Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0D033008.850ON48048025860.0
TBLA0B029008.850ON52046012441e-167
YMR285C (NGL2)8.850ON51546112341e-166
TDEL0B001908.850ON49246112211e-164
Smik_13.5018.850ON51546112161e-163
Kpol_237.18.850ON50346112071e-162
Skud_13.4588.850ON51446111971e-160
ABL118W8.850ON50447011951e-160
NDAI0K003708.850ON56846211971e-159
KLTH0C03608g8.850ON49546011801e-158
Suva_13.4758.850ON51546111721e-156
ZYRO0C14872g8.850ON49644711641e-155
CAGL0I02684g8.850ON49346211611e-155
NCAS0C003108.850ON55646411581e-154
KNAG0K006508.850ON48247311451e-153
TPHA0I003208.850ON52945011441e-152
NCAS0B002708.850ON47646511341e-151
SAKL0D01166g8.850ON50544311351e-151
KAFR0L019608.850ON51146311161e-148
NDAI0E002608.850ON49847611051e-146
KLLA0C06248g8.850ON51646311051e-146
Kwal_27.102048.850ON49444210831e-143
Ecym_46198.850ON48743110801e-143
CAGL0B02387g8.850ON4714689371e-121
Suva_13.258.850ON5024789181e-118
Smik_13.168.850ON5024559151e-118
KAFR0A028608.850ON4784709001e-116
YML118W (NGL3)8.850ON5054838991e-115
Skud_13.238.850ON4984768691e-111
KNAG0G034708.850ON4664778241e-105
KAFR0K006707.78ON7952341938e-15
Kwal_26.71127.78ON7423471857e-14
CAGL0H06149g7.78ON8732401831e-13
NDAI0H025207.78ON8983381812e-13
KNAG0D048407.78ON7792421803e-13
Ecym_73547.78ON7852481803e-13
SAKL0B10032g7.78ON7312431794e-13
KLTH0D02310g7.78ON7392471769e-13
Kpol_1040.147.78ON7842441761e-12
Skud_1.407.78ON8693381742e-12
TPHA0H026807.78ON8723361723e-12
TBLA0A046607.78ON8962821723e-12
ACR288W7.78ON7362311671e-11
Suva_1.457.78ON8312361662e-11
NCAS0F016407.78ON8552361581e-10
ZYRO0D05302g7.78ON8572441572e-10
Smik_1.457.78ON8393371563e-10
YAL021C (CCR4)7.78ON8373381544e-10
ACR277C7.90ON3782861481e-09
CAGL0F01001g7.90ON3592391462e-09
TDEL0H037307.78ON7972441464e-09
KLLA0F15884g7.78ON7902311447e-09
KLTH0D02574g7.90ON3682401428e-09
Skud_15.1157.90ON3632591411e-08
SAKL0B09768g7.90ON3682331355e-08
YOL042W (NGL1)7.90ON3632541355e-08
Smik_15.1257.90ON3632491355e-08
NCAS0I005007.90ON3892421339e-08
Suva_15.1277.90ON3632541339e-08
KNAG0L005507.90ON3812571321e-07
TBLA0E022607.90ON3882251312e-07
Kwal_26.71707.90ON3722401312e-07
TDEL0H036007.90ON3662661302e-07
KAFR0D012507.90ON3562371284e-07
KLLA0F07733g7.90ON3712451204e-06
Kpol_1044.67.90ON3722451195e-06
Ecym_26367.90ON3672521133e-05
ZYRO0D05588g7.90ON3562481106e-05
TPHA0L005307.90ON3912181053e-04
NDAI0A085307.90ON3652321035e-04
YDL056W (MBP1)4.232ON83399714.5
Suva_16.4453.443ON249670715.2
Suva_4.1934.232ON84399705.7
KLTH0F02200g1.75ON34950687.4
Smik_16.3603.443ON249094698.6
TPHA0A034103.392ON36547688.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0D03300
         (480 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0D03300 Chr4 complement(823242..824684) [1443 bp, 480 aa] {O...  1000   0.0  
TBLA0B02900 Chr2 complement(668940..670502) [1563 bp, 520 aa] {O...   483   e-167
YMR285C Chr13 complement(840144..841691) [1548 bp, 515 aa] {ON} ...   479   e-166
TDEL0B00190 Chr2 complement(37032..38510) [1479 bp, 492 aa] {ON}...   474   e-164
Smik_13.501 Chr13 complement(822672..824219) [1548 bp, 515 aa] {...   473   e-163
Kpol_237.1 s237 complement(188..1699) [1512 bp, 503 aa] {ON} com...   469   e-162
Skud_13.458 Chr13 complement(813694..815238) [1545 bp, 514 aa] {...   465   e-160
ABL118W Chr2 (177531..179045) [1515 bp, 504 aa] {ON} Syntenic ho...   464   e-160
NDAI0K00370 Chr11 complement(78396..80102) [1707 bp, 568 aa] {ON...   465   e-159
KLTH0C03608g Chr3 complement(313729..315216) [1488 bp, 495 aa] {...   459   e-158
Suva_13.475 Chr13 complement(822078..823625) [1548 bp, 515 aa] {...   456   e-156
ZYRO0C14872g Chr3 complement(1155977..1157467) [1491 bp, 496 aa]...   452   e-155
CAGL0I02684g Chr9 complement(239316..240797) [1482 bp, 493 aa] {...   451   e-155
NCAS0C00310 Chr3 (42498..44168) [1671 bp, 556 aa] {ON} Anc_8.850      450   e-154
KNAG0K00650 Chr11 complement(116371..117819) [1449 bp, 482 aa] {...   445   e-153
TPHA0I00320 Chr9 complement(61470..63059) [1590 bp, 529 aa] {ON}...   445   e-152
NCAS0B00270 Chr2 (27753..29183) [1431 bp, 476 aa] {ON} Anc_8.850      441   e-151
SAKL0D01166g Chr4 (86218..87735) [1518 bp, 505 aa] {ON} similar ...   441   e-151
KAFR0L01960 Chr12 complement(370756..372291) [1536 bp, 511 aa] {...   434   e-148
NDAI0E00260 Chr5 (30097..31593) [1497 bp, 498 aa] {ON} Anc_8.850...   430   e-146
KLLA0C06248g Chr3 complement(552493..554043) [1551 bp, 516 aa] {...   430   e-146
Kwal_27.10204 s27 complement(239835..241319) [1485 bp, 494 aa] {...   421   e-143
Ecym_4619 Chr4 (1212417..1213880) [1464 bp, 487 aa] {ON} similar...   420   e-143
CAGL0B02387g Chr2 complement(228209..229624) [1416 bp, 471 aa] {...   365   e-121
Suva_13.25 Chr13 (32137..33645) [1509 bp, 502 aa] {ON} YML118W (...   358   e-118
Smik_13.16 Chr13 (28600..30108) [1509 bp, 502 aa] {ON} YML118W (...   357   e-118
KAFR0A02860 Chr1 complement(596779..598215) [1437 bp, 478 aa] {O...   351   e-116
YML118W Chr13 (32334..33851) [1518 bp, 505 aa] {ON}  NGL33'-5' e...   350   e-115
Skud_13.23 Chr13 (32056..33552) [1497 bp, 498 aa] {ON} YML118W (...   339   e-111
KNAG0G03470 Chr7 complement(743425..744825) [1401 bp, 466 aa] {O...   322   e-105
KAFR0K00670 Chr11 complement(148398..150785) [2388 bp, 795 aa] {...    79   8e-15
Kwal_26.7112 s26 complement(221318..223546) [2229 bp, 742 aa] {O...    76   7e-14
CAGL0H06149g Chr8 complement(598643..601264) [2622 bp, 873 aa] {...    75   1e-13
NDAI0H02520 Chr8 (614487..617183) [2697 bp, 898 aa] {ON} Anc_7.78      74   2e-13
KNAG0D04840 Chr4 (874511..876850) [2340 bp, 779 aa] {ON} Anc_7.7...    74   3e-13
Ecym_7354 Chr7 (736001..738358) [2358 bp, 785 aa] {ON} similar t...    74   3e-13
SAKL0B10032g Chr2 (853065..855260) [2196 bp, 731 aa] {ON} simila...    74   4e-13
KLTH0D02310g Chr4 complement(230632..232851) [2220 bp, 739 aa] {...    72   9e-13
Kpol_1040.14 s1040 complement(42093..44447) [2355 bp, 784 aa] {O...    72   1e-12
Skud_1.40 Chr1 complement(86326..88935) [2610 bp, 869 aa] {ON} Y...    72   2e-12
TPHA0H02680 Chr8 (627935..630553) [2619 bp, 872 aa] {ON} Anc_7.7...    71   3e-12
TBLA0A04660 Chr1 complement(1156426..1159116) [2691 bp, 896 aa] ...    71   3e-12
ACR288W Chr3 (882345..884555) [2211 bp, 736 aa] {ON} Syntenic ho...    69   1e-11
Suva_1.45 Chr1 complement(87201..89696) [2496 bp, 831 aa] {ON} Y...    69   2e-11
NCAS0F01640 Chr6 (330064..332631) [2568 bp, 855 aa] {ON} Anc_7.78      65   1e-10
ZYRO0D05302g Chr4 complement(453024..455597) [2574 bp, 857 aa] {...    65   2e-10
Smik_1.45 Chr1 complement(93751..96270) [2520 bp, 839 aa] {ON} Y...    65   3e-10
YAL021C Chr1 complement(110846..113359) [2514 bp, 837 aa] {ON}  ...    64   4e-10
ACR277C Chr3 complement(857936..859072) [1137 bp, 378 aa] {ON} S...    62   1e-09
CAGL0F01001g Chr6 (106796..107875) [1080 bp, 359 aa] {ON} highly...    61   2e-09
TDEL0H03730 Chr8 (623125..625518) [2394 bp, 797 aa] {ON} Anc_7.7...    61   4e-09
KLLA0F15884g Chr6 complement(1468612..1470984) [2373 bp, 790 aa]...    60   7e-09
KLTH0D02574g Chr4 (257847..258953) [1107 bp, 368 aa] {ON} simila...    59   8e-09
Skud_15.115 Chr15 (208773..209864) [1092 bp, 363 aa] {ON} YOL042...    59   1e-08
SAKL0B09768g Chr2 complement(823496..824602) [1107 bp, 368 aa] {...    57   5e-08
YOL042W Chr15 (249825..250916) [1092 bp, 363 aa] {ON}  NGL1Putat...    57   5e-08
Smik_15.125 Chr15 (215988..217079) [1092 bp, 363 aa] {ON} YOL042...    57   5e-08
NCAS0I00500 Chr9 (81492..82661) [1170 bp, 389 aa] {ON} Anc_7.90 ...    56   9e-08
Suva_15.127 Chr15 (222266..223357) [1092 bp, 363 aa] {ON} YOL042...    56   9e-08
KNAG0L00550 Chr12 (84534..85679) [1146 bp, 381 aa] {ON} Anc_7.90...    55   1e-07
TBLA0E02260 Chr5 complement(556705..557871) [1167 bp, 388 aa] {O...    55   2e-07
Kwal_26.7170 s26 (247186..248304) [1119 bp, 372 aa] {ON} YOL042W...    55   2e-07
TDEL0H03600 Chr8 complement(593714..594814) [1101 bp, 366 aa] {O...    55   2e-07
KAFR0D01250 Chr4 (254384..255454) [1071 bp, 356 aa] {ON} Anc_7.9...    54   4e-07
KLLA0F07733g Chr6 (731317..732432) [1116 bp, 371 aa] {ON} simila...    51   4e-06
Kpol_1044.6 s1044 (12595..13362,13366..13545,13548..13718) [1119...    50   5e-06
Ecym_2636 Chr2 complement(1225559..1226662) [1104 bp, 367 aa] {O...    48   3e-05
ZYRO0D05588g Chr4 (482402..483472) [1071 bp, 356 aa] {ON} simila...    47   6e-05
TPHA0L00530 Chr12 (91623..92798) [1176 bp, 391 aa] {ON} Anc_7.90...    45   3e-04
NDAI0A08530 Chr1 complement(1963920..1965017) [1098 bp, 365 aa] ...    44   5e-04
YDL056W Chr4 (352877..355378) [2502 bp, 833 aa] {ON}  MBP1Transc...    32   4.5  
Suva_16.445 Chr16 (767762..775252) [7491 bp, 2496 aa] {ON} YPR11...    32   5.2  
Suva_4.193 Chr4 (342458..344989) [2532 bp, 843 aa] {ON} YDL056W ...    32   5.7  
KLTH0F02200g Chr6 complement(176232..177281) [1050 bp, 349 aa] {...    31   7.4  
Smik_16.360 Chr16 (638042..645514) [7473 bp, 2490 aa] {ON} YPR11...    31   8.6  
TPHA0A03410 Chr1 (748156..749253) [1098 bp, 365 aa] {ON} Anc_3.3...    31   8.8  

