNKKYRWKFHIVPIFYITLFIYLVINFYAKVEPLIHD 80
           SP FK T  +SIYY   Y P   D ++YRWK+++VP  Y+ L+++++I ++ +V  +++ 
Sbjct: 19  SPIFKLTWPLSIYYTKFYRPFFLDKERYRWKYYLVPGLYLGLYLFVIIYYHLRVNFMVNP 78

Query: 81  KLTYFERXXXXXXXXXXXXXXXXXXMLINPDTALMYSNDSIKKYAYDRILYFPDTECKTC 140
            L +FE+                  M+  P+ ++ +  +S  +Y +D ILYFP+  CKTC
Sbjct: 79  HLYWFEKGLILPIMFTSLPYFGVMTMITKPENSIEHGINSNNRYRFDEILYFPNVSCKTC 138

Query: 141 KVEKPARSKHCAVCDQCILVNDHHCVWVNNCIGRGNXXXXXXXXXDNTLFMSYASMRLLE 200
           +  KPARSKHC++CD+CIL+ DHHC+WVNNCIG GN          N+L M Y   RLL 
Sbjct: 139 RKPKPARSKHCSICDKCILLQDHHCIWVNNCIGMGNYKWFYLFIGGNSLTMIYCFTRLLF 198

Query: 201 ITLNFRRAGENVPRDVMTLDILCGCFLFICGTFSYMQLLIVKDGMTTNEKDKWYTIQCLM 260
           I++ ++       R ++T++ILCG F  IC  F+Y+QL +V  G+TTNE DKWYTI    
Sbjct: 199 ISIKYKVTSS---RAILTMNILCGSFAIICSVFTYLQLDLVSQGITTNEMDKWYTIHEYC 255

Query: 261 EDKKLVKSSDNNWYISFVNDQGETEFYSTNAYDHKKYQLTEYKVIDNVEDIPNIYDKGSL 320
            D KL +S   NW   F+ D   T FYSTN YDH +Y  T+Y +I++  DI NIYDKGS 
Sbjct: 256 RDGKLARSKSGNW---FLIDSNNT-FYSTNIYDHTRYSPTQYTIINDPTDIQNIYDKGSC 311

Query: 321 WKNFKDFC 328
           W NF D C
Sbjct: 312 WLNFIDIC 319

>Smik_4.372 Chr4 (664437..665444) [1008 bp, 335 aa] {ON} YDR126W
           (REAL)
          Length = 335

 Score =  268 bits (685), Expect = 8e-88,   Method: Compositional matrix adjust.
 Identities = 141/319 (44%), Positives = 195/319 (61%), Gaps = 13/319 (4%)

Query: 21  SPFFKNTPFISIYYKYAYEPVVQDNKKYRWKFHIVPIFYITLFIYLVINFYAKVEPLIHD 80
           SP FK+T   S +Y+  ++P + D++KYRWKFH+VPIFY  +++YLV  ++ +VE L+  
Sbjct: 20  SPVFKSTWPFSTFYRNVFQPFIADDQKYRWKFHLVPIFYTLIYLYLVYTYHTRVEWLVRS 79

Query: 81  KLTYFERXXXXXXXXXXXXXXXXXXMLINPDTALMYSNDSIKKYAYDRILYFPDTECKTC 140
           +L   ER                  M+   + +  +   S +KY YD +LY+P  +C TC
Sbjct: 80  ELFLCERILVVPIITLAPIACGILVMVTKAEDSYHHKPGSTEKYPYDYLLYYPVVKCSTC 139

Query: 141 KVEKPARSKHCAVCDQCILVNDHHCVWVNNCIGRGNXXXXXXXXXDNTLFMSYASMRLLE 200
            + KPARSKHC++C++CILV DHHC+WVNNCIG+GN          N   + YA +RL  
Sbjct: 140 HIIKPARSKHCSICNRCILVADHHCIWVNNCIGKGNYLQFYLFLISNIFSLLYAFLRLWC 199

Query: 201 ITLNFRRAGENVPRDVMTLDILCGCFLFICGTFSYMQLLIVKDGMTTNEKDKWYTIQCLM 260
           I+LN + A   +PR V+TL ILCGCF  IC  F+Y+QL IV++GMTTNE+DKWYTIQ  M
Sbjct: 200 ISLNSKTA---LPRAVLTLTILCGCFTIICIIFTYLQLTIVREGMTTNEQDKWYTIQEYM 256

Query: 261 EDKKLVKSSDNN---WYISFVNDQG-------ETEFYSTNAYDHKKYQLTEYKVIDNVED 310
            + KLV+S ++N   W++    D            FYSTNAYDHK+Y L  Y  I +  +
Sbjct: 257 REGKLVRSLNDNCQSWFLKLTEDDTTKLTQDQHATFYSTNAYDHKQYNLAHYITIKDASE 316

Query: 311 IPNIYDKGSLWKNFKDFCE 329
           I NIYDKG+   NF D  +
Sbjct: 317 ISNIYDKGTFLANFTDLIQ 335

>TDEL0F04130 Chr6 (759451..760437) [987 bp, 328 aa] {ON} Anc_8.286
           YDR126W
          Length = 328

 Score =  267 bits (683), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 125/310 (40%), Positives = 187/310 (60%), Gaps = 2/310 (0%)

Query: 19  FISPFFKNTPFISIYYKYAYEPVVQDNKKYRWKFHIVPIFYITLFIYLVINFYAKVEPLI 78
            +SPF+K     S YY   + P++Q+++++RWKF++VP FY++L+ Y++      V P+I
Sbjct: 20  LLSPFYKVKWPFSWYYTRIFRPLLQEDQRFRWKFYVVPAFYLSLYCYIIFVLIRDVIPVI 79

Query: 79  HDKLTYFERXXXXXXXXXXXXXXXXXXMLINPDTALMYSNDSIKKYAYDRILYFPDTECK 138
            ++L   E+                  M +   T+      S ++Y YD ILY+P+ +C+
Sbjct: 80  GNRLLSVEKLCIIPVLVVATPVLGWLSMTVKAKTSRGCQPGSAQEYDYDYILYYPNVQCR 139

Query: 139 TCKVEKPARSKHCAVCDQCILVNDHHCVWVNNCIGRGNXXXXXXXXXDNTLFMSYASMRL 198
           TC +EKPARS+HC +C +C+LV DHHCVWVNNCIG+GN          N + +SY  +R+
Sbjct: 140 TCHIEKPARSRHCNLCRECVLVADHHCVWVNNCIGKGNYQFFYAFLVVNVISLSYGFLRV 199

Query: 199 LEITLNFRRAGENVPRDVMTLDILCGCFLFICGTFSYMQLLIVKDGMTTNEKDKWYTIQC 258
           L I++    +    PR ++   ILCG F  ICG F+Y+QL +V DGMTT EKDKWYTIQ 
Sbjct: 200 LWISVMKDPSMVVYPRSILIFTILCGTFAIICGVFTYLQLQLVNDGMTTGEKDKWYTIQQ 259

Query: 259 LMEDKKLVKSSDNNWYISFVNDQGETEFYSTNAYDHKKYQLTEYKVIDNVEDIPNIYDKG 318
           +M +  LV++ D  ++I   + Q   +FYSTNAYD K Y    Y ++++ +DI NIYD+G
Sbjct: 260 IMREGNLVRTLDGQFFIQ--DQQNPNQFYSTNAYDSKLYVPQNYSIVNDPKDITNIYDQG 317

Query: 319 SLWKNFKDFC 328
           S W   +  C
Sbjct: 318 SFWYKLERLC 327

>YDR126W Chr4 (703234..704244) [1011 bp, 336 aa] {ON}
           SWF1Palmitoyltransferase that acts on transmembrane
           proteins, including the SNAREs Snc1p, Syn8p, Tlg1p and
           likely all SNAREs; contains an Asp-His-His-Cys-cysteine
           rich (DHHC-CRD) domain; may have a role in vacuole
           fusion
          Length = 336

 Score =  267 bits (682), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 139/321 (43%), Positives = 197/321 (61%), Gaps = 15/321 (4%)

Query: 19  FISPFFKNTPFISIYYKYAYEPVVQDNKKYRWKFHIVPIFYITLFIYLVINFYAKVEPLI 78
            +SP FK+T   S +Y+  ++P + D++KYRWK H+VP+FY ++++YLV  ++ +VE  I
Sbjct: 18  LLSPVFKSTWPFSTFYRNVFQPFLVDDQKYRWKLHLVPLFYTSIYLYLVYTYHMRVESTI 77

Query: 79  HDKLTYFERXXXXXXXXXXXXXXXXXXMLINPDTALMYSNDSIKKYAYDRILYFPDTECK 138
            ++L   ER                  M+   + +  + + S ++Y YD +LY+P  +C 
Sbjct: 78  KNELFLLERILIVPIIILPPVALGILAMVSRAEDSKDHKSGSTEEYPYDYLLYYPAIKCS 137

Query: 139 TCKVEKPARSKHCAVCDQCILVNDHHCVWVNNCIGRGNXXXXXXXXXDNTLFMSYASMRL 198
           TC++ KPARSKHC++C++C+LV DHHC+W+NNCIG+GN          N   M YA +RL
Sbjct: 138 TCRIVKPARSKHCSICNRCVLVADHHCIWINNCIGKGNYLQFYLFLISNIFSMCYAFLRL 197

Query: 199 LEITLNFRRAGENVPRDVMTLDILCGCFLFICGTFSYMQLLIVKDGMTTNEKDKWYTIQC 258
             I+LN   +   +PR V+TL ILCGCF  IC  F+Y+QL IVK+GMTTNE+DKWYTIQ 
Sbjct: 198 WYISLN---STSTLPRAVLTLTILCGCFTIICAIFTYLQLAIVKEGMTTNEQDKWYTIQE 254

Query: 259 LMEDKKLVKSSDNN---WYISFV---NDQGE------TEFYSTNAYDHKKYQLTEYKVID 306
            M + KLV+S D++   W+       +D  E        FYSTNAYDHK Y LT Y  I 
Sbjct: 255 YMREGKLVRSLDDDCPSWFFKCTEQKDDAAEPLQDQHVTFYSTNAYDHKHYNLTHYITIK 314

Query: 307 NVEDIPNIYDKGSLWKNFKDF 327
           +  +IPNIYDKG+   N  D 
Sbjct: 315 DASEIPNIYDKGTFLANLTDL 335

>NCAS0B03590 Chr2 complement(636400..637389) [990 bp, 329 aa] {ON} 
          Length = 329

 Score =  263 bits (673), Expect = 4e-86,   Method: Compositional matrix adjust.
 Identities = 131/315 (41%), Positives = 196/315 (62%), Gaps = 7/315 (2%)

Query: 19  FISPFFKNTPFISIYYKYAYEPVVQDNKKYRWKFHIVPIFYITLFIYLVINFYAKVEPLI 78
            ISP ++     S+YYK  + P++QDNKK++ KF+I+PIFY  L++YL+  +Y+KV P I
Sbjct: 18  LISPRYRLIWPFSVYYKKVFHPLIQDNKKFKIKFYIIPIFYFVLYLYLIYCYYSKVAPFI 77

Query: 79  HDKLTYFERXX-XXXXXXXXXXXXXXXXMLINPDTALMYSNDSIKKYAYDRILYFPDTEC 137
           +++L  FE+                   M   P     YS++   +YA+D ++++P   C
Sbjct: 78  NNQLWAFEKYMWIPLIIIASPLIFGVFTMFTKPTYTKKYSDEIDNEYAFDNLIFYPQILC 137

Query: 138 KTCKVEKPARSKHCAVCDQCILVNDHHCVWVNNCIGRGNXXXXXXXXXDNTLFMSYASMR 197
           +TC+  KPARSKHC++CD+C+LV DHHC+WVNNC+G+GN          NT  ++YA +R
Sbjct: 138 RTCQSYKPARSKHCSICDRCVLVADHHCIWVNNCVGKGNYTYFYMFLITNTFSLTYAFIR 197

Query: 198 LLEITLNFRRAGENVPRDVMTLDILCGCFLFICGTFSYMQLLIVKDGMTTNEKDKWYTIQ 257
           LL I   F      +P++ +TL ILCGCF  ICG F+++QL + ++GMTTNEKDKW+T+ 
Sbjct: 198 LLTI---FYTTNVYLPKNTLTLTILCGCFSVICGIFTFLQLNLAQEGMTTNEKDKWFTVH 254

Query: 258 CLMEDKKLVKSSDNNWYISFVNDQGETE---FYSTNAYDHKKYQLTEYKVIDNVEDIPNI 314
             M D KLV++    WY +  +D   +E   FYSTN YDH +Y L  +++I++   I NI
Sbjct: 255 EFMRDGKLVRTQSGRWYFADPHDSDISEDSVFYSTNGYDHTEYTLRNFEIIEDPSRITNI 314

Query: 315 YDKGSLWKNFKDFCE 329
           YD+G    N +D C+
Sbjct: 315 YDRGDFLANLRDLCK 329

>ZYRO0D06600g Chr4 complement(573724..574716) [993 bp, 330 aa] {ON}
           similar to uniprot|Q04629 Saccharomyces cerevisiae
           YDR126W SWF1 Spore Wall Formation
          Length = 330

 Score =  260 bits (665), Expect = 8e-85,   Method: Compositional matrix adjust.
 Identities = 126/314 (40%), Positives = 184/314 (58%), Gaps = 6/314 (1%)

Query: 19  FISPFFKNTPFISIYYKYAYEPVVQDNKKYRWKFHIVPIFYITLFIYLVINFYAKVEPLI 78
            ISP FK     S+YYKY + P+ QDN ++RWKF++VP+FY ++++ +V      V P +
Sbjct: 17  LISPLFKYQWPFSLYYKYVFLPLFQDNDRFRWKFYLVPLFYSSIYLGVVHLAIKNVIPQL 76

Query: 79  HDKLTYFERXXXXXXXXXXXXXXXXXXMLINPDTALMYSNDSIKKYAYDRILYFPDTECK 138
              L +F+                    +I P+T       +I K+ YD +L++P+  C+
Sbjct: 77  SPGLNFFDYWFFIPFFIVLTPATGILAAIIGPETTKSCKRRNIDKFRYDNLLFYPNINCR 136

Query: 139 TCKVEKPARSKHCAVCDQCILVNDHHCVWVNNCIGRGNXXXXXXXXXDNTLFMSYASMRL 198
           TC++ KPARSKHC VC+QC+L  DHHC+W+NNC+G GN          N+L MSYA +R 
Sbjct: 137 TCQLPKPARSKHCNVCNQCVLAVDHHCIWINNCVGLGNYLYFYLFLVLNSLSMSYAFIRS 196

Query: 199 LEITLNFRRAGENVPRDVMTLDILCGCFLFICGTFSYMQLLIVKDGMTTNEKDKWYTIQC 258
           + I     +     PR ++  ++L GCF  IC  F+Y+QL +V++GMTTNEKDKW+TI  
Sbjct: 197 MSIV--GLKPNIKYPRSILAFNLLTGCFALICIVFTYLQLCMVREGMTTNEKDKWFTIHE 254

Query: 259 LMEDKKLVKSSDNNWYISFVN----DQGETEFYSTNAYDHKKYQLTEYKVIDNVEDIPNI 314
            M +K+LVKSS   WY    +       + EF+STN YD + Y+L  Y +I++ E I NI
Sbjct: 255 YMREKRLVKSSSGKWYYDLTDRLDLPTDQHEFFSTNPYDGRLYRLQSYTLIEDAERINNI 314

Query: 315 YDKGSLWKNFKDFC 328
           YD+GS   N +  C
Sbjct: 315 YDEGSFMANLRTLC 328

>TPHA0C01070 Chr3 complement(244556..245557) [1002 bp, 333 aa] {ON}
           Anc_8.286 YDR126W
          Length = 333

 Score =  260 bits (665), Expect = 9e-85,   Method: Compositional matrix adjust.
 Identities = 137/317 (43%), Positives = 192/317 (60%), Gaps = 13/317 (4%)

Query: 21  SPFFKNTPFISIYYKYAYEPVVQDNKKYRWKFHIVPIFYITLFIYLVINFYAKVEPLIHD 80
           SPF KN    S+YY+  Y P ++D   Y+WK+H+VP FY ++++YLV  +YAKVE LI +
Sbjct: 19  SPFLKNRWPFSVYYRRLYVPYLKDVNSYKWKYHVVPGFYFSIYLYLVYCYYAKVEYLIVN 78

Query: 81  KLTYFERXXXXXXXXXXXXXXXXXXML---INPDTALMYSNDSIK-KYAYDRILYFPDTE 136
            L  FER                  M+   IN     +  +D +K K+ +D I+Y     
Sbjct: 79  HLNLFERGILLPLLIVLTPSFGILTMVTKPINIHGNGISQHDKLKNKFPFDNIIYHSGNV 138

Query: 137 CKTCKVEKPARSKHCAVCDQCILVNDHHCVWVNNCIGRGNXXXXXXXXXDNTLFMSYASM 196
           C TC +EKPARSKHC +C  CIL+ DHHC+WVNNCIG GN          NT+ +SYA +
Sbjct: 139 CSTCNIEKPARSKHCNICGTCILLQDHHCIWVNNCIGLGNYKYFFMFLLLNTISLSYAFL 198

Query: 197 RLLEITLNFRRAGENVP--RDVMTLDILCGCFLFICGTFSYMQLLIVKDGMTTNEKDKWY 254
           RLL ITL    +  +VP  ++++ L IL G F  ICG F Y+Q+  V +GMTTNE DKWY
Sbjct: 199 RLLHITL----SKPDVPKSKNILALCILTGSFSVICGVFFYLQMKQVNNGMTTNETDKWY 254

Query: 255 TIQCLMEDKKLVKSSDNNWYISFVNDQGE--TEFYSTNAYDHKKYQLT-EYKVIDNVEDI 311
            +Q LM + KL+KS DNNW+     D  +  ++ YSTN YD+K Y+++ +Y ++ +  +I
Sbjct: 255 AVQELMREGKLIKSEDNNWFALSTEDAPDSPSQVYSTNFYDNKTYKISNDYHIVKDASEI 314

Query: 312 PNIYDKGSLWKNFKDFC 328
           PN+YD+G+   N K FC
Sbjct: 315 PNVYDRGTFLDNLKGFC 331

>CAGL0B01991g Chr2 (182894..183886) [993 bp, 330 aa] {ON} similar to
           uniprot|Q04629 Saccharomyces cerevisiae YDR126w
          Length = 330

 Score =  236 bits (602), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 117/309 (37%), Positives = 173/309 (55%), Gaps = 4/309 (1%)

Query: 22  PFFKNTPFISIYYKYAYEPVVQDNKKYRWKFHIVPIFYITLFIYLVINFYAKVEPLIHDK 81
           P F++      YY   Y+P++ DN +YR KF++VP+FY++++ Y+V  FY++   +I   
Sbjct: 21  PQFRDKFIFRWYYDEVYKPMILDNSRYRIKFYVVPVFYLSVYSYMVYIFYSRTFAIISPM 80

Query: 82  LTYFERXXXXXXXXXXXXXXXXXXMLINPDTALMYSNDSIKKYAYDRILYFPDTECKTCK 141
           LT  E                   M+I PD++  +   S K+Y YD +LYFP  EC+TCK
Sbjct: 81  LTSIETYVVIPLMLILPLFFGSMSMIIKPDSSNAHQIGSEKRYPYDNLLYFPQHECRTCK 140

Query: 142 VEKPARSKHCAVCDQCILVNDHHCVWVNNCIGRGNXXXXXXXXXDNTLFMSYASMRLLEI 201
             KPARSKHC VC+ CI + DHHCVW+NNC+G GN          N L +SY+ +RL+ I
Sbjct: 141 QVKPARSKHCTVCNSCIYLADHHCVWINNCVGMGNYMYFYSFLCSNLLLLSYSFIRLIFI 200

Query: 202 TLNFRRAGENVP---RDVMTLDILCGCFLFICGTFSYMQLLIVKDGMTTNEKDKWYTIQC 258
             N + A    P   + ++ L ILCG F  I   + Y    +V  GMTTNEKDKW  +  
Sbjct: 201 QFN-KSAYNTTPTGEKSLLILSILCGSFTVILAVYCYFVFELVNSGMTTNEKDKWQMVHD 259

Query: 259 LMEDKKLVKSSDNNWYISFVNDQGETEFYSTNAYDHKKYQLTEYKVIDNVEDIPNIYDKG 318
            +    LV+  +  ++I + N     EFYST++YD  +Y + +Y  + +  +I NIYDKG
Sbjct: 260 YINTGDLVRDPEGKYFIKYQNGGNNYEFYSTDSYDGTQYTIVDYFTVKSPAEITNIYDKG 319

Query: 319 SLWKNFKDF 327
           +   N ++F
Sbjct: 320 NFINNLREF 328

>Ecym_4282 Chr4 complement(608898..609920) [1023 bp, 340 aa] {ON}
           similar to Ashbya gossypii AGR065W
          Length = 340

 Score =  208 bits (530), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 118/327 (36%), Positives = 174/327 (53%), Gaps = 24/327 (7%)

Query: 19  FISPFFKNTPFISIYYKYAYEPVVQDNKKYRWKFHIVPIFYITLFIYLVINFYAKVEPLI 78
            +SP FK+      YY   + P+ +  ++Y+WK+ +VP FY  ++IY    FY  V   I
Sbjct: 19  LVSPLFKSWQPFRWYYAAVFRPLFRQEEEYKWKYWLVPAFYTGIYIYCSFVFYVHVYGEI 78

Query: 79  HDKLTYFERXXXXXXXXXXXXXXXXXXMLINPDTALMYSNDSIKKYAYDRILYFPDTECK 138
              L   E                   ++ +P   + Y    I    +D I++  +  C+
Sbjct: 79  RSGLYTLE-ARCLPVVLALPLLSGYYTIVTSPHDTITYVGPEI---PFDGIIFHDNIVCR 134

Query: 139 TCKVEKPARSKHCAVCDQCILVNDHHCVWVNNCIGRGNXXXXXXXXXDNTLFMSYASMRL 198
           +C+++K ARSKHC++C +CILV DHHCVW+NNCIG GN          N   +SYA++RL
Sbjct: 135 SCRLKKAARSKHCSICGRCILVADHHCVWLNNCIGLGNYQYFYLFLLSNCSMLSYATIRL 194

Query: 199 LEITLNFRRAGENVPRDVMTLDILCGCFLFICGTFSYMQLLIVKDGMTTNEKDKWYTIQC 258
             +  +         +  ++L IL  CF  I  +F+YMQ  +V+DGMTTNEKDKWYTI  
Sbjct: 195 SSVAPS---GLWRSNKSFLSLMILVCCFAVISISFTYMQFALVRDGMTTNEKDKWYTIHK 251

Query: 259 LMEDKKLVK-SSDNNWYISFVNDQG--------------ETEFYSTNAYDHKKYQL--TE 301
           LM +++L+K ++D  +YI   N                 + E+YSTN YD K Y L  T 
Sbjct: 252 LMRNEQLLKLNNDCKFYIRIKNSPTPSSHTSTSTRTTHYQYEYYSTNPYDPKTYSLSDTS 311

Query: 302 YKVIDNVEDIPNIYDKGSLWKNFKDFC 328
           Y V+++ +DIPNIYD+ S W+N K  C
Sbjct: 312 YHVVNSYQDIPNIYDRCSFWQNLKQRC 338

>KLTH0G13112g Chr7 complement(1129318..1130367) [1050 bp, 349 aa]
           {ON} similar to uniprot|Q04629 Saccharomyces cerevisiae
           YDR126W SWF1 Spore Wall Formation
          Length = 349

 Score =  208 bits (530), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 114/352 (32%), Positives = 164/352 (46%), Gaps = 38/352 (10%)

Query: 1   MGFGTFXXXXXXXXXXXXFISPFFKNTPFISIYYKYAYEPVVQDNKKYRWKFHIVPIFYI 60
           M  G F              SP F+  P    YY   + P+ +D  ++RWKF  +P FY+
Sbjct: 1   MKMGLFIWILIIPQLVLSLFSPLFRTKPVFRWYYTRVFHPIFEDVNRFRWKFRAIPAFYL 60

Query: 61  TLFIYLVINFYAKVEPLIHDKLTYFERXXXXXXXXXXXXXXXXXXMLINPDTALMYSNDS 120
           +++ Y    F+  +E LI  +L   ER                  + I P +   Y++  
Sbjct: 61  SIYAYCTFLFFKDIEGLIRSRLFGVERLLIIPVALSAPIITGLLTIWIKPKST--YASPM 118

Query: 121 IKKYAYDRILYFPDTECKTCKVEKPARSKHCAVCDQCILVNDHHCVWVNNCIGRGNXXXX 180
           +   AYD +++     C+TCK+ K AR+KHC +CDQC+ + DHHCVW NNCIGRGN    
Sbjct: 119 LD--AYDELIFHSGVSCRTCKLPKFARTKHCPICDQCVQLADHHCVWANNCIGRGNYQYF 176

Query: 181 XXXXXDNTLFMSYASMRLLEITLNFRRAGENVPRDVMTLDILCGCFLFICGTFSYMQLLI 240
                 N    +Y  +RLL +   F  +     R ++ L IL GCF  I   FSY Q ++
Sbjct: 177 YLFLVSNVFLTNYGFLRLLFLQ-RFVHS-----RQLLILSILLGCFGVILAVFSYFQFVL 230

Query: 241 VKDGMTTNEKDKWYTIQCLMEDKKLVKSSDNNWYISFVND----------------QGET 284
           V+DGMTTNE++KW  I  ++  +++V      +Y   + D                QG  
Sbjct: 231 VRDGMTTNEENKWLVIHDMIRARQMVTDDTGKYYFRLLADCQEDSAESLTNPRHSSQGPN 290