>TBLA0D03300 Chr4 complement(823242..824684) [1443 bp, 480 aa] {ON}
           Anc_8.850 YMR285C
          Length = 480

 Score = 1000 bits (2586), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 480/480 (100%), Positives = 480/480 (100%)

Query: 1   MTKKEILLLQNKSAGELSQDEIRKQREIFKSKKREKKLIQGEDPDHPIELSFIKRPILYL 60
           MTKKEILLLQNKSAGELSQDEIRKQREIFKSKKREKKLIQGEDPDHPIELSFIKRPILYL
Sbjct: 1   MTKKEILLLQNKSAGELSQDEIRKQREIFKSKKREKKLIQGEDPDHPIELSFIKRPILYL 60

Query: 61  PHHGHSNRKGFKFSLMTYNCLAQAMIRREVFSDSGPALKWFRRSKVLMNEITYYNPDILC 120
           PHHGHSNRKGFKFSLMTYNCLAQAMIRREVFSDSGPALKWFRRSKVLMNEITYYNPDILC
Sbjct: 61  PHHGHSNRKGFKFSLMTYNCLAQAMIRREVFSDSGPALKWFRRSKVLMNEITYYNPDILC 120

Query: 121 LQEIDDFQYENFWKDQLESNLNMNTFYYKQKIKHHGVLIAWKKSIFKQVDHMVVDFDDVK 180
           LQEIDDFQYENFWKDQLESNLNMNTFYYKQKIKHHGVLIAWKKSIFKQVDHMVVDFDDVK
Sbjct: 121 LQEIDDFQYENFWKDQLESNLNMNTFYYKQKIKHHGVLIAWKKSIFKQVDHMVVDFDDVK 180

Query: 181 TSNIARRTITRNIAMYVALKFNDEFITKNFPNLLHSFDQNDIGFIISTTHLFWHPFGTFE 240
           TSNIARRTITRNIAMYVALKFNDEFITKNFPNLLHSFDQNDIGFIISTTHLFWHPFGTFE
Sbjct: 181 TSNIARRTITRNIAMYVALKFNDEFITKNFPNLLHSFDQNDIGFIISTTHLFWHPFGTFE 240

Query: 241 RTRQCYILLEKMKKFIDILNVKDHLKTHWYPFICGDFNSTPRDAPYLSMTSKPIEYTGRE 300
           RTRQCYILLEKMKKFIDILNVKDHLKTHWYPFICGDFNSTPRDAPYLSMTSKPIEYTGRE
Sbjct: 241 RTRQCYILLEKMKKFIDILNVKDHLKTHWYPFICGDFNSTPRDAPYLSMTSKPIEYTGRE 300

Query: 301 KKVIECSTAYKFSKRRNGEIGDSDEEEEKKLINQPKDMVPDSFTPTIEQAKLVHQLQSLH 360
           KKVIECSTAYKFSKRRNGEIGDSDEEEEKKLINQPKDMVPDSFTPTIEQAKLVHQLQSLH
Sbjct: 301 KKVIECSTAYKFSKRRNGEIGDSDEEEEKKLINQPKDMVPDSFTPTIEQAKLVHQLQSLH 360

Query: 361 NQLALRATSLYGLAYKIVDPSNVNINNDRGEPEFTSWAKSWHGVLDYIMYVDNWDINEPP 420
           NQLALRATSLYGLAYKIVDPSNVNINNDRGEPEFTSWAKSWHGVLDYIMYVDNWDINEPP
Sbjct: 361 NQLALRATSLYGLAYKIVDPSNVNINNDRGEPEFTSWAKSWHGVLDYIMYVDNWDINEPP 420

Query: 421 SEIGESLEEFEKNNQLLIKGLLKMPLNKDMPFHTQPFEREYPSDHISILCEMEILDSRLQ 480
           SEIGESLEEFEKNNQLLIKGLLKMPLNKDMPFHTQPFEREYPSDHISILCEMEILDSRLQ
Sbjct: 421 SEIGESLEEFEKNNQLLIKGLLKMPLNKDMPFHTQPFEREYPSDHISILCEMEILDSRLQ 480

>TBLA0B02900 Chr2 complement(668940..670502) [1563 bp, 520 aa] {ON}
           Anc_8.850 YMR285C
          Length = 520

 Score =  483 bits (1244), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 247/460 (53%), Positives = 324/460 (70%), Gaps = 17/460 (3%)

Query: 21  EIRKQREIFKSKKREKKLIQGEDPDHPIELSFIKRPILYLPHHGHSNRKGFKFSLMTYNC 80
           ++R +RE  +  KR+  L QG DPD P EL FIKRPIL +  H +   KGFKFSLMTYNC
Sbjct: 70  QVRAKREAARKAKRDALLAQGIDPDCPKELQFIKRPILQM--HENEPVKGFKFSLMTYNC 127

Query: 81  LAQAMIRREVFSDSGPALKWFRRSKVLMNEITYYNPDILCLQEIDDFQYENFWKDQLESN 140
           LAQA+IRR++F + G ALKW RRSKVL+NE  +YNPDI+CLQEID  QY++FWK++  S 
Sbjct: 128 LAQALIRRKLFPEGGDALKWHRRSKVLLNEFKHYNPDIICLQEIDHVQYQSFWKEEF-SK 186

Query: 141 LNMNTFYYKQKIKHHGVLIAWKKSIFKQVDHMVVDFDDVKTSNIARRTITRNIAMYVALK 200
           L     +YK+  K+HGV + WKK +F+  D M+VD+D   + +I  RT T NIA+ ++LK
Sbjct: 187 LGYECQFYKKPSKNHGVSVVWKKELFEMTDRMLVDYDKELSGDIEPRTTTNNIALLLSLK 246

Query: 201 FNDEFITKNFPNLLHSFDQNDIGFIISTTHLFWHPFGTFERTRQCYILLEKMKKFIDILN 260
           F+ + +T+ FP  +     N  G +I TTHLFWHPFGT+ERTRQCYI+L KMK+FID +N
Sbjct: 247 FSKK-VTERFPKNI-----NKTGILIGTTHLFWHPFGTYERTRQCYIILNKMKEFIDRVN 300

Query: 261 V----KDHLKTHWYPFICGDFNSTPRDAPYLSMTSKPIEYTGREKKVIECSTAYKFSKRR 316
           +     D   +HWYPF CGDFNS P D+PYLSMTSKPI+Y+GR K VIECST++KFSK+R
Sbjct: 301 ILQNNGDKDFSHWYPFFCGDFNSQPFDSPYLSMTSKPIKYSGRSKTVIECSTSFKFSKKR 360

Query: 317 NGEIGDSDEEE--EKKLINQPKDMVPDSFTPTIEQAKLVHQLQSLHNQLALRATSLYGLA 374
           +GE GD +E    EK   +QP+  VPD +    EQ  LV ++Q LHN L +RA SLY   
Sbjct: 361 DGEEGDDEEGGNIEKFGKDQPQHPVPDDYQANDEQKLLVTKMQELHNSLDMRAISLYSAG 420

Query: 375 YKIVDPSNVNINNDRGEPEFTSWAKSWHGVLDYIMYVDNWDINEPPSEIGESLEEFEKNN 434
           Y  V P N  I+N+R EPE ++WA  W G+LDY+ Y+ +WD   P  EI +SLE+FE+ N
Sbjct: 421 YSKVHPENSGIDNERNEPEISNWAHIWRGLLDYLFYIKSWDFT-PNKEI-DSLEDFEREN 478

Query: 435 QLLIKGLLKMPLNKDMPFHTQPFEREYPSDHISILCEMEI 474
            + I+G L+MP  K++P H QPFE EYPSDH+ +LCE+E+
Sbjct: 479 DIKIRGYLRMPPAKELPSHGQPFEGEYPSDHLCMLCEVEL 518

>YMR285C Chr13 complement(840144..841691) [1548 bp, 515 aa] {ON}
           NGL2Protein involved in 5.8S rRNA processing; Ccr4p-like
           RNase required for correct 3'-end formation of 5.8S rRNA
           at site E; similar to Ngl1p and Ngl3p
          Length = 515

 Score =  479 bits (1234), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 231/461 (50%), Positives = 312/461 (67%), Gaps = 16/461 (3%)

Query: 21  EIRKQREIFKSKKREKKLIQGEDPDHPIELSFIKRPILYLPHHGHSNRKGFKFSLMTYNC 80
           ++R +RE+ +  KR+  L QG DPD P EL FI+RP L L  H      GF+F LMTYNC
Sbjct: 62  KVRAEREVMRKAKRDAMLAQGVDPDCPPELHFIRRPFLSL--HEAEPVTGFRFKLMTYNC 119

Query: 81  LAQAMIRREVFSDSGPALKWFRRSKVLMNEITYYNPDILCLQEIDDFQYENFWKDQLESN 140
           LAQA+IRR++F DSG ALKW+RRSKVL+NE  YYN D++CLQEID  Q+++FWKD+  S 
Sbjct: 120 LAQALIRRKLFPDSGDALKWYRRSKVLLNEFKYYNSDVICLQEIDHIQFQSFWKDEF-SK 178

Query: 141 LNMNTFYYKQKIKHHGVLIAWKKSIFKQVDHMVVDFDDVKTSNIARRTITRNIAMYVALK 200
           L  +  YY+   K+HGV I W++ +F QVD M++D+D   + +I+ RT T N+ + +ALK
Sbjct: 179 LGYDGQYYRNATKNHGVAIMWRRELFHQVDKMLIDYDKESSESISTRTTTNNVGLVLALK 238

Query: 201 FNDEFITKNFPNLLHSFDQNDIGFIISTTHLFWHPFGTFERTRQCYILLEKMKKFIDILN 260
           F+++ ++      L        G +I TTHLFWHPFGT+ERTRQCYI+L+KMK+F+  +N
Sbjct: 239 FSEKVLSN-----LGKKSSKKCGILIGTTHLFWHPFGTYERTRQCYIVLKKMKEFMHRVN 293

Query: 261 V----KDHLKTHWYPFICGDFNSTPRDAPYLSMTSKPIEYTGREKKVIECSTAYKFSKRR 316
           V     D   +HW+PF CGDFNS P D PYLSMTSKP+ Y  R K VI CST+YKFSK R
Sbjct: 294 VLQNENDGDLSHWFPFFCGDFNSQPFDTPYLSMTSKPVHYRNRAKTVIGCSTSYKFSKVR 353

Query: 317 NGEIGDSDEEE---EKKLINQPKDMVPDSFTPTIEQAKLVHQLQSLHNQLALRATSLYGL 373
           +GE G  DEE    EK   +QP+  VP+ F    EQ++LV ++  LHN L +RA SLY +
Sbjct: 354 DGEEGADDEEGGNIEKYGKDQPESPVPEKFHANEEQSELVDKMAQLHNSLDMRAISLYSV 413

Query: 374 AYKIVDPSNVNINNDRGEPEFTSWAKSWHGVLDYIMYVDNWDINEPPSEIGESLEEFEKN 433
            YK V P N  ++NDRGEPE ++WA +W G+LDY+ YV  WD      E+ E+L +FEK 
Sbjct: 414 GYKNVHPENAGLDNDRGEPEISNWANTWRGLLDYLFYVKKWDPQSNCQEV-ETLGDFEKE 472

Query: 434 NQLLIKGLLKMPLNKDMPFHTQPFEREYPSDHISILCEMEI 474
           N++  +G L+MP   +M  H QP   EY SDH+S++C++E+
Sbjct: 473 NKVKCRGFLRMPPGNEMTKHGQPHVGEYASDHLSMVCDLEL 513

>TDEL0B00190 Chr2 complement(37032..38510) [1479 bp, 492 aa] {ON}
           Anc_8.850 YMR285C
          Length = 492

 Score =  474 bits (1221), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 238/461 (51%), Positives = 317/461 (68%), Gaps = 19/461 (4%)

Query: 21  EIRKQREIFKSKKREKKLIQGEDPDHPIELSFIKRPILYLPHHGHSNRKGFKFSLMTYNC 80
           ++R +RE  +  KRE+ L +G DPDHP EL FIKRP+L L  H     +G  F L+TYNC
Sbjct: 42  KVRAEREAARKAKREEMLAKGMDPDHPPELQFIKRPLLTL--HEDEPIEGLSFKLLTYNC 99

Query: 81  LAQAMIRREVFSDSGPALKWFRRSKVLMNEITYYNPDILCLQEIDDFQYENFWKDQLESN 140
           LAQA+IRR++F DSG +LKWFRRSKVL  E  +YN D+LCLQEID  QY+ FWKD+L+  
Sbjct: 100 LAQALIRRKLFPDSGDSLKWFRRSKVLQYEFKHYNADVLCLQEIDYIQYQQFWKDELD-K 158

Query: 141 LNMNTFYYKQKIKHHGVLIAWKKSIFKQVDHMVVDFDDVKTSNIARRTITRNIAMYVALK 200
           L  +T +YKQ  K+HGV IAWK+ +F+  D M++D+D   +  I +RT+T N  + +ALK
Sbjct: 159 LGYDTQFYKQPCKNHGVSIAWKRHLFQLTDRMLIDYDKESSGKIEKRTLTHNSGLILALK 218

Query: 201 FNDEFITKNFPNLLHSFDQNDIGFIISTTHLFWHPFGTFERTRQCYILLEKMKKFIDILN 260
           F D    ++ P++  S      G ++ T+HLFWHPFGT+ERTRQCY++L+KMK+F+  +N
Sbjct: 219 FTDA-AKQSCPHIRKS------GILVGTSHLFWHPFGTYERTRQCYVVLKKMKEFMKRVN 271

Query: 261 V----KDHLKTHWYPFICGDFNSTPRDAPYLSMTSKPIEYTGREKKVIECSTAYKFSKRR 316
           V     D   +HW PF CGDFNS P D PYLSMTSKP+EYTGR K V+ECST+Y FSK R
Sbjct: 272 VLQNNNDGNLSHWVPFFCGDFNSQPFDTPYLSMTSKPVEYTGRAKTVVECSTSYTFSKLR 331

Query: 317 NGEIGDSDEEE---EKKLINQPKDMVPDSFTPTIEQAKLVHQLQSLHNQLALRATSLYGL 373
           NGE    DEE    EK   +QP+  VP++F  T EQ KLV ++Q LHN + +RA SLY +
Sbjct: 332 NGEEDAEDEEGGNIEKFGKDQPQTPVPETFDATPEQQKLVEEMQELHNSIDMRAISLYAV 391

Query: 374 AYKIVDPSNVNINNDRGEPEFTSWAKSWHGVLDYIMYVDNWDINEPPSEIGESLEEFEKN 433
            Y  V P N  I+NDRGEPE ++WA +W G+LDYI+ +  WD ++   +  +SLE FEK 
Sbjct: 392 GYGEVHPENSGIDNDRGEPEMSNWANTWRGLLDYILLITQWDSSD--RKKVDSLETFEKE 449

Query: 434 NQLLIKGLLKMPLNKDMPFHTQPFEREYPSDHISILCEMEI 474
           N L ++GLL+MP   +M  H QP E EY SDH+S++C +E+
Sbjct: 450 NSLKLRGLLRMPPASEMSHHGQPHEGEYASDHLSMMCTIEL 490

>Smik_13.501 Chr13 complement(822672..824219) [1548 bp, 515 aa] {ON}
           YMR285C (REAL)
          Length = 515

 Score =  473 bits (1216), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 226/461 (49%), Positives = 313/461 (67%), Gaps = 16/461 (3%)

Query: 21  EIRKQREIFKSKKREKKLIQGEDPDHPIELSFIKRPILYLPHHGHSNRKGFKFSLMTYNC 80
           +IR +R+  +  KR+  L QG DPD P EL FIKRP L L  H      GF+F LMTYNC
Sbjct: 62  KIRAERDAMRKAKRDAMLAQGVDPDCPPELHFIKRPFLVL--HEKEPVTGFRFKLMTYNC 119

Query: 81  LAQAMIRREVFSDSGPALKWFRRSKVLMNEITYYNPDILCLQEIDDFQYENFWKDQLESN 140
           LAQA+IRR++F DSG ALKW+RRS+VL+NE  YY  D++CLQEID  Q+++FWKD+  + 
Sbjct: 120 LAQALIRRKLFPDSGDALKWYRRSRVLLNEFKYYKADVICLQEIDHIQFQSFWKDEF-NK 178

Query: 141 LNMNTFYYKQKIKHHGVLIAWKKSIFKQVDHMVVDFDDVKTSNIARRTITRNIAMYVALK 200
           L  +  YY+   K+HGV I W++ +F+QVD M++D+D   + NI+ RT T N+ + +ALK
Sbjct: 179 LGYDGQYYRNSTKNHGVAIMWRREMFQQVDKMLIDYDKETSENISTRTTTNNVGLVLALK 238

Query: 201 FNDEFITKNFPNLLHSFDQNDIGFIISTTHLFWHPFGTFERTRQCYILLEKMKKFIDILN 260
           F+++ ++      L        G +I TTHLFWHPFGT+ERTRQCY++L+KMK+F+  +N
Sbjct: 239 FSEKVLSN-----LSKSSSKKCGILIGTTHLFWHPFGTYERTRQCYVVLKKMKEFMHRVN 293

Query: 261 V----KDHLKTHWYPFICGDFNSTPRDAPYLSMTSKPIEYTGREKKVIECSTAYKFSKRR 316
           V     D   +HW+PF CGDFNS P D PYLSMTSKP+ Y  R K VIECST++KFSK R
Sbjct: 294 VLQNENDGDLSHWFPFFCGDFNSQPFDTPYLSMTSKPVHYKNRAKTVIECSTSFKFSKAR 353

Query: 317 NGEIGDSDEEE---EKKLINQPKDMVPDSFTPTIEQAKLVHQLQSLHNQLALRATSLYGL 373
           +G+    DEE    EK   +QP+  VP+++    EQ +LV ++  LHN L +RA SLY +
Sbjct: 354 DGDESADDEEGGNIEKYGKDQPESPVPENYHANEEQIELVDKMAQLHNSLDMRAISLYSV 413

Query: 374 AYKIVDPSNVNINNDRGEPEFTSWAKSWHGVLDYIMYVDNWDINEPPSEIGESLEEFEKN 433
            Y+ V P N  ++NDRGEPE ++WA +W G+LDY+ YV  WD+     E+ E+L +FEK 
Sbjct: 414 GYRNVHPENAGLDNDRGEPEISNWANTWRGLLDYLFYVKKWDLRSNCQEV-ENLGDFEKV 472

Query: 434 NQLLIKGLLKMPLNKDMPFHTQPFEREYPSDHISILCEMEI 474
           N++  +G L+MP  K+M  H QP   EY SDH+S++C++E+
Sbjct: 473 NEMKCRGFLRMPPGKEMTKHGQPHVGEYASDHLSMVCDLEL 513

>Kpol_237.1 s237 complement(188..1699) [1512 bp, 503 aa] {ON}
           complement(188..1699) [1512 nt, 504 aa]
          Length = 503

 Score =  469 bits (1207), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 234/461 (50%), Positives = 314/461 (68%), Gaps = 20/461 (4%)

Query: 23  RKQREIFKSKKREKKLIQGEDPDHPIELSFIKRPILYLPHHGHSNRKGFKFSLMTYNCLA 82
           R +R   K +KR++ L +G DPD+P EL FIKRP+L+L  H      GF F+LMTYNCLA
Sbjct: 54  RAERAAAKEQKRKELLAKGLDPDYPPELQFIKRPMLHL--HQDEPVTGFNFTLMTYNCLA 111