Query: 285 EF------------YSTNAYDHKKYQLTEYKVIDNVEDIPNIYDKGSLWKNF 324
           EF            YSTN YD+  Y +   K I +   I NIYD+G  WKN 
Sbjct: 291 EFHLNDSSPDIYVYYSTNPYDNATYDVKNPKEILSTAAITNIYDEGGFWKNL 342

>KNAG0H03110 Chr8 complement(584877..585872) [996 bp, 331 aa] {ON}
           Anc_8.286 YDR126W
          Length = 331

 Score =  207 bits (528), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 117/310 (37%), Positives = 169/310 (54%), Gaps = 17/310 (5%)

Query: 30  ISIYYKYAYEPVVQDNKKYRWKFHIVPIFYITLFIYLVINFYAKVEPLIHDKLTYFERXX 89
           +S YY+  Y P + D  +YR K++IVP+FY +L+ Y++  + +++ P+I  +L + E   
Sbjct: 29  LSWYYEKVYRPFLADPTRYRVKYYIVPVFYFSLYCYMLNLYRSELLPVIWGRLYFIELYF 88

Query: 90  XXXXXXXXXXXXXXXXMLINPDTALMYSND---SIKKYAYDRILYFPDTECKTCKVEKPA 146
                           M   P+           S  ++ YD ILY+P+T C++C   K A
Sbjct: 89  FQPLLLAAIPVSGLLTMFTRPEGCGGRDQGVAPSEGQWPYDGILYYPNTTCRSCHTVKWA 148

Query: 147 RSKHCAVCDQCILVNDHHCVWVNNCIGRGNXXXXXXXXXDNTLFMSYASMRLLEITLNFR 206
           RSKHC++C +CI + DHHC+W N CIGRGN          + L ++YA  RL      F 
Sbjct: 149 RSKHCSICRRCIQLADHHCIWFNTCIGRGNFFYFYVFLACHCLILTYAFARL----FFFV 204

Query: 207 RAGEN---VPRDVMTLDILCGCFLFICGTFSYMQLLIVKDGMTTNEKDKWYTIQCLMEDK 263
              +N     R  +TL +L G F  +   F+Y Q+++VK+GMTTNE+DKW+ I   M D 
Sbjct: 205 VVADNKLTSTRSTLTLLMLTGTFALLVDLFTYWQMMLVKEGMTTNEQDKWFLIHEYMRDG 264

Query: 264 KLVKSSDNN----WYISFVNDQGETEFYSTNAYDHKKYQLTEYKVIDNVEDIPNIYDKGS 319
           K V  S N     W   F+    + +FYSTNAYDH  Y LT Y ++ N  +I N+YDKGS
Sbjct: 265 KCVNVSCNGSTKKW---FLESDEDGKFYSTNAYDHTAYTLTNYHIVKNASEIINMYDKGS 321

Query: 320 LWKNFKDFCE 329
            W+NFKD C 
Sbjct: 322 FWENFKDMCR 331

>KLLA0F19690g Chr6 (1820355..1821329) [975 bp, 324 aa] {ON} similar
           to uniprot|Q04629 Saccharomyces cerevisiae YDR126W SWF1
           Spore Wall Formation
          Length = 324

 Score =  195 bits (495), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 110/309 (35%), Positives = 160/309 (51%), Gaps = 12/309 (3%)

Query: 21  SPFFKNTPFISIYYKYAYEPVVQDNKKYRWKFHIVPIFYITLFIYLVINFYAKVEPLIHD 80
           SP FK+      YY++ Y P+  D  +YRWK+ +VP FY  + I+ V  FY K+   ++ 
Sbjct: 19  SPKFKDLILFRWYYQHIYYPLFTDYTRYRWKYWLVPGFYACILIFCVHLFYNKLNDTVNP 78

Query: 81  KLTYFERXXXXXXXXXXXXXXXXXXMLINPDTALMYSNDSIKKYAYDRILYFPDTECKTC 140
            L   E+                  + + P         +  ++  D I++ P   C+TC
Sbjct: 79  YLYSLEKAFIPITIAFTSLTGVAS-VFVKP-----LGLQAGPQFQPDYIIFHPSAVCQTC 132

Query: 141 KVEKPARSKHCAVCDQCILVNDHHCVWVNNCIGRGNXXXXXXXXXDNTLFMSYASMRLLE 200
           K  K  RSKHC +C++CI ++DHHC+W+NNC+G GN          N L ++YAS+RLL 
Sbjct: 133 KTIKVPRSKHCPICERCIPLHDHHCIWINNCVGYGNYEYFYSFLLSNCLLLTYASLRLLT 192

Query: 201 ITLNFRRAGENVPRDVMTLDILCGCFLFICGTFSYMQLLIVKDGMTTNEKDKWYTIQCLM 260
           +   FR       +  ++L +L   F  I   F+Y QL +V DGMT NE+DKWY +Q  M
Sbjct: 193 L---FRITAFKKDKFFLSLFLLTTAFSLIAIVFTYYQLKLVNDGMTNNEQDKWYLVQEYM 249

Query: 261 EDKKLVKSSDNNWYISFVNDQGETE---FYSTNAYDHKKYQLTEYKVIDNVEDIPNIYDK 317
            +  LVK  D   Y   ++   +T    FYSTN YDH KY L     I + E+I N+YD+
Sbjct: 250 RNGNLVKDMDGVLYYRSMSTDAQTAEPIFYSTNLYDHSKYHLINPAKILSHEEIINLYDR 309

Query: 318 GSLWKNFKD 326
           GS   N K+
Sbjct: 310 GSFLDNLKE 318

>Kwal_56.23697 s56 complement(665965..666981) [1017 bp, 338 aa] {ON}
           YDR126W (PSL10) - Hypothetical ORF [contig 174] FULL
          Length = 338

 Score =  191 bits (485), Expect = 9e-58,   Method: Compositional matrix adjust.
 Identities = 110/322 (34%), Positives = 161/322 (50%), Gaps = 30/322 (9%)

Query: 25  KNTPFISIYYKYAYEPVVQDNKKYRWKFHIVPIFYITLFIYLVINFYAKVEPLIHDKLTY 84
           +  P    YY+  + P+ +D  K+R+KFH+VPI Y+ +++Y  + F+  +E LIH +L  
Sbjct: 23  RARPVFKWYYRNVFYPIFEDADKFRFKFHVVPILYLAIYLYCCLLFFRDIEGLIHSRLYA 82

Query: 85  FERXXXXXXXXXXXXXXXXXXMLINPDTALMYSNDSIKKYAYDRILYFPDTECKTCKVEK 144
            ER                  ML+ P++   Y    + ++  D IL+    EC+TCK+ K
Sbjct: 83  IERWFIIPVALMTPISCGLLTMLVKPEST--YIAPPVDQF--DGILFHAGVECRTCKMPK 138

Query: 145 PARSKHCAVCDQCILVNDHHCVWVNNCIGRGNXXXXXXXXXDNTLFMSYASMRLLEITLN 204
            ARSKHCA+C +C  + DHHCVW NNCIG+GN          N     Y   RLL +   
Sbjct: 139 YARSKHCAICGRCTQLADHHCVWANNCIGKGNYEYFYLFLASNVFLTVYGFTRLLYLQPT 198

Query: 205 FRRAGENVPRDVMTLDILCGCFLFICGTFSYMQLLIVKDGMTTNEKDKWYTIQCLMEDKK 264
            +       R ++TL +L G F  I   FSY Q++++KDGMTTNE+ KW  +  +M  +K
Sbjct: 199 VKS------RTLLTLALLLGSFALILVIFSYFQVVLIKDGMTTNEESKWLVVHDMMRARK 252

Query: 265 LVKSSDNNWYISFVNDQGETE--------------------FYSTNAYDHKKYQLTEYKV 304
           LV  +   +Y     ++                        FYSTN YD+  Y +   + 
Sbjct: 253 LVVDNAGKFYYRIPENEDSLSPELKSNEGPELTTTSPSRYTFYSTNPYDNCTYTVKYPRE 312

Query: 305 IDNVEDIPNIYDKGSLWKNFKD 326
           I + E+I NIYDKGS   N KD
Sbjct: 313 IVDYEEITNIYDKGSFCNNLKD 334

>AGR065W Chr7 (835871..836851) [981 bp, 326 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR126W (SWF1)
          Length = 326

 Score =  188 bits (478), Expect = 7e-57,   Method: Compositional matrix adjust.
 Identities = 107/310 (34%), Positives = 154/310 (49%), Gaps = 18/310 (5%)

Query: 19  FISPFFKNTPFISIYYKYAYEPVVQDNKKYRWKFHIVPIFYITLFIYLVINFYAKVEPLI 78
             +P  +     S YY   +  V+QD +++RWK+   P FY  ++ Y V  FY +V   I
Sbjct: 17  LAAPALRAYWPFSWYYHVVFRTVLQDTQRHRWKYWATPAFYAGVYAYCVWLFYGEVYAEI 76

Query: 79  HDKLTYFERXXXXXXXXXXXXXXXXXXMLINPDTALMYSNDSIKKYAYDRILYFPDTECK 138
              L   ER                         A           AYD +L+    EC+
Sbjct: 77  AKALWVPERWVLPAAVVA---------PAAAGVAAAATPAAVPADAAYDGLLFHDGVECR 127

Query: 139 TCKVEKPARSKHCAVCDQCILVNDHHCVWVNNCIGRGNXXXXXXXXXDNTLFMSYASMRL 198
           TC+V KPARS+HC VC +C+ + DHHCVW+NNC+GRGN          +   ++Y ++RL
Sbjct: 128 TCRVRKPARSRHCGVCGRCVPLADHHCVWLNNCVGRGNYGLFYLALGAHCALLTYGAVRL 187

Query: 199 LEITLNFRRAGENVPRDVMTLDILCGCFLFICGTFSYMQLLIVKDGMTTNEKDKWYTIQC 258
                  R      PR ++ L++L   F  +C  F+  Q+ +V+DGMTTNE+DKWY +Q 
Sbjct: 188 PLAAPAGR-----WPRALLALELLVASFAVLCVWFTATQVALVRDGMTTNEQDKWYAVQE 242

Query: 259 LMEDKKLVKSSDNNWYISFVNDQGETEFYSTNAYDHKKYQL--TEYKVIDNVEDIPNIYD 316
            M +  LV+      +   V      EFYSTNAYDH+ Y L    Y V+ + E+IPN+YD
Sbjct: 243 SMREGTLVRLRGR--FYHRVEGGDGVEFYSTNAYDHRTYALHNEPYAVVTSHEEIPNVYD 300

Query: 317 KGSLWKNFKD 326
            GS  +N + 
Sbjct: 301 TGSFCENLRQ 310

>SAKL0H16434g Chr8 complement(1447419..1449086) [1668 bp, 555 aa]
           {ON} similar to uniprot|Q04629 Saccharomyces cerevisiae
           YDR126W SWF1 Spore Wall Formation
          Length = 555

 Score =  194 bits (492), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 103/286 (36%), Positives = 156/286 (54%), Gaps = 10/286 (3%)

Query: 21  SPFFKNTPFISIYYKYAYEPVVQDNKKYRWKFHIVPIFYITLFIYLVINFYAKVEPLIHD 80
           SP FK+      YY + + P+ +D  +YRWK+++VP+FY +++IY V+ FY  +   +  
Sbjct: 19  SPLFKSVVPFHWYYAHIFHPLFKDTLRYRWKYNVVPLFYTSIYIYCVLMFYKDLYRDLSP 78

Query: 81  KLTYFERXXXXXXXXXXXXXXXXXXMLINPDTALMYSNDSIKKYAYDRILYFPDTECKTC 140
            L + ER                  M I PD+    ++  +    +D I++ P T C+TC
Sbjct: 79  YLLFLERFLIVPLLLLGPIITGYLCMTIEPDSTKSLADCRV---PFDEIIFHPGTICQTC 135

Query: 141 KVEKPARSKHCAVCDQCILVNDHHCVWVNNCIGRGNXXXXXXXXXDNTLFMSYASMRLLE 200
              KPARSKHC++C++CIL+ DHHC+WVNNCIG+GN          N   +SY+ +RL  
Sbjct: 136 HKIKPARSKHCSICNKCILMVDHHCIWVNNCIGKGNYKYFYGFLLSNVTLLSYSFLRLTS 195

Query: 201 ITLNFRRAGENV-PRDVMTLDILCGCFLFICGTFSYMQLLIVKDGMTTNEKDKWYTIQCL 259
           I L      EN+  + ++ L IL GCF  I   F Y Q  +V DGMTTNE+DKW+T+Q  
Sbjct: 196 IQL--MSQTENIKTKPMLVLTILTGCFDIIVAVFGYTQFNLVHDGMTTNEQDKWFTVQEF 253