Query: 83  QAMIRREVFSDSGPALKWFRRSKVLMNEITYYNPDILCLQEIDDFQYENFWKDQLESNLN 142
           QA+IRR++F DSG A+KWFRRSKVL+ E  +YN D++CLQEID  QY+ FWK + E  L 
Sbjct: 112 QALIRRKLFPDSGEAVKWFRRSKVLLYEFQHYNSDVICLQEIDHIQYQAFWKVEFEK-LG 170

Query: 143 MNTFYYKQKIKHHGVLIAWKKSIFKQVDHMVVDFDDVKTSNIARRTITRNIAMYVALKFN 202
             + +++   K+HGV I WK+ +FK  D M++DFD   +S+I  RT T N  + ++LKF+
Sbjct: 171 YESQFHRIASKNHGVAIVWKREMFKMTDRMLIDFDKETSSDIPPRTRTNNTGLILSLKFS 230

Query: 203 DEFITKNFPNLLHSFDQNDIGFIISTTHLFWHPFGTFERTRQCYILLEKMKKFIDILNV- 261
           D+ ++   P      +    G II TTHLFWHPFGT+ERTRQCY+LL KMK+F+  +NV 
Sbjct: 231 DKILS-TLPK-----NTKTTGIIIGTTHLFWHPFGTYERTRQCYVLLNKMKEFMHRVNVL 284

Query: 262 ---KDHLKTHWYPFICGDFNSTPRDAPYLSMTSKPIEYTGREKKVIECSTAYKFSKRRNG 318
               D   +HW PF CGDFNS P D+PYLSMTSKPIEYT R K VI+CST+YKFSK RNG
Sbjct: 285 QNGNDGDLSHWVPFFCGDFNSQPFDSPYLSMTSKPIEYTERAKTVIQCSTSYKFSKLRNG 344

Query: 319 EIGDSDEEE----EKKLINQPKDMVPDSFTPTIEQAKLVHQLQSLHNQLALRATSLYGLA 374
           E  D D+EE    EK   +QP+  VP++F    EQ  LV ++  +HN+L +RA SLY + 
Sbjct: 345 E-EDVDDEEGGNIEKFGKDQPQTPVPETFIANEEQTALVERMAVIHNELGMRANSLYSVG 403

Query: 375 YKIVDPSNVNINNDRGEPEFTSWAKSWHGVLDYIMYVDNWDINEPPSEIGESLEEFEKNN 434
           YK V   N  I+N RGEP  ++WA +W G+LDYI +V+ WD +    +  +SLE+FE  N
Sbjct: 404 YKHVHAENAGIDNTRGEPIISNWANTWRGLLDYIFHVNTWDFDN--RQAVDSLEKFEIEN 461

Query: 435 QLLIKGLLKMPLNKDMPFHTQPFEREYPSDHISILCEMEIL 475
            + ++G L+MPL+ +MP H QP E EY SDH+S++C +E+L
Sbjct: 462 SIRLRGFLRMPLDSEMPKHGQPHEGEYASDHLSMICNIELL 502

>Skud_13.458 Chr13 complement(813694..815238) [1545 bp, 514 aa] {ON}
           YMR285C (REAL)
          Length = 514

 Score =  465 bits (1197), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 225/461 (48%), Positives = 311/461 (67%), Gaps = 16/461 (3%)

Query: 21  EIRKQREIFKSKKREKKLIQGEDPDHPIELSFIKRPILYLPHHGHSNRKGFKFSLMTYNC 80
           ++R +RE  +  KR+  L  G DPD P EL FI+RP+L L         GF+F LMTYNC
Sbjct: 61  KVRAEREAMRKAKRDAMLAHGVDPDCPPELHFIQRPLLSLGEG--EPVTGFRFKLMTYNC 118

Query: 81  LAQAMIRREVFSDSGPALKWFRRSKVLMNEITYYNPDILCLQEIDDFQYENFWKDQLESN 140
           LAQA+IRR++F DSG ALKWFRRSKVL+NE  YYN D++CLQE+D  Q+++FWK +  + 
Sbjct: 119 LAQALIRRKLFPDSGDALKWFRRSKVLLNEFKYYNADVICLQEVDHIQFQSFWKGKF-NK 177

Query: 141 LNMNTFYYKQKIKHHGVLIAWKKSIFKQVDHMVVDFDDVKTSNIARRTITRNIAMYVALK 200
           +  +  Y++   K+HGV I W++S+F++VD M++D+D   + +I  RT T N+ + +ALK
Sbjct: 178 MGYDGQYHRNPTKNHGVAIIWRRSMFQKVDKMLIDYDKEASGSILTRTTTNNVGLVLALK 237

Query: 201 FNDEFITKNFPNLLHSFDQNDIGFIISTTHLFWHPFGTFERTRQCYILLEKMKKFIDILN 260
           F+ E ++K     L        G +I TTHLFWHPFGT+ERTRQCY++L KMK+F+  +N
Sbjct: 238 FSKEVLSK-----LGKKSSKKCGILIGTTHLFWHPFGTYERTRQCYVVLRKMKEFMHRVN 292

Query: 261 V----KDHLKTHWYPFICGDFNSTPRDAPYLSMTSKPIEYTGREKKVIECSTAYKFSKRR 316
           V     D   +HW+PF CGDFNS P D PYLSMTSKP+ Y  R K VIECST++KFSK R
Sbjct: 293 VLQNDNDGDLSHWFPFFCGDFNSQPFDTPYLSMTSKPVHYKSRAKTVIECSTSFKFSKVR 352

Query: 317 NGEIGDSDEEE---EKKLINQPKDMVPDSFTPTIEQAKLVHQLQSLHNQLALRATSLYGL 373
           +GE G  DEE    EK   +QP+  VP++F    EQ ++V  +  LHN L +RA SLY +
Sbjct: 353 DGEEGADDEEGGNIEKFGKDQPESPVPENFHANDEQIEIVDDMVQLHNSLDMRAISLYSV 412

Query: 374 AYKIVDPSNVNINNDRGEPEFTSWAKSWHGVLDYIMYVDNWDINEPPSEIGESLEEFEKN 433
            YK V P N  ++NDRGEPE ++WA +W G+LDY+ Y+  WD+     E+ E+L +FEK 
Sbjct: 413 GYKSVHPENAGLDNDRGEPEISNWANTWRGLLDYLFYIKKWDLQSNRQEV-ENLSDFEKK 471

Query: 434 NQLLIKGLLKMPLNKDMPFHTQPFEREYPSDHISILCEMEI 474
           N++  +G L+MP   +M  H QP   EYPSDH+S++C++E+
Sbjct: 472 NEIKCRGFLRMPPASEMTKHGQPHVGEYPSDHLSMVCDLEL 512

>ABL118W Chr2 (177531..179045) [1515 bp, 504 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR285C (NGL2) and
           YML118W (NGL3)
          Length = 504

 Score =  464 bits (1195), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 229/470 (48%), Positives = 314/470 (66%), Gaps = 25/470 (5%)

Query: 12  KSAGELSQDEIRKQREIFKSKKREKKLIQGEDPDHPIELSFIKRPILYLPHHGHSNRKGF 71
           K+ G  S +EI K R   K+KK       GED      + FIKRP+L          KGF
Sbjct: 53  KANGRPSAEEIEKIRAQRKAKKEAAGKQGGED------VGFIKRPLLVC---NGDEAKGF 103

Query: 72  KFSLMTYNCLAQAMIRREVFSDSGPALKWFRRSKVLMNEITYYNPDILCLQEIDDFQYEN 131
            F +MTYNCLAQA+IRR++F  SG ALKWF+RSKVL++E+ YYNPD++CLQEID  QY++
Sbjct: 104 VFRMMTYNCLAQALIRRKLFPTSGNALKWFKRSKVLLSELQYYNPDVICLQEIDHTQYKS 163

Query: 132 FWKDQLESNLNMNTFYYKQKIKHHGVLIAWKKSIFKQVDHMVVDFDDVKTSNIARRTITR 191
           FW D L+ +    + +++   K+HG+ I W++S+F +VD  ++DFD+ ++  I RRT T+
Sbjct: 164 FWMDALQ-HAGYCSKFHRSFGKNHGIAIVWRRSLFNKVDETLIDFDEEQSGEIERRTTTK 222

Query: 192 NIAMYVALKFNDEFITKNFPNLLHSFDQNDIGFIISTTHLFWHPFGTFERTRQCYILLEK 251
           N+ + VAL++ DE I + +P    S      G ++ T+HLFWHPFGT+ER RQCYI+L +
Sbjct: 223 NVGLIVALEYTDE-IKRRYPGSAQS------GIVVGTSHLFWHPFGTYERARQCYIILSR 275

Query: 252 MKKFIDILNVKDH----LKTHWYPFICGDFNSTPRDAPYLSMTSKPIEYTGREKKVIECS 307
           MK F+  L + +       + W+PF CGDFNS P DAPYLSM SKPI Y GR + VIECS
Sbjct: 276 MKVFLKRLRLLERGSCGAASQWHPFFCGDFNSQPFDAPYLSMCSKPIIYEGRARTVIECS 335

Query: 308 TAYKFSKRRNGEIGDSDEEE--EKKLINQPKDMVPDSFTPTIEQAKLVHQLQSLHNQLAL 365
           T+YKFS  R+G   D +E    EK    QP+  VPDSF  T EQ  LV  +QSLHN L +
Sbjct: 336 TSYKFSSLRDGCAADEEEGGNIEKFGAGQPETPVPDSFDGTPEQRALVDAMQSLHNALDM 395

Query: 366 RATSLYGLAYKIVDPSNVNINNDRGEPEFTSWAKSWHGVLDYIMYVDNWDINEPPSEIGE 425
           RA SLY LAY+ V P N  I+N+RGEPE ++WA +W G+LDYIMYV  WD ++  +E+ +
Sbjct: 396 RAISLYSLAYRYVHPENAGIDNNRGEPEISNWAHAWRGLLDYIMYVMPWDFSD-NTEV-D 453

Query: 426 SLEEFEKNNQLLIKGLLKMPLNKDMPFHTQPFEREYPSDHISILCEMEIL 475
            + EF+KN  ++++ LL++P   +MP H QP E EYPSDH+S++CE+E+L
Sbjct: 454 DIGEFQKNTSVIVRSLLRVPPASEMPSHGQPHEGEYPSDHLSLMCELELL 503

>NDAI0K00370 Chr11 complement(78396..80102) [1707 bp, 568 aa] {ON}
           Anc_8.850 YML118W
          Length = 568

 Score =  465 bits (1197), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 232/462 (50%), Positives = 318/462 (68%), Gaps = 24/462 (5%)

Query: 21  EIRKQREIFKSKKREKKLIQGEDPDHPIELSFIKRPILYLPHHGHSNRKGFKFSLMTYNC 80
           ++R +R++ K  K+E  +I       P EL FIKRPILYL  H     +GFKFS+MTYNC
Sbjct: 124 KLRAERKLLKEAKKEVSVI-------PPELQFIKRPILYL--HEEEPVQGFKFSMMTYNC 174

Query: 81  LAQAMIRREVFSDSGPALKWFRRSKVLMNEITYYNPDILCLQEIDDFQYENFWKDQLESN 140
           LAQA+IRR++F DSG ALKW+RRSKVL+NE TYY+PDI+CLQE+D  QY++FWK + E  
Sbjct: 175 LAQALIRRKLFPDSGDALKWYRRSKVLLNEFTYYSPDIICLQEVDHIQYQSFWKTEFEK- 233

Query: 141 LNMNTFYYKQKIKHHGVLIAWKKSIFKQVDHMVVDFDDVKTSNIARRTITRNIAMYVALK 200
           L   + Y+++ +K+HGV I W++S+F   D M+++FD   + N+  RT T N+ + ++LK
Sbjct: 234 LGYQSQYHRKGVKNHGVSIIWRRSLFTMTDKMLIEFDKESSGNVPPRTTTNNVGLILSLK 293

Query: 201 FNDEFITKNFPNLLHSFDQNDIGFIISTTHLFWHPFGTFERTRQCYILLEKMKKFIDILN 260
           F  E     F N+    +    G II TTHLFWHPFGT+ERTRQCY++L KMK+F+  +N
Sbjct: 294 FTPE-AKAQFKNV----ETTKTGIIIGTTHLFWHPFGTYERTRQCYVVLNKMKEFMHRVN 348

Query: 261 V----KDHLKTHWYPFICGDFNSTPRDAPYLSMTSKPIEYTGREKKVIECSTAYKFSKRR 316
           V     D   +HWYPF CGDFNS P D+PYLSM  KP+EY+GR K VIECST+YKFSK+R
Sbjct: 349 VLQNNNDRDLSHWYPFFCGDFNSQPFDSPYLSMVRKPVEYSGRAKTVIECSTSYKFSKKR 408

Query: 317 NGEIGDSDEEE---EKKLINQPKDMVPDSFTPTIEQAKLVHQLQSLHNQLALRATSLYGL 373
           +GE    DEE    EK  I+QP+  VP+ F    EQ  LV  ++ LHN L +RA SLYG+
Sbjct: 409 DGEEDVDDEEGGNIEKFGIDQPQTPVPEEFIANGEQTILVKDMEKLHNSLNMRAISLYGV 468

Query: 374 AYKIVDPSNVNINNDRGEPEFTSWAKSWHGVLDYIMYVDNWDINEPPSEIGESLEEFEKN 433
            YK V P N +I+N+ GEPE ++WA +W+G+LDY+++V  W  ++      E+L++FE++
Sbjct: 469 GYKNVHPENASIDNECGEPEISNWAHTWNGLLDYLLFVKEWTFSD--CTKTETLKQFEES 526

Query: 434 NQLLIKGLLKMPLNKDMPFHTQPFEREYPSDHISILCEMEIL 475
           N + I+G L+MP   +M  H QP   EYPSDH+S+LC +E+L
Sbjct: 527 NSMRIRGFLRMPPANEMTKHGQPHVGEYPSDHLSMLCSIELL 568

>KLTH0C03608g Chr3 complement(313729..315216) [1488 bp, 495 aa] {ON}
           similar to uniprot|Q03264 Saccharomyces cerevisiae
           YMR285C
          Length = 495

 Score =  459 bits (1180), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 224/460 (48%), Positives = 306/460 (66%), Gaps = 18/460 (3%)

Query: 21  EIRKQREIFKSKKREKKLIQGEDPDHPIELSFIKRPILYLPHHGHSNRKGFKFSLMTYNC 80
           E+R QRE  K KKRE  + +G DPD P +L FI RP+L L  +   N  GF F LMTYNC
Sbjct: 46  EVRAQREAAKKKKREDMIARGLDPDFPPDLQFIHRPMLSL--NPSENANGFVFKLMTYNC 103

Query: 81  LAQAMIRREVFSDSGPALKWFRRSKVLMNEITYYNPDILCLQEIDDFQYENFWKDQLESN 140
           LAQA+IRR++F  SG ALKWF+RS+VL+NE  +YN D+LCLQE+D  QY++FWK++ E  
Sbjct: 104 LAQALIRRKLFPTSGNALKWFKRSRVLLNEFMHYNSDVLCLQEVDYIQYQSFWKEEFE-K 162

Query: 141 LNMNTFYYKQKIKHHGVLIAWKKSIFKQVDHMVVDFDDVKTSNIARRTITRNIAMYVALK 200
           L   + +++   K+HG+ I WK+ +F  VD M++D+D   +  +  RT T+N+ + +AL 
Sbjct: 163 LGYESQFHRHGTKNHGIAIVWKRDMFTMVDKMLIDYDKEPSGALEPRTTTKNVGLAIALG 222

Query: 201 FNDEFITKNFPNLLHSFDQNDIGFIISTTHLFWHPFGTFERTRQCYILLEKMKKFIDILN 260
           F  + + K +P        +  G I+ TTHLFWHPFGTFERTRQCY++L KMK+F+  +N
Sbjct: 223 FTKKVLAK-YPG------SSKRGIIVGTTHLFWHPFGTFERTRQCYVMLNKMKEFMHRIN 275

Query: 261 V-KDHLKTH---WYPFICGDFNSTPRDAPYLSMTSKPIEYTGREKKVIECSTAYKFSKRR 316
           V +D   T    WYPF CGDFNS P D PYLS++SKP+ Y GR K VIECST+Y FSK R
Sbjct: 276 VLQDKGATQENLWYPFFCGDFNSQPFDTPYLSVSSKPVTYKGRAKTVIECSTSYTFSKAR 335

Query: 317 NGEIGDSDEEE--EKKLINQPKDMVPDSFTPTIEQAKLVHQLQSLHNQLALRATSLYGLA 374
           +GE  D +E    EK    QP+  VP+ F+ T EQ  LV  + SLHN L +R  S+Y + 
Sbjct: 336 DGEECDDEEGGNIEKFGDGQPEHPVPEKFSATEEQKGLVESMASLHNSLDMRGISIYSVG 395

Query: 375 YKIVDPSNVNINNDRGEPEFTSWAKSWHGVLDYIMYVDNWDINEPPSEIGESLEEFEKNN 434
           YK V   N  ++N+  EPE ++WA++W G+LDYI ++  WD ++  S   E LE F+  N
Sbjct: 396 YKHVHAENAGLDNNFNEPEISNWAETWRGLLDYIFFIKKWDFSDKASP--EELEAFQDEN 453

Query: 435 QLLIKGLLKMPLNKDMPFHTQPFEREYPSDHISILCEMEI 474
            + I+GLL+MP  K+MP H QP E EY SDH+S++CE+E+
Sbjct: 454 GIKIRGLLRMPPAKEMPNHGQPHEGEYGSDHLSMMCELEL 493

>Suva_13.475 Chr13 complement(822078..823625) [1548 bp, 515 aa] {ON}
           YMR285C (REAL)
          Length = 515

 Score =  456 bits (1172), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 225/461 (48%), Positives = 312/461 (67%), Gaps = 16/461 (3%)

Query: 21  EIRKQREIFKSKKREKKLIQGEDPDHPIELSFIKRPILYLPHHGHSNRKGFKFSLMTYNC 80
           ++R +R+  +  KR+  L QG DPD P EL FIKRP L L  H      GF+F LMTYNC
Sbjct: 62  KVRAERDAIRKAKRDSMLAQGIDPDCPPELHFIKRPFLSL--HEEEPVTGFRFKLMTYNC 119

Query: 81  LAQAMIRREVFSDSGPALKWFRRSKVLMNEITYYNPDILCLQEIDDFQYENFWKDQLESN 140
           LAQA+IRR++F DSG ALKW+RRS+VL+NE  +YN D++CLQEID  Q+++FWK++  S 
Sbjct: 120 LAQALIRRKLFPDSGDALKWYRRSRVLLNEFRHYNADVICLQEIDHIQFQSFWKEEF-SK 178

Query: 141 LNMNTFYYKQKIKHHGVLIAWKKSIFKQVDHMVVDFDDVKTSNIARRTITRNIAMYVALK 200
           L     Y++   K+HGV I W++ +F+QVD M++DFD   + NI  RT T N+ + +ALK
Sbjct: 179 LGYEGQYHRNSTKNHGVAIIWRRDMFQQVDKMLIDFDKEVSGNIPTRTTTNNVGLVLALK 238

Query: 201 FNDEFITKNFPNLLHSFDQNDIGFIISTTHLFWHPFGTFERTRQCYILLEKMKKFIDILN 260
           F+++ ++      L        G +I T+HLFWHPFGT+ERTRQCYI+L+KM++F+  +N
Sbjct: 239 FSEKVLSN-----LGKASSKKSGILIGTSHLFWHPFGTYERTRQCYIVLKKMEEFMHRVN 293

Query: 261 V----KDHLKTHWYPFICGDFNSTPRDAPYLSMTSKPIEYTGREKKVIECSTAYKFSKRR 316
           V     D   +HW+PF CGDFNS P D PYLSMT KP+ Y  R K VIECST++KFSK R
Sbjct: 294 VLQNENDGDLSHWFPFFCGDFNSQPFDTPYLSMTCKPVHYEKRAKTVIECSTSFKFSKVR 353

Query: 317 NGEIGDSDEEE---EKKLINQPKDMVPDSFTPTIEQAKLVHQLQSLHNQLALRATSLYGL 373
           +GE G  +EE    EK   +QP+  VP  F    EQ +LV ++  LHN L +RA SLY +
Sbjct: 354 DGEEGADEEEGGNIEKFGKDQPESPVPKDFHANEEQIELVDEMAQLHNSLDMRAVSLYSV 413

Query: 374 AYKIVDPSNVNINNDRGEPEFTSWAKSWHGVLDYIMYVDNWDINEPPSEIGESLEEFEKN 433
           AYK V P N  ++NDRGEPE ++WA +W G+LDY+ Y+  WD+     E+ +SL++FEK+
Sbjct: 414 AYKNVHPENAGLDNDRGEPEISNWANTWRGLLDYLFYIKKWDLRSNCQEV-DSLDDFEKD 472

Query: 434 NQLLIKGLLKMPLNKDMPFHTQPFEREYPSDHISILCEMEI 474
           N++  +G L+MP   +M  H QP   EY SDH+S++C++E+
Sbjct: 473 NEIKFRGFLRMPPGSEMTKHGQPHVGEYASDHLSMVCDIEL 513

>ZYRO0C14872g Chr3 complement(1155977..1157467) [1491 bp, 496 aa]
           {ON} similar to uniprot|Q03264 Saccharomyces cerevisiae
           YMR285C
          Length = 496

 Score =  452 bits (1164), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 233/447 (52%), Positives = 310/447 (69%), Gaps = 21/447 (4%)