Query: 260 MEDKKLVKSSDNNWYISFVN----DQGETEFYSTNAYDHKKYQLTE 301
           M D  LV+    ++Y   ++    D+ + E   +   ++KK  L E
Sbjct: 254 MRDGNLVRDKKGHYYFRILDESSSDRDQKEEEDSYRSNNKKKMLLE 299

 Score = 46.6 bits (109), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 31/51 (60%)

Query: 276 SFVNDQGETEFYSTNAYDHKKYQLTEYKVIDNVEDIPNIYDKGSLWKNFKD 326
           S V+ +    FYSTN YD   Y + +Y VI + +D+ NIYDKG+ W N  D
Sbjct: 501 SNVSPKKNYRFYSTNPYDDLTYHVEDYDVIKDPKDLNNIYDKGNFWANLWD 551

>NCAS0C02920 Chr3 (549815..550939) [1125 bp, 374 aa] {ON} Anc_8.389
          Length = 374

 Score = 73.2 bits (178), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 35/40 (87%)

Query: 137 CKTCKVEKPARSKHCAVCDQCILVNDHHCVWVNNCIGRGN 176
           CKTC++ +P RS HC++C+ C+L++DHHCVWVNNC+G+ N
Sbjct: 184 CKTCRIWRPPRSSHCSICETCVLMHDHHCVWVNNCVGQRN 223

>KLLA0D18370g Chr4 complement(1549382..1550449) [1068 bp, 355 aa]
           {ON} similar to uniprot|Q6B217 Saccharomyces cerevisiae
           YLR246W ERF2 Subunit of a palmitoyltransferase composed
           of Erf2p and Shr5p that adds a palmitoyl lipid moiety to
           Ras2p through a thioester linkage mutants partially
           mislocalize Ras2p to the vacuole
          Length = 355

 Score = 71.6 bits (174), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 54/94 (57%), Gaps = 6/94 (6%)

Query: 137 CKTCKVEKPARSKHCAVCDQCILVNDHHCVWVNNCIGRGNXXXXXXXXXDNTLFMSYASM 196
           C+TC++ +P RS HC+VCD C+L +DHHC W+NNCIG+ N          +T+     S 
Sbjct: 174 CQTCRIWRPPRSAHCSVCDVCVLSHDHHCKWLNNCIGKRNYRFFLEFLMASTI-----SC 228

Query: 197 RLLEITLNFRRA-GENVPRDVMTLDILCGCFLFI 229
            LL +  +FR +    V    ++L I+C C L I
Sbjct: 229 ILLILLSSFRLSYSPQVRYTPVSLLIICYCGLGI 262

>NDAI0G02250 Chr7 (503564..504733) [1170 bp, 389 aa] {ON} Anc_8.389
          Length = 389

 Score = 70.9 bits (172), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 23/40 (57%), Positives = 33/40 (82%)

Query: 137 CKTCKVEKPARSKHCAVCDQCILVNDHHCVWVNNCIGRGN 176
           C TC++ +P RS HC++C+ CI+ +DHHC+WVNNCIG+ N
Sbjct: 217 CTTCRIWRPPRSSHCSICEACIITHDHHCIWVNNCIGQRN 256

>AGL125C Chr7 complement(473496..474599) [1104 bp, 367 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR246W
           (ERF2)
          Length = 367

 Score = 70.5 bits (171), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 51/94 (54%), Gaps = 6/94 (6%)

Query: 137 CKTCKVEKPARSKHCAVCDQCILVNDHHCVWVNNCIGRGNXXXXXXXXXDNTLFMSYASM 196
           C TC++ +P R+ HCAVCD CIL  DHHC W+NNCIG+ N          + L    +S+
Sbjct: 187 CTTCRIWRPPRASHCAVCDSCILSFDHHCDWLNNCIGQRNHRYFLAFLFSSVL----SSI 242

Query: 197 RLLE-ITLNFRRAGENVPRDVMTLDILCGCFLFI 229
            LL    L  R AG      V +L ++C C + I
Sbjct: 243 WLLTCCALKLRHAGSPSAAPV-SLLLICYCAVSI 275

>Smik_12.306 Chr12 (568353..569432) [1080 bp, 359 aa] {ON} YLR246W
           (REAL)
          Length = 359

 Score = 69.7 bits (169), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 34/40 (85%)

Query: 137 CKTCKVEKPARSKHCAVCDQCILVNDHHCVWVNNCIGRGN 176
           C++C++ +P RS HC+ C+ C++V+DHHC+WVNNCIG+ N
Sbjct: 175 CQSCRIWRPPRSSHCSTCNVCVMVHDHHCIWVNNCIGKRN 214

>TPHA0C02360 Chr3 (531446..532660) [1215 bp, 404 aa] {ON} Anc_8.389
           YLR246W
          Length = 404

 Score = 69.7 bits (169), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 36/50 (72%)

Query: 127 DRILYFPDTECKTCKVEKPARSKHCAVCDQCILVNDHHCVWVNNCIGRGN 176
           D   Y   T C+TC++ +P RS HC++CD C++  DHHC+W+NNC+G+ N
Sbjct: 186 DESQYVEITYCRTCRIWRPPRSSHCSICDCCVMSLDHHCLWLNNCVGKRN 235

>TBLA0H00920 Chr8 (203681..204763) [1083 bp, 360 aa] {ON} Anc_8.389
           YLR246W
          Length = 360

 Score = 68.9 bits (167), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 41/121 (33%), Positives = 58/121 (47%), Gaps = 18/121 (14%)

Query: 137 CKTCKVEKPARSKHCAVCDQCILVNDHHCVWVNNCIGRGNXXXXXXXXXDNTLFMSYASM 196
           C TC + +P R+ HC++C  CI V+DHHC+W+NNC+G  N            +F+  A +
Sbjct: 190 CSTCHIWRPPRASHCSICQACIDVHDHHCIWINNCVGNRNYRYF-------IIFLVGAIL 242

Query: 197 RLLEITLN-------FRRAGENVPRDVMTLDILCGCFLFI-CGTFSYMQLLIVKDGMTTN 248
             + I +N        RRA  N P  V  L I+ GC   I  G      + +   G TT 
Sbjct: 243 SSIFIIINCSIHVARIRRA-SNAP--VAILLIVYGCLTIIYPGILLGYHIALTGTGQTTR 299

Query: 249 E 249
           E
Sbjct: 300 E 300

>CAGL0G08217g Chr7 complement(778823..779803) [981 bp, 326 aa] {ON}
           similar to uniprot|Q06551 Saccharomyces cerevisiae
           YLR246w ERF2
          Length = 326

 Score = 68.9 bits (167), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 36/53 (67%)

Query: 137 CKTCKVEKPARSKHCAVCDQCILVNDHHCVWVNNCIGRGNXXXXXXXXXDNTL 189
           C TCK+ +P R+ HC+VC+ C+L +DHHC+WVNNC+G+ N          +TL
Sbjct: 160 CHTCKIWRPPRASHCSVCECCVLTHDHHCIWVNNCVGQRNYRYFLAFLLSSTL 212

>Skud_12.321 Chr12 (571368..572438) [1071 bp, 356 aa] {ON} YLR246W
           (REAL)
          Length = 356

 Score = 68.9 bits (167), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 21/40 (52%), Positives = 34/40 (85%)

Query: 137 CKTCKVEKPARSKHCAVCDQCILVNDHHCVWVNNCIGRGN 176
           C++C++ +P R+ HC+ C+ C++V+DHHCVWVNNC+G+ N
Sbjct: 175 CQSCRIWRPPRTSHCSTCNVCVMVHDHHCVWVNNCVGKRN 214

>KAFR0H01980 Chr8 (367846..368931) [1086 bp, 361 aa] {ON} Anc_8.389
           YLR246W
          Length = 361

 Score = 68.9 bits (167), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 19/40 (47%), Positives = 34/40 (85%)

Query: 137 CKTCKVEKPARSKHCAVCDQCILVNDHHCVWVNNCIGRGN 176
           C+TC++ +P R+ HC++C+ C++ +DHHC+W+NNC+G+ N
Sbjct: 178 CRTCRIWRPPRASHCSICEACVMTHDHHCIWINNCVGQRN 217

>YLR246W Chr12 (627118..628197) [1080 bp, 359 aa] {ON}  ERF2Subunit
           of a palmitoyltransferase, composed of Erf2p and Shr5p,
           that adds a palmitoyl lipid moiety to heterolipidated
           substrates such as Ras1p and Ras2p through a thioester
           linkage; mutants partially mislocalize Ras2p to the
           vacuole
          Length = 359

 Score = 68.6 bits (166), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 33/40 (82%)

Query: 137 CKTCKVEKPARSKHCAVCDQCILVNDHHCVWVNNCIGRGN 176
           C +C++ +P RS HC+ C+ C++V+DHHC+WVNNCIG+ N
Sbjct: 175 CPSCRIWRPPRSSHCSTCNVCVMVHDHHCIWVNNCIGKRN 214

>Suva_10.342 Chr10 (593959..595029) [1071 bp, 356 aa] {ON} YLR246W
           (REAL)
          Length = 356

 Score = 68.6 bits (166), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 33/40 (82%)

Query: 137 CKTCKVEKPARSKHCAVCDQCILVNDHHCVWVNNCIGRGN 176
           C +C++ +P RS HC+ C+ C++V+DHHC+WVNNCIG+ N
Sbjct: 175 CTSCRIWRPPRSSHCSTCNICVMVHDHHCIWVNNCIGKRN 214

>ZYRO0C04092g Chr3 complement(320634..321734) [1101 bp, 366 aa] {ON}
           similar to uniprot|Q6B217 Saccharomyces cerevisiae
           YLR246W ERF2 Subunit of a palmitoyltransferase composed
           of Erf2p and Shr5p that adds a palmitoyl lipid moiety to
           Ras2p through a thioester linkage mutants partially
           mislocalize Ras2p to the vacuole
          Length = 366

 Score = 68.6 bits (166), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 32/40 (80%)

Query: 137 CKTCKVEKPARSKHCAVCDQCILVNDHHCVWVNNCIGRGN 176
           C +C++ +P R+ HC+ C+ CIL +DHHC+WVNNCIG+ N
Sbjct: 181 CTSCRIWRPPRASHCSTCEACILTHDHHCIWVNNCIGQRN 220

>TDEL0F05130 Chr6 complement(961887..962966) [1080 bp, 359 aa] {ON}
           Anc_8.389 YLR246W
          Length = 359

 Score = 67.4 bits (163), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 32/114 (28%), Positives = 54/114 (47%), Gaps = 6/114 (5%)

Query: 137 CKTCKVEKPARSKHCAVCDQCILVNDHHCVWVNNCIGRGNXXXXXXXXXDNTLFMSYASM 196
           C +C++ +P R+ HC+ C  C++ +DHHC+WVNNC+G+ N            L    A +
Sbjct: 181 CTSCRIWRPPRASHCSTCGVCVMTHDHHCIWVNNCVGQRNYRYFIIFLIGTVL----AEL 236

Query: 197 RLLE-ITLNFRRAGENVPRDVMTLDILCGCFLFICGTFSYMQLLIVKDGMTTNE 249
            L+   +++  R    VP  ++ L   C   L+      Y  + +     TT E
Sbjct: 237 FLIANCSIHIARRSSQVPVTILLLVYACLSILYPAILLGY-HVFMTGTQQTTRE 289

>KLTH0F08668g Chr6 (750644..751720) [1077 bp, 358 aa] {ON} similar
           to uniprot|Q6B217 Saccharomyces cerevisiae YLR246W ERF2
           Subunit of a palmitoyltransferase composed of Erf2p and
           Shr5p that adds a palmitoyl lipid moiety to Ras2p
           through a thioester linkage mutants partially
           mislocalize Ras2p to the vacuole
          Length = 358

 Score = 67.0 bits (162), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 31/40 (77%)

Query: 137 CKTCKVEKPARSKHCAVCDQCILVNDHHCVWVNNCIGRGN 176
           C TC++ +P R+ HC+ C+ C+L +DHHC WVNNCIG+ N
Sbjct: 178 CATCRIWRPPRASHCSTCEACVLTHDHHCTWVNNCIGQRN 217

>Kwal_23.3302 s23 (234749..235810) [1062 bp, 353 aa] {ON} YLR246W
           (ERF2) - Mutation has an Effect on Ras Function [contig
           251] FULL
          Length = 353

 Score = 66.6 bits (161), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 31/40 (77%)

Query: 137 CKTCKVEKPARSKHCAVCDQCILVNDHHCVWVNNCIGRGN 176
           C TC++ +P R+ HC+VC  CIL +DHHC WVNNCIG+ N
Sbjct: 173 CPTCRIWRPPRASHCSVCGACILNHDHHCKWVNNCIGQRN 212

>SAKL0H13860g Chr8 (1185970..1187028) [1059 bp, 352 aa] {ON} similar
           to uniprot|Q6B217 Saccharomyces cerevisiae YLR246W ERF2
           Subunit of a palmitoyltransferase composed of Erf2p and
           Shr5p that adds a palmitoyl lipid moiety to Ras2p
           through a thioester linkage mutants partially
           mislocalize Ras2p to the vacuole
          Length = 352