Query: 38  LIQGEDPDHPIELSFIKRPILYLPHHGHSNRKGFKFSLMTYNCLAQAMIRREVFSDSGPA 97
           + QG DPD P EL FIKRPIL  P H   N +GFKF LMTYNCLAQA+IRR++F  SG A
Sbjct: 63  MAQGIDPDFPPELQFIKRPIL--PLHKGENVEGFKFKLMTYNCLAQALIRRKLFPTSGDA 120

Query: 98  LKWFRRSKVLMNEITYYNPDILCLQEIDDFQYENFWKDQLESNLNMNTFYYKQKIKHHGV 157
           LKW+RRSKVL+NE  YYN D++CLQEID  QY++FWKD+L + L  ++ +++Q  K+HGV
Sbjct: 121 LKWYRRSKVLLNEFKYYNADVICLQEIDYIQYQSFWKDEL-AKLGYDSQFHRQASKNHGV 179

Query: 158 LIAWKKSIFKQVDHMVVDFDDVKTSNIARRTITRNIAMYVALKFNDEFITKNFPNLLHSF 217
            I WK+  F   D M++DFD   + +I  RT T N  + ++LKF+D+   ++  NL    
Sbjct: 180 AIVWKREYFVMTDKMLIDFDRESSGDIPPRTTTNNAGLILSLKFSDKVAQEH--NL---- 233

Query: 218 DQNDIGFIISTTHLFWHPFGTFERTRQCYILLEKMKKFIDILNV----KDHLKTHWYPFI 273
                G I+ TTHLFWHPFGTFERTRQCY++L K+K+F   +NV     D   +HWYPF 
Sbjct: 234 --KKTGIIVGTTHLFWHPFGTFERTRQCYVVLNKVKEFSHRVNVLQNGNDGDHSHWYPFF 291

Query: 274 CGDFNSTPRDAPYLSMTSKPIEYTGREKKVIECSTAYKFSKRRNGEIGDSDEEE----EK 329
           CGDFNS P D+PYLSMT KPIEY+ R K VIECST+Y FSK R+GE  D++EEE    EK
Sbjct: 292 CGDFNSQPFDSPYLSMTRKPIEYSKRAKTVIECSTSYTFSKMRDGEEDDAEEEEGGNIEK 351

Query: 330 KLINQPKDMVPDSFTPTIEQAKLVHQLQSLHNQLALRATSLYGLAYKIVDPSNVNINNDR 389
              +QP   VP  +     + +LV Q+QSLHN L +RA SLY +AY+ V P N  ++N+R
Sbjct: 352 FGTDQPDHPVPQHYEAKDHERELVEQMQSLHNSLDMRAVSLYSVAYRKVHPENAGLDNER 411

Query: 390 GEPEFTSWAKSWHGVLDYIMYVDNWDINEPPSEIGESLEEFEKNNQLLIKGLLKMPLNKD 449
           GEPE ++WA +W G+LDY+ ++ +WD ++   EI +SLE FE+ N L I+GLL++P  K+
Sbjct: 412 GEPEISNWAHTWRGLLDYLFFIRHWDFSD-CKEI-DSLESFERENSLKIRGLLRVPPGKE 469

Query: 450 MPFHTQPFEREYPSDHISILCEMEILD 476
           M  H QP   EYPSDH+ +LCE+E+++
Sbjct: 470 MTEHGQPHTGEYPSDHLCMLCELELVN 496

>CAGL0I02684g Chr9 complement(239316..240797) [1482 bp, 493 aa] {ON}
           similar to uniprot|Q03264 Saccharomyces cerevisiae
           YMR285c
          Length = 493

 Score =  451 bits (1161), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 224/462 (48%), Positives = 313/462 (67%), Gaps = 21/462 (4%)

Query: 22  IRKQREIFKSKKREKKLIQGEDPDHPIELSFIKRPILYLPHHGHSNRKGFKFSLMTYNCL 81
           IR +RE  +  KR++ L +G DPD P EL FI+R +L L  H     +G K  +M+YNCL
Sbjct: 43  IRAEREAMREAKRQEMLERGVDPDCPPELQFIRRNMLKL--HEEEPVEGLKIKIMSYNCL 100

Query: 82  AQAMIRREVFSDSGPALKWFRRSKVLMNEITYYNPDILCLQEIDDFQYENFWKDQLESNL 141
           AQA+IRR++F DSG ALKW+RRS+VL+NE  +Y+PD+LCLQEID  QY++FWK++ +  L
Sbjct: 101 AQALIRRKLFPDSGEALKWYRRSRVLLNEFKHYDPDVLCLQEIDYIQYQSFWKEEFQ-KL 159

Query: 142 NMNTFYYKQKIKHHGVLIAWKKSIFKQVDHMVVDFDDVKTSNIARRTITRNIAMYVALKF 201
             ++ ++++  K+HGV I WK   F+  D M++DFD  K+ +I  RT T N A+ +ALKF
Sbjct: 160 GYSSQFHRKPSKNHGVCIIWKHEKFEMSDRMLIDFDSEKSGDIEPRTTTNNAALILALKF 219

Query: 202 NDEFITKNFPNLLHSFDQNDIGFIISTTHLFWHPFGTFERTRQCYILLEKMKKFIDILNV 261
                T+    +      +  G ++ TTHLFWHPFGT+ERTRQCY++L KMK+F+  +NV
Sbjct: 220 -----TQKVKMMGKKLLDDKSGILVGTTHLFWHPFGTYERTRQCYVVLNKMKEFMHRVNV 274

Query: 262 ----KDHLKTHWYPFICGDFNSTPRDAPYLSMTSKPIEYTGREKKVIECSTAYKFSKRRN 317
                D   +HWYPF CGDFNS P D+PYLSMT KPI+Y  R K VIECST++KFSK+R 
Sbjct: 275 LQNNNDGDMSHWYPFFCGDFNSQPFDSPYLSMTCKPIKYDSRAKTVIECSTSFKFSKKR- 333

Query: 318 GEIGDSDEEEEKKLI-----NQPKDMVPDSFTPTIEQAKLVHQLQSLHNQLALRATSLYG 372
            E G+  E+EE   I     +QP+  VP+ F    EQ KLV Q++ LHN L +RA SLY 
Sbjct: 334 -ESGEDAEDEEGGNIEKFGKDQPQTPVPEKFVANDEQTKLVSQMEELHNSLDMRAVSLYS 392

Query: 373 LAYKIVDPSNVNINNDRGEPEFTSWAKSWHGVLDYIMYVDNWDINEPPSEIGESLEEFEK 432
           +AY  V P N  ++N+RGEPE ++WA +W G+LDY+  + NW+ ++  +EI ++LE+FE 
Sbjct: 393 VAYHKVHPENSGLDNERGEPEISNWAHTWRGLLDYMFMIRNWEFDD-RTEI-DTLEDFEN 450

Query: 433 NNQLLIKGLLKMPLNKDMPFHTQPFEREYPSDHISILCEMEI 474
           +N + I+GLL+MP   +M  H QP   EYPSDH+ +L E+E+
Sbjct: 451 SNNIKIRGLLRMPPGSEMSTHGQPHVGEYPSDHLCLLSEVEL 492

>NCAS0C00310 Chr3 (42498..44168) [1671 bp, 556 aa] {ON} Anc_8.850
          Length = 556

 Score =  450 bits (1158), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 228/464 (49%), Positives = 317/464 (68%), Gaps = 24/464 (5%)

Query: 21  EIRKQREIFKSKKREKKLIQGEDPDHPIELSFIKRPILYLPHHGHSNRKGFKFSLMTYNC 80
           +IR +R+     K+E  L QG DP+   +L FI+RPIL+L  H      GFK S+MTYNC
Sbjct: 108 KIRAERQA----KKEAALAQGLDPNALPDLQFIQRPILHL--HEEEPVTGFKISIMTYNC 161

Query: 81  LAQAMIRREVFSDSGPALKWFRRSKVLMNEITYYNPDILCLQEIDDFQYENFWKDQLESN 140
           LAQA+IRR++F DSG ALKWF+RSKVL NE  +YNPD++CLQEID  QY++FWK + E  
Sbjct: 162 LAQALIRRKLFPDSGDALKWFKRSKVLSNEFKHYNPDVICLQEIDHLQYQSFWKAEFEK- 220

Query: 141 LNMNTFYYKQKIKHHGVLIAWKKSIFKQVDHMVVDFDDVKTSNIARRTITRNIAMYVALK 200
           +   + +++++ K+HGV I W+K +F   D M++DFD   +  I  RT T N  + ++LK
Sbjct: 221 VGYESQFHRKQSKNHGVAIIWRKELFTLTDKMLIDFDKEPSGEIPPRTTTNNAGLALSLK 280

Query: 201 FNDEFITKNFPNLLHSFDQNDIGFIISTTHLFWHPFGTFERTRQCYILLEKMKKFIDILN 260
           F ++ ++K F N       + +G I+ TTHLFWHPFGT+ERTRQCY++L KMK+F+  +N
Sbjct: 281 FTEKALSK-FSN-----GTSRMGIIVGTTHLFWHPFGTYERTRQCYVVLNKMKEFMHRIN 334

Query: 261 V----KDHLKTHWYPFICGDFNSTPRDAPYLSMTSKPIEYTGREKKVIECSTAYKFSKRR 316
           V     D   +HWYPF CGDFNS P D PYLSMTSKPI Y GR K VIECST+YKFSK+R
Sbjct: 335 VLQNNNDGDTSHWYPFFCGDFNSQPFDTPYLSMTSKPIHYKGRAKTVIECSTSYKFSKKR 394

Query: 317 NGEIGDSDEEE---EKKLINQPKDMVPDSFTPTIEQAKLVHQLQSLHNQLALRATSLYGL 373
           +GE    +EE    EK   +QP+  VPD F    EQ KLV  ++ LHN L +RA SLYG+
Sbjct: 395 DGEEDADEEEGGNIEKFGKDQPQTPVPDHFIANEEQKKLVKNMELLHNSLDMRAISLYGV 454

Query: 374 AYKIVDPSNVNINNDRGEPEFTSWAKSWHGVLDYIMYVDNWDINEPPSEIGESLEEFEKN 433
            Y+ V P N  ++ND GEPE ++WA +W+G+LDYI+++ +W  ++   +  ++LE+FEK 
Sbjct: 455 GYRKVHPENAGLDNDCGEPEISNWAHTWNGLLDYILFIKHWGFDD--CQHVDTLEKFEKE 512

Query: 434 NQLLIKGLLKMPLNKDMP--FHTQPFEREYPSDHISILCEMEIL 475
           N + ++G L+MP + +M    H QP   EYPSDH+S++CE+E++
Sbjct: 513 NSIKVRGYLRMPPSTEMSKHGHGQPHTGEYPSDHLSMICELELI 556