 Score = 66.2 bits (160), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 31/40 (77%)

Query: 137 CKTCKVEKPARSKHCAVCDQCILVNDHHCVWVNNCIGRGN 176
           C TC++ +P R+ HC+ C+ CI+ +DHHC WVNNCIG+ N
Sbjct: 172 CTTCRIWRPPRASHCSTCEACIITHDHHCKWVNNCIGQRN 211

>Ecym_4178 Chr4 (375346..376452) [1107 bp, 368 aa] {ON} similar to
           Ashbya gossypii AGL125C
          Length = 368

 Score = 66.2 bits (160), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 29/93 (31%), Positives = 51/93 (54%), Gaps = 5/93 (5%)

Query: 137 CKTCKVEKPARSKHCAVCDQCILVNDHHCVWVNNCIGRGNXXXXXXXXXDNTLFMSYASM 196
           C TC++ +P R+ HC+ C+ CI+  DHHC+WVNNC+G+ N            ++ +  ++
Sbjct: 189 CTTCRIWRPLRASHCSTCNSCIMTFDHHCIWVNNCVGQRNYRYFLTF-----IYSAVLTI 243

Query: 197 RLLEITLNFRRAGENVPRDVMTLDILCGCFLFI 229
            LL I  + R +  +      +L ++C C + I
Sbjct: 244 ILLVINCSVRLSKGSPTAKTPSLLLICYCGVGI 276

>KLTH0C10978g Chr3 complement(905760..906893) [1134 bp, 377 aa] {ON}
           similar to uniprot|Q12006 Saccharomyces cerevisiae
           YOL003C DHHC-CRD protein
          Length = 377

 Score = 64.3 bits (155), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 45/148 (30%), Positives = 63/148 (42%), Gaps = 16/148 (10%)

Query: 137 CKTCKVEKPARSKHCAVCDQCILVNDHHCVWVNNCIGRGNXXXXXXXXXDNTLFMSYASM 196
           CK C   KP R+ HC  C QC+L  DHHC W  NC+G  N            L  SY  +
Sbjct: 80  CKKCDNYKPERTHHCKTCKQCVLSMDHHCPWTMNCVGHNNFPHFVRFLTWVVLTTSYLGL 139

Query: 197 RLLEITLNFRRAGENVPRDVMTLDILCGCFLFICGTFSYMQLLIVK------------DG 244
            L +   +   A  N  + V T ++   CFLF+    +   LL V             +G
Sbjct: 140 LLTQRAFD-HWASRNTRKFVHTSEL---CFLFVNAPLNAFILLTVSLLVFRCVKNQFLNG 195

Query: 245 MTTNEKDKWYTIQCLMEDKKLVKSSDNN 272
           MT  E  +   I+ L  +++LV    +N
Sbjct: 196 MTQIESWEKDRIENLFFNERLVPQLIDN 223

>Kwal_56.22459 s56 (138563..139714) [1152 bp, 383 aa] {ON} YOL003C -
           Hypothetical ORF [contig 185] FULL
          Length = 383

 Score = 63.5 bits (153), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 23/40 (57%), Positives = 27/40 (67%)

Query: 137 CKTCKVEKPARSKHCAVCDQCILVNDHHCVWVNNCIGRGN 176
           C+ CK  KP R+ HC  CDQC+LV DHHC W  NC+G  N
Sbjct: 80  CQKCKTYKPERTHHCKTCDQCVLVMDHHCPWTMNCVGHNN 119

>Smik_15.167 Chr15 complement(289180..290316) [1137 bp, 378 aa] {ON}
           YOL003C (REAL)
          Length = 378

 Score = 62.8 bits (151), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 23/40 (57%), Positives = 28/40 (70%)

Query: 137 CKTCKVEKPARSKHCAVCDQCILVNDHHCVWVNNCIGRGN 176
           CK C+  KP RS HC  C+QC+L+ DHHC W  NC+G GN
Sbjct: 80  CKKCQNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFGN 119

>KLLA0C06204g Chr3 complement(548912..550045) [1134 bp, 377 aa] {ON}
           similar to uniprot|Q12006 Saccharomyces cerevisiae
           YOL003C DHHC- CRD protein
          Length = 377

 Score = 62.8 bits (151), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 27/40 (67%)

Query: 137 CKTCKVEKPARSKHCAVCDQCILVNDHHCVWVNNCIGRGN 176
           CK C+V KP R+ HC  C+QC+L  DHHC W  NC+G  N
Sbjct: 80  CKKCRVYKPERAHHCKTCNQCVLAMDHHCPWTLNCVGHSN 119

>CAGL0E02497g Chr5 complement(241355..242485) [1131 bp, 376 aa] {ON}
           similar to uniprot|Q12006 Saccharomyces cerevisiae
           YOL003c
          Length = 376

 Score = 62.0 bits (149), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 23/40 (57%), Positives = 27/40 (67%)

Query: 137 CKTCKVEKPARSKHCAVCDQCILVNDHHCVWVNNCIGRGN 176
           CK CK  KP RS HC  C+QC+L+ DHHC W  NC+G  N
Sbjct: 80  CKKCKCYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGYNN 119

>KNAG0A02710 Chr1 (294783..295847) [1065 bp, 354 aa] {ON} Anc_8.389
           YLR246W
          Length = 354

 Score = 61.6 bits (148), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 19/40 (47%), Positives = 27/40 (67%)

Query: 137 CKTCKVEKPARSKHCAVCDQCILVNDHHCVWVNNCIGRGN 176
           C  CK+ +P R+ HC +C  C+   DHHC W+NNC+G+ N
Sbjct: 186 CTACKIWRPPRASHCRICQVCVQTQDHHCAWINNCVGQRN 225

>NDAI0C02650 Chr3 (614101..615270) [1170 bp, 389 aa] {ON} Anc_6.28
          Length = 389

 Score = 61.6 bits (148), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 28/43 (65%)

Query: 134 DTECKTCKVEKPARSKHCAVCDQCILVNDHHCVWVNNCIGRGN 176
           +T CK C   KP RS HC  C+QC+L+ DHHC W  NC+G  N
Sbjct: 81  NTHCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGYKN 123

>YOL003C Chr15 complement(321858..322994) [1137 bp, 378 aa] {ON}
           PFA4Palmitoyltransferase with autoacylation activity,
           required for palmitoylation of amino acid permeases
           containing a C-terminal Phe-Trp-Cys site; required for
           modification of Chs3p; member of the DHHC family of
           putative palmitoyltransferases
          Length = 378

 Score = 61.2 bits (147), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 27/40 (67%)

Query: 137 CKTCKVEKPARSKHCAVCDQCILVNDHHCVWVNNCIGRGN 176
           CK C+  KP RS HC  C+QC+L+ DHHC W  NC+G  N
Sbjct: 80  CKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFAN 119

>TDEL0G04410 Chr7 complement(800085..801230) [1146 bp, 381 aa] {ON}
           Anc_6.28 YOL003C
          Length = 381

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 24/62 (38%), Positives = 35/62 (56%)

Query: 115 MYSNDSIKKYAYDRILYFPDTECKTCKVEKPARSKHCAVCDQCILVNDHHCVWVNNCIGR 174
           +Y+N    +  ++   Y     CK C+  KP R+ HC  C+QC+L+ DHHC W  NC+G 
Sbjct: 58  IYTNPGRPRPNFEVPKYEWKNYCKKCQNYKPERAHHCKTCNQCVLMMDHHCPWTMNCVGH 117

Query: 175 GN 176
            N
Sbjct: 118 NN 119

>NCAS0D02140 Chr4 complement(398924..400054) [1131 bp, 376 aa] {ON}
           Anc_6.28
          Length = 376

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 21/40 (52%), Positives = 28/40 (70%)

Query: 137 CKTCKVEKPARSKHCAVCDQCILVNDHHCVWVNNCIGRGN 176
           CK C++ KP R+ HC  C+QC+L+ DHHC W  NC+G  N
Sbjct: 80  CKKCQLFKPERAHHCKTCNQCVLMMDHHCPWTMNCVGFKN 119

>Skud_15.159 Chr15 complement(281485..282624) [1140 bp, 379 aa] {ON}
           YOL003C (REAL)
          Length = 379

 Score = 60.1 bits (144), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 27/40 (67%)

Query: 137 CKTCKVEKPARSKHCAVCDQCILVNDHHCVWVNNCIGRGN 176
           CK C+  KP RS HC  C+QC+L+ DHHC W  NC+G  N
Sbjct: 80  CKKCQSYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFRN 119

>TPHA0P01560 Chr16 (318550..319545) [996 bp, 331 aa] {ON} Anc_3.12
           YNL326C
          Length = 331

 Score = 59.7 bits (143), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 28/40 (70%)

Query: 137 CKTCKVEKPARSKHCAVCDQCILVNDHHCVWVNNCIGRGN 176
           C+TC V KP RS HC+ C++C+L  DHHC W + CIG  N
Sbjct: 110 CRTCNVWKPDRSHHCSTCNRCVLKMDHHCPWFSECIGFKN 149

>Kpol_1037.23 s1037 complement(51397..52533) [1137 bp, 378 aa] {ON}
           complement(51397..52533) [1137 nt, 379 aa]
          Length = 378

 Score = 59.7 bits (143), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 21/40 (52%), Positives = 25/40 (62%)

Query: 137 CKTCKVEKPARSKHCAVCDQCILVNDHHCVWVNNCIGRGN 176
           CK C   KP R+ HC  C QC+L+ DHHC W  NC+G  N
Sbjct: 80  CKKCNAYKPERTHHCKTCQQCVLMMDHHCPWTMNCVGYKN 119

>ZYRO0C07546g Chr3 complement(574411..575544) [1134 bp, 377 aa] {ON}
           similar to uniprot|Q12006 Saccharomyces cerevisiae
           YOL003C DHHC-CRD protein
          Length = 377

 Score = 59.7 bits (143), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 25/37 (67%)

Query: 137 CKTCKVEKPARSKHCAVCDQCILVNDHHCVWVNNCIG 173
           CK C+  KP R+ HC  C+QC+L  DHHC W  NC+G
Sbjct: 80  CKKCRNYKPERAHHCKTCNQCVLAMDHHCPWTKNCVG 116

>Suva_15.172 Chr15 complement(296325..297521) [1197 bp, 398 aa] {ON}
           YOL003C (REAL)
          Length = 398

 Score = 59.7 bits (143), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 27/40 (67%)

Query: 137 CKTCKVEKPARSKHCAVCDQCILVNDHHCVWVNNCIGRGN 176
           CK C+  KP RS HC  C+QC+L+ DHHC W  NC+G  N
Sbjct: 100 CKKCQNYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFKN 139

>NCAS0E01300 Chr5 complement(250120..251103) [984 bp, 327 aa] {ON}
           Anc_3.12
          Length = 327

 Score = 59.3 bits (142), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 23/40 (57%), Positives = 27/40 (67%)

Query: 137 CKTCKVEKPARSKHCAVCDQCILVNDHHCVWVNNCIGRGN 176
           C+TC+V KP R  HC+ CD+CIL  DHHC W   CIG  N
Sbjct: 101 CQTCQVWKPDRCHHCSTCDKCILKMDHHCPWFAECIGFEN 140

>TBLA0H00150 Chr8 complement(13169..14206) [1038 bp, 345 aa] {ON}
           Anc_3.12 YNL326C
          Length = 345

 Score = 59.3 bits (142), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 25/60 (41%), Positives = 33/60 (55%)

Query: 137 CKTCKVEKPARSKHCAVCDQCILVNDHHCVWVNNCIGRGNXXXXXXXXXDNTLFMSYASM 196
           C+TC V KP R  HC+ CD+CIL  DHHC W   CIG  N          N+L+ ++  +
Sbjct: 106 CRTCLVWKPDRCHHCSSCDRCILKMDHHCPWFAECIGFKNHKYFINFLIYNSLYATFVCL 165

>TPHA0J00390 Chr10 (88587..89729) [1143 bp, 380 aa] {ON} Anc_6.28
           YOL003C
          Length = 380

 Score = 59.3 bits (142), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 23/40 (57%), Positives = 26/40 (65%)

Query: 137 CKTCKVEKPARSKHCAVCDQCILVNDHHCVWVNNCIGRGN 176
           CK C   KP RS HC  C+QC+L+ DHHC W  NCIG  N
Sbjct: 80  CKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCIGFNN 119

>KNAG0F02930 Chr6 complement(557052..558212) [1161 bp, 386 aa] {ON}
           Anc_6.28 YOL003C
          Length = 386

 Score = 59.3 bits (142), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 25/40 (62%)

Query: 137 CKTCKVEKPARSKHCAVCDQCILVNDHHCVWVNNCIGRGN 176
           C  C   KP RS HC  C QC+L+ DHHC W  NC+G GN
Sbjct: 82  CAKCNGFKPERSHHCKTCQQCVLMMDHHCPWTMNCLGFGN 121

>KAFR0A05130 Chr1 complement(1019919..1021109) [1191 bp, 396 aa]
           {ON} Anc_6.28 YOL003C
          Length = 396

 Score = 58.9 bits (141), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 22/42 (52%), Positives = 27/42 (64%)

Query: 135 TECKTCKVEKPARSKHCAVCDQCILVNDHHCVWVNNCIGRGN 176
           T CK C   KP R+ HC  C++CIL+ DHHC W  NC+G  N
Sbjct: 79  TYCKKCDAYKPPRAHHCKTCNKCILMMDHHCPWTMNCVGFKN 120

>Kpol_1014.29 s1014 (48992..49972) [981 bp, 326 aa] {ON}
           (48992..49972) [981 nt, 327 aa]
          Length = 326

 Score = 58.2 bits (139), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 26/40 (65%)

Query: 137 CKTCKVEKPARSKHCAVCDQCILVNDHHCVWVNNCIGRGN 176
           C+TC V KP R  HC+ CD+CIL  DHHC W   C+G  N
Sbjct: 106 CRTCNVWKPDRCHHCSACDKCILKMDHHCPWFAECVGFKN 145

>Ecym_3032 Chr3 (63354..64487) [1134 bp, 377 aa] {ON} similar to
           Ashbya gossypii ACL003C
          Length = 377

 Score = 58.2 bits (139), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 41/145 (28%), Positives = 67/145 (46%), Gaps = 9/145 (6%)

Query: 137 CKTCKVEKPARSKHCAVCDQCILVNDHHCVWVNNCIGRGNXXXXXXXXXDNTLFMSYASM 196
           CK C+  KP R+ HC  C QC+LV DHHC +  NC+G  N               +Y S+
Sbjct: 80  CKKCQNFKPERTHHCKTCAQCVLVMDHHCPFTMNCVGYNNFPHFMRFLFWIITTTTYLSI 139

Query: 197 RLLEIT---LNFRRAGENV--PRDVMTLDILCGCFLFICGTFSYMQLLIVK----DGMTT 247
           +  + T    N R +   +   ++++ L IL     F+  T S +    +K    +GMT 
Sbjct: 140 QFFKRTWFVWNIRHSTAQLVTKKEIIFLTILTPANAFVLLTISILFGRCIKNQVLNGMTQ 199

Query: 248 NEKDKWYTIQCLMEDKKLVKSSDNN 272
            E  +   I+ +  +++LV    +N
Sbjct: 200 IEAWEMDRIESMFYNRRLVPQLLSN 224

>ZYRO0C03410g Chr3 (265684..266667) [984 bp, 327 aa] {ON} similar to
           uniprot|P42836 Saccharomyces cerevisiae YNL326C PFA3
           Palmitoyltransferase for Vac8p one of three yeast
           DHHC-cysteine rich domain proteins (Pfa3p Erf2p Akr1p)
           with palmitoyltransferase activity required for vacuolar
           integrity under stress conditions
          Length = 327

 Score = 58.2 bits (139), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 23/40 (57%), Positives = 26/40 (65%)

Query: 137 CKTCKVEKPARSKHCAVCDQCILVNDHHCVWVNNCIGRGN 176
           C+TC V KP R  HC+ CD+CIL  DHHC W   CIG  N
Sbjct: 107 CRTCHVWKPDRCHHCSRCDKCILKMDHHCPWFPGCIGFNN 146

>ACL003C Chr3 complement(352024..353151) [1128 bp, 375 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL003C
          Length = 375

 Score = 58.2 bits (139), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 31/59 (52%)

Query: 115 MYSNDSIKKYAYDRILYFPDTECKTCKVEKPARSKHCAVCDQCILVNDHHCVWVNNCIG 173
           +Y N       +  + Y     C  C+  KP R+ HC  C+QC+LV DHHC W  NC+G
Sbjct: 58  IYKNPGRPTKGFRPLRYEWQNYCTKCETYKPERTHHCKRCNQCVLVMDHHCPWTMNCLG 116

>TDEL0A00310 Chr1 complement(54006..54995) [990 bp, 329 aa] {ON}
           Anc_3.12 YNL326C
          Length = 329

 Score = 57.4 bits (137), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 21/40 (52%), Positives = 28/40 (70%)

Query: 137 CKTCKVEKPARSKHCAVCDQCILVNDHHCVWVNNCIGRGN 176
           C+TC V KP R  HC+ C++CIL  DHHC W+ +C+G  N
Sbjct: 108 CRTCHVWKPDRCHHCSACNRCILRMDHHCPWLPDCVGFRN 147

>Ecym_2014 Chr2 complement(19723..20742) [1020 bp, 339 aa] {ON}
           similar to Ashbya gossypii ADL197C
          Length = 339

 Score = 57.4 bits (137), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 27/40 (67%)

Query: 137 CKTCKVEKPARSKHCAVCDQCILVNDHHCVWVNNCIGRGN 176
           C TC V KP RS HC+ C++C L  DHHC W ++CIG  N
Sbjct: 110 CATCGVWKPDRSHHCSSCNKCYLKRDHHCPWFSSCIGFNN 149

>ADL197C Chr4 complement(350991..352163) [1173 bp, 390 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL326C
          Length = 390

 Score = 57.4 bits (137), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 23/40 (57%), Positives = 25/40 (62%)

Query: 137 CKTCKVEKPARSKHCAVCDQCILVNDHHCVWVNNCIGRGN 176
           C  CKV KP R  HC+ CD+C L  DHHCVW   CIG  N
Sbjct: 171 CVKCKVWKPDRCHHCSACDKCYLRRDHHCVWFPGCIGYNN 210

>NDAI0G01340 Chr7 (301254..302261) [1008 bp, 335 aa] {ON} Anc_3.12
          Length = 335

 Score = 57.4 bits (137), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 27/40 (67%)

Query: 137 CKTCKVEKPARSKHCAVCDQCILVNDHHCVWVNNCIGRGN 176
           C+TC+V KP R  HC+ C++CIL  DHHC W   CIG  N
Sbjct: 109 CQTCQVWKPDRCHHCSTCNKCILKMDHHCPWFAECIGFKN 148

>SAKL0C13596g Chr3 (1198957..1199958) [1002 bp, 333 aa] {ON} similar
           to uniprot|P42836 Saccharomyces cerevisiae YNL326C PFA3
           Palmitoyltransferase for Vac8p one of three yeast
           DHHC-cysteine rich domain proteins (Pfa3p Erf2p Akr1p)
           with palmitoyltransferase activity required for vacuolar
           integrity under stress conditions
          Length = 333

 Score = 57.4 bits (137), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 27/40 (67%)

Query: 137 CKTCKVEKPARSKHCAVCDQCILVNDHHCVWVNNCIGRGN 176
           C+ CKV KP RS HC+ C++C L  DHHC W  +CIG  N
Sbjct: 105 CRNCKVWKPDRSHHCSSCNKCFLKMDHHCPWFASCIGFKN 144

>KNAG0K02570 Chr11 (511867..512853) [987 bp, 328 aa] {ON} Anc_3.12
           YNL326C
          Length = 328

 Score = 56.6 bits (135), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 27/40 (67%)

Query: 137 CKTCKVEKPARSKHCAVCDQCILVNDHHCVWVNNCIGRGN 176
           C++C+  KP R  HC+ CD+CIL  DHHC W+  C+G  N
Sbjct: 103 CQSCRYWKPDRCHHCSSCDRCILKMDHHCPWIAGCVGFRN 142

>SAKL0E01518g Chr5 (113669..114808) [1140 bp, 379 aa] {ON} similar
           to uniprot|Q12006 Saccharomyces cerevisiae YOL003C
           DHHC-CRD protein
          Length = 379

 Score = 56.2 bits (134), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 24/40 (60%)

Query: 137 CKTCKVEKPARSKHCAVCDQCILVNDHHCVWVNNCIGRGN 176
           C  C   KP R+ HC  C+QC+L  DHHC W  NC+G  N
Sbjct: 80  CNKCNNYKPERAHHCKACNQCVLSMDHHCPWTMNCVGHRN 119

>KLTH0F19580g Chr6 (1586776..1587804) [1029 bp, 342 aa] {ON} similar
           to uniprot|P42836 Saccharomyces cerevisiae YNL326C PFA3
           Palmitoyltransferase for Vac8p one of three yeast
           DHHC-cysteine rich domain proteins (Pfa3p Erf2p Akr1p)
           with palmitoyltransferase activity required for vacuolar
           integrity under stress conditions
          Length = 342

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 19/40 (47%), Positives = 24/40 (60%)

Query: 137 CKTCKVEKPARSKHCAVCDQCILVNDHHCVWVNNCIGRGN 176
           C+ C V KP R  HC+ C +C L  DHHC W  +C+G  N
Sbjct: 106 CRVCAVWKPDRCHHCSACKKCFLKMDHHCPWFASCVGYAN 145

>KAFR0A08590 Chr1 (1722408..1723403) [996 bp, 331 aa] {ON} Anc_3.12
           YNL326C
          Length = 331

 Score = 54.3 bits (129), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 21/40 (52%), Positives = 25/40 (62%)

Query: 137 CKTCKVEKPARSKHCAVCDQCILVNDHHCVWVNNCIGRGN 176
           C+TC   KP R  HC+ C++CIL  DHHC W   CIG  N
Sbjct: 106 CQTCMFWKPDRCHHCSSCNRCILKMDHHCPWFAECIGFKN 145

>Kwal_55.22126 s55 (1121936..1123018) [1083 bp, 360 aa] {ON} YNL326C
           - Hypothetical ORF [contig 124] FULL
          Length = 360

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 49/195 (25%), Positives = 79/195 (40%), Gaps = 45/195 (23%)

Query: 137 CKTCKVEKPARSKHCAVCDQCILVNDHHCVWVNNCIGRGNXXXXXXXXXDNT------LF 190
           C+TC V KP R  HC+ C++C L  DHHC W  +C+G  N           T       F
Sbjct: 133 CRTCVVWKPDRCHHCSGCNKCYLKMDHHCPWFASCVGYRNQKYFIHFLLYTTAYSILVFF 192

Query: 191 MSYASMRLLEITLNFRRAGENVPRDVMTLDILCGCFLFICGTFSYMQLLIVKDGMTTNEK 250
           ++ A     ++ + FR  G N  ++++ L +L    L +  T S +              
Sbjct: 193 LTGA-----DLLMWFRSQGYN--QELINLPLLIVWILSLVITISMLAFTS---------- 235

Query: 251 DKWYTIQCLMEDKKLVKSSDNNWYISFVNDQGETEFYSTNAYDHKKYQLTEYKVIDNVED 310
              YTI  + +                  +Q   E Y    Y +++  + E + +D  ED
Sbjct: 236 ---YTIYLVAK------------------NQTTIEMYEWTNYRNQRNIMDEVRGLDTFED 274

Query: 311 IPNIYDKGSLWKNFK 325
             N++D GS   N+K
Sbjct: 275 -KNVFDLGSPLLNWK 288

>KLLA0E02069g Chr5 complement(195185..196162) [978 bp, 325 aa] {ON}
           weakly similar to uniprot|P42836 Saccharomyces
           cerevisiae YNL326C PFA3 Palmitoyltransferase for Vac8p
           one of three yeast DHHC-cysteine rich domain proteins
           (Pfa3p Erf2p Akr1p) with palmitoyltransferase activity
           required for vacuolar integrity under stress conditions
          Length = 325

 Score = 53.5 bits (127), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 32/125 (25%), Positives = 55/125 (44%), Gaps = 4/125 (3%)

Query: 137 CKTCKVEKPARSKHCAVCDQCILVNDHHCVWVNNCIGRGNXXXXXXXXXDNTLFMSYA-- 194
           C+TC++ KP R  HC+ C++C L  DHHC W  +C+G  N           T++  Y   
Sbjct: 105 CQTCEIWKPDRCHHCSKCNKCFLKMDHHCPWFASCVGFRNQKFFVQFLAYTTVYSLYVLL 164

Query: 195 --SMRLLEITLNFRRAGENVPRDVMTLDILCGCFLFICGTFSYMQLLIVKDGMTTNEKDK 252
             S +L       +   E +   ++ + +L          F+   + +V    TT E+ +
Sbjct: 165 MTSAQLYSWFRQMKYKSELLDLHLLVVWVLSVIAAIATFAFTTYTIWLVTKNETTIEQYE 224

Query: 253 WYTIQ 257
           W  I+
Sbjct: 225 WGNIR 229

>Suva_14.15 Chr14 complement(23560..24552) [993 bp, 330 aa] {ON}
           YNL326C (REAL)
          Length = 330

 Score = 53.5 bits (127), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 21/40 (52%), Positives = 23/40 (57%)

Query: 137 CKTCKVEKPARSKHCAVCDQCILVNDHHCVWVNNCIGRGN 176
           C+ C V KP R  HC+ CD CIL  DHHC W   C G  N
Sbjct: 106 CQICHVWKPDRCHHCSSCDMCILKMDHHCPWFAECTGFKN 145