>KNAG0K00650 Chr11 complement(116371..117819) [1449 bp, 482 aa] {ON}
           Anc_8.850 YMR285C
          Length = 482

 Score =  445 bits (1145), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 222/473 (46%), Positives = 317/473 (67%), Gaps = 24/473 (5%)

Query: 15  GELSQDEIRKQREIFKSKKREKKLIQGEDPDHPIELSFIKRPILYLPHHGHSNRKGFKF- 73
           G+ S++EI + R   K+K RE   +QG   D P EL FI+RP+L +   G    +G +  
Sbjct: 19  GKPSEEEIARIRAERKAK-REAAALQGAKSDIPAELRFIERPMLSVHPDGAIGAEGNRLP 77

Query: 74  -SLMTYNCLAQAMIRREVFSDSGPALKWFRRSKVLMNEITYYNPDILCLQEIDDFQYENF 132
            +LMTYNCLAQA+IRR++F DSGPALKW+RRS+VL+N+  +Y PD+LCLQE+D  Q+ +F
Sbjct: 78  VTLMTYNCLAQALIRRKLFPDSGPALKWYRRSQVLLNKFKHYEPDVLCLQEVDAVQWHSF 137

Query: 133 WKDQLESNLNMNTFYYKQKIKHHGVLIAWKKSIFKQVDHMVVDFDDVKTSNIARRTITRN 192
           W+ + E  L     ++K++ K+HGV + W+  +F   D M++DFD  ++ ++  RT T N
Sbjct: 138 WRGEFE-KLGYAAQFHKKQTKNHGVAVVWRSKLFTMADKMLIDFDKEQSGDVPPRTTTNN 196

Query: 193 IAMYVALKFNDEFITKNFPNLLHSFDQNDIGFIISTTHLFWHPFGTFERTRQCYILLEKM 252
             + +ALKF ++ +T +        D    G ++ TTHLFWHPFGTFERTRQCY++L KM
Sbjct: 197 AGLVIALKFTEQALTGH-------RDTPRSGILVGTTHLFWHPFGTFERTRQCYVVLNKM 249

Query: 253 KKFIDILNV----KDHLKTHWYPFICGDFNSTPRDAPYLSMTSKPIEYTGREKKVIECST 308
           K+F+  +NV     D    HW+PF CGDFNS P DAPYLSMTSKP+ Y+GR + VIECST
Sbjct: 250 KEFMHRVNVLQNENDGNNQHWFPFFCGDFNSQPYDAPYLSMTSKPVSYSGRARTVIECST 309

Query: 309 AYKFSKRRNGEIGDSDEEEEKKLI-----NQPKDMVPDSFTPTIEQAKLVHQLQSLHNQL 363
           +Y FSK+R+GE   +DEEEE   I     +QP   VP +F P  EQ  LVHQ+++LHN L
Sbjct: 310 SYTFSKQRDGEDAAADEEEEGGNIEIFGKDQPHHPVPATFEPNAEQCALVHQMETLHNSL 369

Query: 364 ALRATSLYGLAYKIVDPSNVNINNDRGEPEFTSWAKSWHGVLDYIMYVDNWDINEPPSEI 423
            +RA SLY + Y+ V P N   +N RGEPE ++WA +W+G+LDY+ YV +WD  +     
Sbjct: 370 DMRAVSLYSVGYRNVHPENAGADNARGEPEISNWAHTWNGLLDYLFYVGHWDFKDRTGV- 428

Query: 424 GESLEEFEKNNQLLIKGLLKMPLNKDMP--FHTQPFEREYPSDHISILCEMEI 474
            ++LEEFE+++ + +K LL+MP  ++M    H QP   EYPSDH++++C++E+
Sbjct: 429 -DTLEEFEQDSGVTVKRLLRMPSKQEMQQFGHGQPHTGEYPSDHLAMVCDLEL 480

>TPHA0I00320 Chr9 complement(61470..63059) [1590 bp, 529 aa] {ON}
           Anc_8.850 YMR285C
          Length = 529

 Score =  445 bits (1144), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 223/450 (49%), Positives = 313/450 (69%), Gaps = 17/450 (3%)

Query: 33  KREKKLIQGEDPDHPIELSFIKRPILYLPHHGHSNRKGFKFSLMTYNCLAQAMIRREVFS 92
           K++K L  G DPD P EL FI+RP+L L  H     K F F+LMTYNCLAQA+IRR++F 
Sbjct: 87  KQKKMLANGLDPDCPPELQFIRRPLLTL--HDDEPEKSFTFTLMTYNCLAQALIRRKLFP 144

Query: 93  DSGPALKWFRRSKVLMNEITYYNPDILCLQEIDDFQYENFWKDQLESNLNMNTFYYKQKI 152
           DSG A+KW+RRS+VL+NE  YYNPD++CLQEID  Q+++FW+++ +  +   + +++   
Sbjct: 145 DSGEAVKWYRRSRVLLNEFKYYNPDLICLQEIDHIQFQSFWQEEFKK-MGYASQFHRIHS 203

Query: 153 KHHGVLIAWKKSIFKQVDHMVVDFDDVKTSNIARRTITRNIAMYVALKFNDEFITKNFPN 212
           K+HGV I WK ++F+  D M++DFD   + +I  RT T N  + ++LK++D  + K +P 
Sbjct: 204 KNHGVAIVWKNNLFRLTDRMLIDFDKELSGDILPRTKTNNTGLILSLKYSDSVLAK-YPE 262

Query: 213 LLHSFDQNDIGFIISTTHLFWHPFGTFERTRQCYILLEKMKKFIDILNV----KDHLKTH 268
           L    + N  G II TTHLFWHPFGT+ERTRQC++LL K+K+F   +NV     D    H
Sbjct: 263 L---GNNNKSGIIIGTTHLFWHPFGTYERTRQCFVLLNKVKEFKKRVNVLQNNNDGNMDH 319

Query: 269 WYPFICGDFNSTPRDAPYLSMTSKPIEYTGREKKVIECSTAYKFSKRRNGEIGDSDEEE- 327
           W  F CGDFNS P D PYLS+TSKP+EY  R K VIECST+Y +SK RNG+  ++++EE 
Sbjct: 320 WTAFFCGDFNSQPFDTPYLSITSKPVEYKERAKIVIECSTSYTYSKLRNGDDDEAEDEEG 379

Query: 328 ---EKKLINQPKDMVPDSFTPTIEQAKLVHQLQSLHNQLALRATSLYGLAYKIVDPSNVN 384
              EK   +QP+  VPDS+TPT EQA LV +++SLHN L ++ATSLY + YK V P N  
Sbjct: 380 GNIEKFGKDQPQTPVPDSYTPTPEQADLVSKMESLHNSLNMKATSLYAVGYKKVHPENSG 439

Query: 385 INNDRGEPEFTSWAKSWHGVLDYIMYVDNWDINEPPSEIGESLEEFEKNNQLLIKGLLKM 444
           ++N +GEPE ++WA SW G+LDYI YVD+WD ++   +  E  E+FEK N + ++G L+M
Sbjct: 440 LDNKKGEPEISNWAHSWRGLLDYIFYVDHWDFSD--CKEVEDFEKFEKKNHMKLRGYLRM 497

Query: 445 PLNKDMPFHTQPFEREYPSDHISILCEMEI 474
           P   +M  + QP + EYPSDH+S++C++E+
Sbjct: 498 PPATEMSKYGQPHQGEYPSDHLSMMCKIEL 527

>NCAS0B00270 Chr2 (27753..29183) [1431 bp, 476 aa] {ON} Anc_8.850
          Length = 476

 Score =  441 bits (1134), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 231/465 (49%), Positives = 312/465 (67%), Gaps = 26/465 (5%)

Query: 21  EIRKQREIFKSKKREKKLIQGEDPDHPIELSFIKRPILYL----PHHGHSNRKGFKFSLM 76
           EIRKQR     + RE ++ QG DPD P EL F +RP L L    P +G S  +   FS++
Sbjct: 25  EIRKQRANKWQRIRESRMQQGLDPDIPPELQFQRRPFLTLHDNEPDNGESKHE---FSIL 81

Query: 77  TYNCLAQAMIRREVFSDSGPALKWFRRSKVLMNEITYYNPDILCLQEIDDFQYENFWKDQ 136
           TYNCLAQ +I R++F +SG ALKW RRSK ++NE+ YYNPDI+CLQEID    + FW  Q
Sbjct: 82  TYNCLAQGLIMRDMFPESGNALKWTRRSKTMINELKYYNPDIMCLQEIDFKYVKEFWSVQ 141

Query: 137 LESNLNMNTFYYKQKIKHHGVLIAWKKSIFKQVDHMVVDFDDVKTSNIARRTITRNIAMY 196
            +S L  +  ++K++ K HGV+IAW+ SIFK  D   VDFD++   +I  RT TRNI + 
Sbjct: 142 FKS-LGYSFKFFKKEKKIHGVVIAWRDSIFKFYDQCQVDFDELLAGDIPPRTKTRNIGLI 200

Query: 197 VALKFNDEFITKNFPNLLHSFDQNDIGFIISTTHLFWHPFGTFERTRQCYILLEKMKKFI 256
           VAL+F D     N P+      +   G +++TTHLFWHPFGTFERTRQCY++L +M KF+
Sbjct: 201 VALQFLDN--NNNNPS------RESHGIVVATTHLFWHPFGTFERTRQCYLMLSEMNKFL 252

Query: 257 DILNVKDHLKTHWYPFICGDFNSTPRDAPYLSMTSKPIEYTGREKKVIECSTAYKFSKRR 316
             LN    + T+WYPF+ GDFNS P+DAPY+SMT+KPI+Y    + VIECST+Y +SK+R
Sbjct: 253 SFLNEHSGI-TNWYPFLTGDFNSQPKDAPYMSMTTKPIQYHDEMRTVIECSTSYTYSKKR 311

Query: 317 NGEIGDSDEEEEKK-------LINQPKDMVPDSFTPTIEQAKLVHQLQSLHNQLALRATS 369
           NG++ D +E+E+         +  QP D  P  F PT EQA LV+ +Q LHN L  RA S
Sbjct: 312 NGDM-DVNEKEQSDSEEDEEFIKKQPTDPRPAFFQPTKEQAALVNTIQQLHNSLPFRAIS 370

Query: 370 LYGLAYKIVDPSNVNINNDRGEPEFTSWAKSWHGVLDYIMYVDNWDINEPPSEIGESLEE 429
           LY + Y+ V P N  INN RGEPEF+SW   W G+LDYI Y+  W++ +   ++ E+LE 
Sbjct: 371 LYSVGYRNVHPENSFINNTRGEPEFSSWGIHWSGLLDYIFYIKAWNLKDKNDDV-ETLET 429

Query: 430 FEKNNQLLIKGLLKMPLNKDMPFHTQPFEREYPSDHISILCEMEI 474
           FEK N L I G LK+PL K+M  H+QP+E EYPSDH++++C++++
Sbjct: 430 FEKTNTLKILGFLKLPLRKEMAHHSQPYEGEYPSDHLALMCKLQL 474