>Skud_14.15 Chr14 complement(20841..21851) [1011 bp, 336 aa] {ON}
           YNL326C (REAL)
          Length = 336

 Score = 52.4 bits (124), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 21/40 (52%), Positives = 23/40 (57%)

Query: 137 CKTCKVEKPARSKHCAVCDQCILVNDHHCVWVNNCIGRGN 176
           C+ C V KP R  HC+ CD CIL  DHHC W   C G  N
Sbjct: 106 CQICHVWKPDRCHHCSSCDICILKMDHHCPWFAECTGFKN 145

>CAGL0D02508g Chr4 (256760..257758) [999 bp, 332 aa] {ON} similar to
           uniprot|P42836 Saccharomyces cerevisiae YNL326c
          Length = 332

 Score = 52.4 bits (124), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 19/40 (47%), Positives = 24/40 (60%)

Query: 137 CKTCKVEKPARSKHCAVCDQCILVNDHHCVWVNNCIGRGN 176
           CK+C   KP R  HC+ C+ C+L  DHHC W   C+G  N
Sbjct: 106 CKSCSSWKPDRCHHCSTCNVCVLKMDHHCPWFAGCVGYRN 145

>YNL326C Chr14 complement(27337..28347) [1011 bp, 336 aa] {ON}
           PFA3Palmitoyltransferase for Vac8p, required for
           vacuolar membrane fusion; contains an
           Asp-His-His-Cys-cysteine rich (DHHC-CRD) domain;
           autoacylates; required for vacuolar integrity under
           stress conditions
          Length = 336

 Score = 52.0 bits (123), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 21/40 (52%), Positives = 23/40 (57%)

Query: 137 CKTCKVEKPARSKHCAVCDQCILVNDHHCVWVNNCIGRGN 176
           C+ C V KP R  HC+ CD CIL  DHHC W   C G  N
Sbjct: 106 CQVCHVWKPDRCHHCSSCDVCILKMDHHCPWFAECTGFRN 145

>Smik_14.6 Chr14 complement(11864..12868) [1005 bp, 334 aa] {ON}
           YNL326C (REAL)
          Length = 334

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 23/40 (57%)

Query: 137 CKTCKVEKPARSKHCAVCDQCILVNDHHCVWVNNCIGRGN 176
           C+ C V KP R  HC+ CD C+L  DHHC W   C G  N
Sbjct: 106 CQVCHVWKPDRCHHCSSCDICVLKMDHHCPWFAECTGFKN 145

>TBLA0B00480 Chr2 (93291..94424) [1134 bp, 377 aa] {ON} Anc_6.28
           YOL003C
          Length = 377

 Score = 45.8 bits (107), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 22/45 (48%), Positives = 28/45 (62%)

Query: 132 FPDTECKTCKVEKPARSKHCAVCDQCILVNDHHCVWVNNCIGRGN 176
           FP T CK CK  K  R+ HC  C+ C+++ DHHC W  NC+G  N
Sbjct: 85  FPTTTCKKCKKIKLPRAHHCKTCNTCVVMMDHHCPWTMNCVGYTN 129

>Kpol_1004.57 s1004 complement(123368..124456) [1089 bp, 362 aa]
           {ON} complement(123368..124456) [1089 nt, 363 aa]
          Length = 362

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 51/195 (26%), Positives = 77/195 (39%), Gaps = 33/195 (16%)

Query: 137 CKTCKVEKPARSKHCAVCDQCILVNDHHCVWVNNCIGRGNXXXXXXXXXDNTLFMSYASM 196
           C TCK  K  R+ H      CI   DHHC+WV   IG+ N           T F+ Y S 
Sbjct: 124 CDTCKSLKIGRTHHSKRLGYCIPRFDHHCMWVGTVIGKSNYLLF-------TQFVFYFSC 176

Query: 197 RLLEI---TLNFRRAGENVPRDVMTLDILCGCFLFICGTFSYMQL-LIVKDGMTTNEKDK 252
            LL      +++ +   + P     LD      L +   FS M L L +     T     
Sbjct: 177 LLLIFWISIVSYIKRIVDYPHTGYKLDPNLIVILILSVPFSIMTLSLFLSHVYFTFMNRT 236

Query: 253 WYTIQCLMEDKKL-VKSSDNNWYISFVNDQGETEFYSTNAYDHKKYQLTEYKVIDNVEDI 311
              I  +  +KKL +K      ++ +++                K     Y +  + ED+
Sbjct: 237 SLEIINIKRNKKLNIKK-----FVCYLD----------------KTSGNRYVIEMSPEDM 275

Query: 312 PNIYDKGSLWKNFKD 326
            NI+ K S+W+NFK+
Sbjct: 276 ANIWKKRSIWENFKE 290

>KNAG0C02830 Chr3 complement(563740..564804) [1065 bp, 354 aa] {ON}
           Anc_5.579 YDR459C
          Length = 354

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 27/102 (26%), Positives = 41/102 (40%), Gaps = 6/102 (5%)

Query: 135 TECKTCKVEKPARSKHCAVCDQCILVNDHHCVWVNNCIGRGNXXX--XXXXXXDNTLFMS 192
           T C  C+  K  R+ H      C+   DH+C W+   IG GN           D  L + 
Sbjct: 124 TWCAHCQSVKSLRTHHSGRTGSCVFKFDHYCGWLGTLIGAGNYLLFIQFLVYMDCLLLIM 183

Query: 193 YASMRLLEITLNFRRAGENVPRDVMTLDILCGCFLFICGTFS 234
           + SM        FRR G  +   ++++     C LF+ G  +
Sbjct: 184 WISMSPFIRVYTFRRDGNLIAIYILSV----WCSLFVTGLLT 221

>KLTH0G04972g Chr7 complement(404787..405890) [1104 bp, 367 aa] {ON}
           similar to uniprot|Q03289 Saccharomyces cerevisiae
           YDR459C likely functions in pathway(s) outside Ras
          Length = 367

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 40/194 (20%), Positives = 75/194 (38%), Gaps = 30/194 (15%)

Query: 137 CKTCKVEKPARSKHCAVCDQCILVNDHHCVWVNNCIGRGNXXXXXXXXXDNTLFMSYASM 196
           C  C+  K  R+ H +    CI   DH+CVW+   +GR N             F  +  +
Sbjct: 132 CTACQSIKANRTHHSSTLGYCIPRFDHYCVWIGTVVGRKNYRLFVQFAFYFWAFAIFVIV 191

Query: 197 RLLEITLNFRRAGENVPR---DVMTLDILCGCFLFICGTFSYMQLLIVKDGMTTNEKDKW 253
                     R+  +VPR   +++ +  LCG    + G         +    T+ E    
Sbjct: 192 STASFLPKIIRSQPHVPRVNPNILIMMGLCGMATLMVGPLFLAHTYYMMVNRTSLE---- 247

Query: 254 YTIQCLMEDKKLVKSSDNNWYISFVNDQGETEFYSTNAYDHKKYQLTEYKVIDNVEDIPN 313
                ++  K+  +++ N W   +            NA D  +Y + E+K +    +  +
Sbjct: 248 -----IIATKRRSRAT-NTWLCYY------------NAVDGIRY-VFEFKAL----EAQD 284

Query: 314 IYDKGSLWKNFKDF 327
            ++K ++W N K+F
Sbjct: 285 FWNKRNIWTNLKEF 298

>Ecym_4114 Chr4 complement(238112..239230) [1119 bp, 372 aa] {ON}
           similar to Ashbya gossypii ABR203W
          Length = 372

 Score = 42.7 bits (99), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 49/194 (25%), Positives = 78/194 (40%), Gaps = 29/194 (14%)

Query: 137 CKTCKVEKPARSKHCAVCDQCILVNDHHCVWVNNCIGRGNXXXXXXXXXDNTLFMSYASM 196
           C TC+  K  RS H  +   C+   DH+CVW+   IGR N           T+++  AS 
Sbjct: 127 CSTCQSLKIERSHHSELLKYCVPRFDHYCVWLGTVIGRKNYKLFMQYVMYFTIYLVTAS- 185

Query: 197 RLLEITLNFRRAGE-NVPRDV-MTLDILCGCFLFICGTFSYMQLLIVKDGMTTNEKDKWY 254
             L I L  +R  + N   D+ + L+I+    L +   F    L  V     +  +    
Sbjct: 186 --LTIALFMKRIVDYNKEHDLTLNLNIIVLFILVLAFAFFVTPLFAVFSFYMSCNRTSLD 243

Query: 255 TIQCLMEDKKLVKSSDNNWYISFVNDQGETEFYSTNAYDHKKYQLTEYKVIDNV-EDIPN 313
            IQ     KK +K     ++  +            N  D  +Y      V+D +  +  N
Sbjct: 244 IIQ-----KKAIKRHRKAYFCVY------------NPEDRYRY------VVDCLPAEQYN 280

Query: 314 IYDKGSLWKNFKDF 327
           I++K + W N K+F
Sbjct: 281 IWNKRNAWLNIKEF 294

>Kwal_47.18366 s47 (796220..797290) [1071 bp, 356 aa] {ON} YDR459C -
           Hypothetical ORF [contig 196] FULL
          Length = 356

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/100 (23%), Positives = 39/100 (39%), Gaps = 3/100 (3%)

Query: 137 CKTCKVEKPARSKHCAVCDQCILVNDHHCVWVNNCIGRGNXXXXXXXXXDNTLFMSYASM 196
           C  C+  K  R+ H +    CI   DH+CVW+   +GR N            LF  Y   
Sbjct: 125 CTACQSLKSNRTHHSSTLGYCIPRFDHYCVWIGTIVGRKNYRLFVQFAFYFWLFTIYMIA 184

Query: 197 RLLEITLNFRRAGENVPR---DVMTLDILCGCFLFICGTF 233
            +        ++   +PR   +++ +  LC   + + G  
Sbjct: 185 SIASFLRRIIKSRSQIPRVNPNILVVLALCCMAMLMVGPL 224

>KAFR0I01110 Chr9 (214426..215538) [1113 bp, 370 aa] {ON} Anc_5.579
           YDR459C
          Length = 370

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 23/40 (57%)

Query: 137 CKTCKVEKPARSKHCAVCDQCILVNDHHCVWVNNCIGRGN 176
           C  C+  K  RS H +V + CI   DH+C+W+   IG+ N
Sbjct: 119 CSNCEGLKSLRSHHSSVANYCIPRFDHYCIWLGTTIGKDN 158

>Smik_4.737 Chr4 complement(1303557..1304693) [1137 bp, 378 aa] {ON}
           YDR459C (REAL)
          Length = 378

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 17/40 (42%), Positives = 21/40 (52%)

Query: 137 CKTCKVEKPARSKHCAVCDQCILVNDHHCVWVNNCIGRGN 176
           C  C+  K  RS H +    CI   DH+CVW+   IGR N
Sbjct: 131 CSPCQSLKMERSHHSSELGHCIPRFDHYCVWIGTIIGRDN 170

>TBLA0E02830 Chr5 (700364..701524) [1161 bp, 386 aa] {ON} Anc_5.579
           YDR459C
          Length = 386

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 25/42 (59%), Gaps = 3/42 (7%)

Query: 135 TECKTCKVEKPARSKHCAVCDQCILVNDHHCVWVNNCIGRGN 176
           +EC++ K+E   R+ H +    C+   DH+CVWV   IG+ N
Sbjct: 124 SECQSLKLE---RTHHSSAMGHCVPRFDHYCVWVGTVIGKDN 162

>NCAS0F01390 Chr6 complement(275879..277003) [1125 bp, 374 aa] {ON}
           Anc_5.579 YDR459C
          Length = 374

 Score = 39.7 bits (91), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 28/60 (46%), Gaps = 2/60 (3%)

Query: 117 SNDSIKKYAYDRILYFPDTECKTCKVEKPARSKHCAVCDQCILVNDHHCVWVNNCIGRGN 176
           S    K Y  D+  Y P   C  C+  K +RS H     +CIL  DH+C W+   I R N
Sbjct: 100 STKPPKYYQCDKNGYPP--WCTHCQSLKLSRSHHSKQVGRCILRFDHYCAWIGCVIARNN 157

>SAKL0G06160g Chr7 complement(514850..515944) [1095 bp, 364 aa] {ON}
           similar to uniprot|Q03289 Saccharomyces cerevisiae
           YDR459C likely functions in pathway(s) outside Ras
          Length = 364

 Score = 39.7 bits (91), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 21/40 (52%)

Query: 137 CKTCKVEKPARSKHCAVCDQCILVNDHHCVWVNNCIGRGN 176
           C  C+  K  R+ H A    C+   DH+CVW+   +GR N
Sbjct: 127 CSMCQSLKMERTHHSATLGYCVPRFDHYCVWIGTVVGRKN 166

>YDR459C Chr4 complement(1382319..1383443) [1125 bp, 374 aa] {ON}
           PFA5Palmitoyltransferase with autoacylation activity;
           likely functions in pathway(s) outside Ras; member of a
           family of putative palmitoyltransferases containing an
           Asp-His-His-Cys-cysteine rich (DHHC-CRD) domain
          Length = 374

 Score = 38.5 bits (88), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 21/40 (52%)

Query: 137 CKTCKVEKPARSKHCAVCDQCILVNDHHCVWVNNCIGRGN 176
           C  C+  K  R+ H +    CI   DH+C+W+   IGR N
Sbjct: 131 CSECQSLKMERTHHSSELGHCIPRFDHYCMWIGTVIGRDN 170

>Skud_4.734 Chr4 complement(1302386..1303528) [1143 bp, 380 aa] {ON}
           YDR459C (REAL)
          Length = 380

 Score = 38.1 bits (87), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 36/92 (39%), Gaps = 18/92 (19%)

Query: 137 CKTCKVEKPARSKHCAVCDQCILVNDHHCVWVNNCIGRGNXXXXXXXXXDNTLFMSYASM 196
           C  C+  K  R+ H +    C+   DH+C+W    IGR N             F++Y S+
Sbjct: 132 CSPCQSLKTERTHHSSELGHCVPRFDHYCMWAGTVIGRDNYRLFVQ-------FVAYFSI 184

Query: 197 RLL-----------EITLNFRRAGENVPRDVM 217
            LL           EIT      G  +  +VM
Sbjct: 185 LLLIMWASICVYTKEITQRHHSQGPRINVNVM 216

>Suva_2.634 Chr2 complement(1134492..1135658) [1167 bp, 388 aa] {ON}
           YDR459C (REAL)
          Length = 388

 Score = 37.7 bits (86), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 21/40 (52%)

Query: 137 CKTCKVEKPARSKHCAVCDQCILVNDHHCVWVNNCIGRGN 176
           C  C+  K  R+ H +    C+   DH+C+WV   IGR N
Sbjct: 137 CSPCQSLKMERTHHSSELGHCVPRFDHYCLWVGTVIGRDN 176

>KLLA0D06149g Chr4 (527705..528754) [1050 bp, 349 aa] {ON} similar
           to uniprot|Q03289 Saccharomyces cerevisiae YDR459C
           likely functions in pathway(s) outside Ras
          Length = 349

 Score = 37.4 bits (85), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 23/98 (23%), Positives = 39/98 (39%), Gaps = 5/98 (5%)

Query: 137 CKTCKVEKPARSKHCAVCDQCILVNDHHCVWVNNCIGRGNXXXXXXXXXDNTLFMSYASM 196
           C  C+  K +R+ H      C+   DH+CVW+   +GR N           T ++    +
Sbjct: 128 CSNCQSLKMSRTHHSTKVGYCVPRFDHYCVWIGTVLGRLNYKLFVQF----TFYLDLVVL 183

Query: 197 RLL-EITLNFRRAGENVPRDVMTLDILCGCFLFICGTF 233
            L+  I    R+   +   +V  +  L  C L + G  
Sbjct: 184 ILMISIATQMRQMKGSANGNVYAVFALACCALLMAGPL 221

>CAGL0K06347g Chr11 complement(624046..625104) [1059 bp, 352 aa]
           {ON} similar to uniprot|Q03289 Saccharomyces cerevisiae
           YDR459c
          Length = 352

 Score = 36.2 bits (82), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 21/40 (52%)

Query: 137 CKTCKVEKPARSKHCAVCDQCILVNDHHCVWVNNCIGRGN 176
           C  C+  K  R+KH +    C+   DH+CVW+   IG  N
Sbjct: 116 CSNCQSLKVGRTKHSSHQGHCVPRFDHYCVWLGAVIGFKN 155

>NDAI0H01890 Chr8 complement(458111..459331) [1221 bp, 406 aa] {ON}
           Anc_5.579 YDR459C
          Length = 406

 Score = 36.2 bits (82), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 18/40 (45%)

Query: 137 CKTCKVEKPARSKHCAVCDQCILVNDHHCVWVNNCIGRGN 176
           C  C+  K  R  H      CI   DH+C W+   IGR N
Sbjct: 117 CTYCQSLKLERVHHSRQLGYCIFRFDHYCAWIGTVIGRNN 156

>ABR203W Chr2 (782704..783783) [1080 bp, 359 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR459C
          Length = 359

 Score = 35.8 bits (81), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 20/40 (50%)

Query: 137 CKTCKVEKPARSKHCAVCDQCILVNDHHCVWVNNCIGRGN 176
           C  C+  K  R+ H      C+   DH+CVW+   IGR N
Sbjct: 122 CSVCQSLKGLRTHHSVHLGFCVPRLDHYCVWLGTVIGRRN 161

>TDEL0A04440 Chr1 complement(795121..796218) [1098 bp, 365 aa] {ON}
           Anc_5.579 YDR459C
          Length = 365

 Score = 35.4 bits (80), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 19/40 (47%)

Query: 137 CKTCKVEKPARSKHCAVCDQCILVNDHHCVWVNNCIGRGN 176
           C  C   K  R+ H +  + C+   DH C W+   IGR N
Sbjct: 127 CSACDSVKTERAHHSSDMEYCVPRFDHKCAWLGAVIGRDN 166

>CAGL0M08712g Chr13 (866454..868745) [2292 bp, 763 aa] {ON} similar
           to uniprot|P39010 Saccharomyces cerevisiae YDR264c
           ankyrin repeat-containing protein
          Length = 763

 Score = 35.0 bits (79), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 17/40 (42%), Positives = 22/40 (55%)

Query: 137 CKTCKVEKPARSKHCAVCDQCILVNDHHCVWVNNCIGRGN 176
           C    V KP RSK+  + D  IL  DH+C W+ N +G  N
Sbjct: 456 CLETWVRKPLRSKYSYLNDALILRFDHYCPWIYNDVGLKN 495

>ZYRO0D13860g Chr4 complement(1171732..1172829) [1098 bp, 365 aa]
           {ON} similar to uniprot|Q03289 Saccharomyces cerevisiae
           YDR459C likely functions in pathway(s) outside Ras
          Length = 365

 Score = 33.9 bits (76), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 25/112 (22%), Positives = 48/112 (42%), Gaps = 5/112 (4%)

Query: 137 CKTCKVEKPARSKHCAVCDQCILVNDHHCVWVNNCIGRGNXXXXXXXXXDNTLFMSYASM 196
           C  C+  K  R+ H      C+   DH C ++ + IG+ N           T++++    
Sbjct: 127 CTNCQSLKTERAHHSRELGHCVPKFDHKCTYLGSIIGKDNYRLFVQYCVFMTIWLAIIWT 186

Query: 197 RLL----EITLNFRRAGENVPRDVMTLDILCGCFLFICGTFSYMQL-LIVKD 243
            ++     IT ++R  G ++  +++ + IL   F     +    QL  IVK+
Sbjct: 187 SIVAYIRSITRDYRGHGSHLNGNLIAILILTTLFWITVTSLLLTQLNCIVKN 238

>ZYRO0C11132g Chr3 complement(861388..863667) [2280 bp, 759 aa] {ON}
           similar to uniprot|P39010 Saccharomyces cerevisiae
           YDR264C AKR1 Palmitoyl transferase involved in protein
           palmitoylation acts as a negative regulator of pheromone
           response pathway required for endocytosis of pheromone
           receptors involved in cell shape control contains
           ankyrin repeats
          Length = 759

 Score = 33.1 bits (74), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 22/40 (55%)

Query: 137 CKTCKVEKPARSKHCAVCDQCILVNDHHCVWVNNCIGRGN 176
           C    V+KP RS+  ++ +  +   DH+C WV N IG  N
Sbjct: 464 CIETWVKKPLRSRFSSLSNSLVARFDHYCPWVYNDIGLRN 503

>KAFR0H00570 Chr8 (100639..102912) [2274 bp, 757 aa] {ON} Anc_5.626
           YOR034C
          Length = 757

 Score = 32.0 bits (71), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 33/76 (43%), Gaps = 6/76 (7%)

Query: 107 LINPDTALMYSNDSIK--KYAYDRILYFP--DTE--CKTCKVEKPARSKHCAVCDQCILV 160
           LI  D  L+ SND  +  +     +L     DT   C    + KP RSK     +  +  
Sbjct: 427 LIKSDPGLIPSNDDHEEIRNVIQELLSIGKFDTRNFCIETWIRKPLRSKFSTFYNSTVSR 486

Query: 161 NDHHCVWVNNCIGRGN 176
            DH+C WV N IG  N
Sbjct: 487 FDHYCPWVYNDIGLKN 502

>Kpol_526.32 s526 complement(77926..80259) [2334 bp, 777 aa] {ON}
           complement(77926..80259) [2334 nt, 778 aa]
          Length = 777

 Score = 32.0 bits (71), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 32/64 (50%), Gaps = 3/64 (4%)

Query: 116 YSNDSIKKYAYDRILYFP-DTE--CKTCKVEKPARSKHCAVCDQCILVNDHHCVWVNNCI 172
           +++DSI++   + +L    DT   C    V KP RS++  +    +   DH C W+ N I
Sbjct: 455 FNHDSIRETITNLMLIGKFDTNNFCIESSVRKPLRSRYSYLNSAIVTRFDHFCPWIYNDI 514

Query: 173 GRGN 176
           G  N
Sbjct: 515 GLKN 518

>Smik_4.515 Chr4 complement(928882..931176) [2295 bp, 764 aa] {ON}
           YDR264C (REAL)
          Length = 764

 Score = 31.6 bits (70), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 13/40 (32%), Positives = 21/40 (52%)

Query: 137 CKTCKVEKPARSKHCAVCDQCILVNDHHCVWVNNCIGRGN 176
           C      KP RSK+ ++ +  +   DH+C W+ N +G  N
Sbjct: 472 CIETWTRKPLRSKYSSLNNAVVARFDHYCPWIFNDVGLKN 511

>YDR264C Chr4 complement(996029..998323) [2295 bp, 764 aa] {ON}
           AKR1Palmitoyl transferase involved in protein
           palmitoylation; acts as a negative regulator of
           pheromone response pathway; required for endocytosis of
           pheromone receptors; involved in cell shape control;
           contains ankyrin repeats
          Length = 764

 Score = 30.8 bits (68), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 13/40 (32%), Positives = 20/40 (50%)

Query: 137 CKTCKVEKPARSKHCAVCDQCILVNDHHCVWVNNCIGRGN 176
           C    + KP RSK   + +  +   DH+C W+ N +G  N
Sbjct: 472 CIETWIRKPLRSKFSPLNNAVVARFDHYCPWIFNDVGLKN 511

>TDEL0A04920 Chr1 complement(867970..870222) [2253 bp, 750 aa] {ON}
           Anc_5.626 YOR034C
          Length = 750

 Score = 30.8 bits (68), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 13/40 (32%), Positives = 20/40 (50%)

Query: 137 CKTCKVEKPARSKHCAVCDQCILVNDHHCVWVNNCIGRGN 176
           C    + KP RS+  ++    I   DH+C W+ N +G  N
Sbjct: 462 CIESWIRKPLRSRFSSLNGTLIARFDHYCPWIYNDVGLKN 501

>Skud_4.527 Chr4 complement(938779..941073) [2295 bp, 764 aa] {ON}
           YDR264C (REAL)
          Length = 764

 Score = 30.4 bits (67), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 13/40 (32%), Positives = 20/40 (50%)

Query: 137 CKTCKVEKPARSKHCAVCDQCILVNDHHCVWVNNCIGRGN 176
           C      KP RSK  ++ +  +   DH+C W+ N +G  N
Sbjct: 472 CIETWTRKPLRSKFSSLNNAVVARFDHYCPWIFNDVGLKN 511

>SAKL0C05918g Chr3 complement(558911..561538) [2628 bp, 875 aa] {ON}
           similar to uniprot|Q75BN0 Ashbya gossypii ACR241C
           ACR241Cp and weakly similar to YKR064W uniprot|P36023
           Saccharomyces cerevisiae YKR064W Hypothetical ORF
          Length = 875

 Score = 30.4 bits (67), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 13/44 (29%), Positives = 19/44 (43%), Gaps = 1/44 (2%)

Query: 133 PDTECKTCKVEKPARSKHCAVCDQCILVNDHH-CVWVNNCIGRG 175
           P   C  CK  K    K    C  C+ + D   C ++N  +G+G
Sbjct: 9   PTVVCSNCKRRKSKCDKQKPACSNCVRLGDEATCTYLNEPVGKG 52

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.326    0.141    0.458 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 35,193,493
Number of extensions: 1501968
Number of successful extensions: 5168
Number of sequences better than 10.0: 111
Number of HSP's gapped: 5209
Number of HSP's successfully gapped: 114
Length of query: 329
Length of database: 53,481,399
Length adjustment: 110
Effective length of query: 219
Effective length of database: 40,868,139
Effective search space: 8950122441
Effective search space used: 8950122441
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 66 (30.0 bits)