>SAKL0D01166g Chr4 (86218..87735) [1518 bp, 505 aa] {ON} similar to
           uniprot|Q03264 Saccharomyces cerevisiae YMR285C
          Length = 505

 Score =  441 bits (1135), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 225/443 (50%), Positives = 301/443 (67%), Gaps = 18/443 (4%)

Query: 38  LIQGEDPDHPIELSFIKRPILYLPHHGHSNRKGFKFSLMTYNCLAQAMIRREVFSDSGPA 97
           L  G DP+ P +L FIKRP+L L  H     KGFKF +MTYN LAQA+IRR++F  SG A
Sbjct: 73  LAHGLDPNVPPDLQFIKRPLLCL--HEEEPVKGFKFKIMTYNALAQALIRRKLFPSSGNA 130

Query: 98  LKWFRRSKVLMNEITYYNPDILCLQEIDDFQYENFWKDQLESNLNMNTFYYKQKIKHHGV 157
           +KWF+RSKVL+NE  +Y+ D+ CLQEID  QY+ FWK++ +  L   + +++   K+HGV
Sbjct: 131 VKWFKRSKVLLNEFKHYDADVHCLQEIDHIQYQAFWKEEFQ-KLGYASQFHRIGTKNHGV 189

Query: 158 LIAWKKSIFKQVDHMVVDFDDVKTSNIARRTITRNIAMYVALKFNDEFITKNFPNLLHSF 217
            I W+ S+F  VD M+VD+D   + +I  RT T+N  + +ALKF D+ + + FP    S 
Sbjct: 190 AIVWRCSLFTMVDTMLVDYDKEPSGDIPPRTTTKNAGLILALKFTDKVLNQ-FPGTKKS- 247

Query: 218 DQNDIGFIISTTHLFWHPFGTFERTRQCYILLEKMKKFIDILNV----KDHLKTHWYPFI 273
                G +I TTHLFWHPFGTFERTRQCY++L KMK+ I  +NV    +D   +HWYPFI
Sbjct: 248 -----GILIGTTHLFWHPFGTFERTRQCYVVLNKMKELIHRVNVLQNNQDRDYSHWYPFI 302

Query: 274 CGDFNSTPRDAPYLSMTSKPIEYTGREKKVIECSTAYKFSKRRNGEIGDSDEEE--EKKL 331
           CGDFNS P D PYLSMTSKP+ Y GR K VIECST++ FSK R+GE G+ +E    EK  
Sbjct: 303 CGDFNSQPFDTPYLSMTSKPVTYRGRAKTVIECSTSFTFSKLRDGEEGEDEEGGNIEKFG 362

Query: 332 INQPKDMVPDSFTPTIEQAKLVHQLQSLHNQLALRATSLYGLAYKIVDPSNVNINNDRGE 391
             QP+  VP  F  T EQ  LV Q++SLHN L +RA SLY + YK V P N  ++ND GE
Sbjct: 363 KGQPEHPVPKEFHATEEQTALVKQMESLHNSLDMRAISLYAVGYKHVHPENAGLDNDSGE 422

Query: 392 PEFTSWAKSWHGVLDYIMYVDNWDINEPPSEIGESLEEFEKNNQLLIKGLLKMPLNKDMP 451
           PE ++WA++W G+LDYI +V NW+  +  S   + ++ FE+ N + I+GLL+MP  ++M 
Sbjct: 423 PEISNWAETWRGLLDYIFFVKNWNGTDRSSV--DKIDVFERENGIKIRGLLRMPPGEEMT 480

Query: 452 FHTQPFEREYPSDHISILCEMEI 474
            H QP E EYPSDH+S++CE+E+
Sbjct: 481 KHGQPHEGEYPSDHLSMMCEIEL 503

>KAFR0L01960 Chr12 complement(370756..372291) [1536 bp, 511 aa] {ON}
           Anc_8.850 YMR285C
          Length = 511

 Score =  434 bits (1116), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 220/463 (47%), Positives = 306/463 (66%), Gaps = 21/463 (4%)

Query: 21  EIRKQREIFKSKKREKKLIQGEDPDHPIELSFIKRPILYLPHHGHSNRKGFKFSLMTYNC 80
           ++R +RE  +  K+E  L QG DPD P EL FI+RP+L L      +  GF+F +MTYNC
Sbjct: 59  KVRAEREAMRKSKQEAMLAQGLDPDLPPELQFIRRPLLALSKA--ESTAGFEFKIMTYNC 116

Query: 81  LAQAMIRREVFSDSGPALKWFRRSKVLMNEITYYNPDILCLQEIDDFQYENFWKDQLESN 140
           LAQA+IRR++F DSG A+KWFRRSKVL+NE  YY+ D++CLQE+D  Q++ FWK++ +  
Sbjct: 117 LAQALIRRKLFPDSGEAVKWFRRSKVLLNEFKYYDSDVICLQEVDRIQFQTFWKEEFD-K 175

Query: 141 LNMNTFYYKQKIKHHGVLIAWKKSIFKQVDHMVVDFDDVKTSNIARRTITRNIAMYVALK 200
           L  ++ ++ +  K+HG+ I WK+S+F   D M++D+D   + NI  RT T N+ + +ALK
Sbjct: 176 LGYDSQFHAKPSKNHGISILWKRSLFTMTDKMLIDYDKEISGNIPPRTTTNNVGLVLALK 235

Query: 201 FNDEFITKNFPNLLHSFDQNDIGFIISTTHLFWHPFGTFERTRQCYILLEKMKKFIDILN 260
           F+ + + + FPN   S      G I+ TTHLFWHPFGT+ERTRQCYI+L K K+F+  +N
Sbjct: 236 FSPKVLER-FPNTRKS------GIIVGTTHLFWHPFGTYERTRQCYIVLNKTKEFMHRVN 288

Query: 261 V----KDHLKTHWYPFICGDFNSTPRDAPYLSMTSKPIEYTGREKKVIECSTAYKFSKRR 316
           V     D +K HWY F  GDFNS P D PYLSMTSKP++Y+ R K VIECST+Y FSK R
Sbjct: 289 VLQNNNDEIKDHWYTFFGGDFNSQPFDTPYLSMTSKPVKYSNRAKTVIECSTSYTFSKSR 348

Query: 317 NGEIGDSDEEE---EKKLINQPKDMVPDSFTPTIEQAKLVHQLQSLHNQLALRATSLYGL 373
           +GE    DEE    EK   +QP   VP  F  + EQ  LV  ++ LHN L +RA SLY +
Sbjct: 349 DGEEDAEDEEGGNIEKFGKDQPATPVPSFFDASSEQQSLVANMEKLHNSLDMRAISLYSV 408

Query: 374 AYKIVDPSNVNINNDRGEPEFTSWAKSWHGVLDYIMYVDNWDINEPPSEIGESLEEFEKN 433
            Y  V   N  ++N RGEPE ++WA +W+G+LDY+  + +WD ++      +SL++FE  
Sbjct: 409 GYGTVHIENAGLDNTRGEPEISNWAHAWNGLLDYLFVIKSWDFSDKIQV--DSLKKFEDE 466

Query: 434 NQLLIKGLLKMPLNKDMP--FHTQPFEREYPSDHISILCEMEI 474
           N+L +K  LKMP   +M    H QP   EYPSDH+S++C++E+
Sbjct: 467 NELKVKAFLKMPTKAEMGKFGHGQPHVGEYPSDHLSMICKLEL 509

>NDAI0E00260 Chr5 (30097..31593) [1497 bp, 498 aa] {ON} Anc_8.850
           YML118W
          Length = 498

 Score =  430 bits (1105), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 220/476 (46%), Positives = 309/476 (64%), Gaps = 38/476 (7%)

Query: 21  EIRKQREIFKSKKREKKLIQGEDPDHPIELSFIKRPILYLPHHGHSNRKGFKFSLMTYNC 80
           +IR +RE  +  +RE ++  G +PD P EL FIKRP+L L  H     KG    +MTYNC
Sbjct: 41  KIRAEREKKRELEREYRMKHGFEPDIPSELQFIKRPLLTL--HDDDPVKGTMLKIMTYNC 98

Query: 81  LAQAMIRREVFSDSGPALKWFRRSKVLMNEITYYNPDILCLQEIDDFQYENFWKDQLESN 140
           LAQ++I+R++F  SG ALKW RRSKVL+NE+ YY+ D+L LQEID  Q++ +WK  L + 
Sbjct: 99  LAQSLIQRDLFPGSGQALKWVRRSKVLLNELKYYDSDLLSLQEIDFVQFKQYWKIVL-AK 157

Query: 141 LNMNTFYYKQKIKHHGVLIAWKKSIFKQVDHMVVDFDDVKTSNIARRTITRNIAMYVALK 200
           L  +  +YK+  K HGVLIAWK+++F +V  + +DFD+  +  I  RT T+N+ + +AL 
Sbjct: 158 LGYDCEFYKKNGKIHGVLIAWKRNLFAKVKSLPIDFDETLSGTIKPRTRTKNVGLVIAL- 216

Query: 201 FNDEFITKNFPNLLHSFDQNDIGFIISTTHLFWHPFGTFERTRQCYILLEKMKKFIDILN 260
              EF+ K+   +         G II TTHLFWH FGTFERTRQCY+++++M KF+  L 
Sbjct: 217 ---EFLNKDKSAIKKK------GVIIGTTHLFWHLFGTFERTRQCYVMMDQMDKFMKKLG 267

Query: 261 VKDHLKTHWYPFICGDFNSTPRDAPYLSMTSKPIEYTGREKKVIECSTAYKFSKRR---- 316
             +     WYPF  GDFNS P+DAPY+S+TSKP+ +    K VIECS AYK+SK+R    
Sbjct: 268 GIEK----WYPFFTGDFNSQPKDAPYVSITSKPVSFQNETKIVIECSAAYKYSKKRNGEE 323

Query: 317 ----------------NGEIGDSDEEEEKKLINQPKDMVPDSFTPTIEQAKLVHQLQSLH 360
                           +    ++DEE+E+ + NQP +  P  FTPT EQA+LV QL +LH
Sbjct: 324 EEKNEGKEKQHEIDSSDSSDAETDEEKEEIIPNQPSNARPLHFTPTREQAELVSQLAALH 383

Query: 361 NQLALRATSLYGLAYKIVDPSNVNINNDRGEPEFTSWAKSWHGVLDYIMYVDNWDINEPP 420
           N L LRA SLY + Y+ VDP N  INNDRGEPE + WA+ W G+LDYI ++ +WD  +  
Sbjct: 384 NSLNLRAISLYSVGYRKVDPENAYINNDRGEPELSEWARMWSGLLDYIFFLQHWD-GKTN 442

Query: 421 SEIGESLEEFEKNNQLLIKGLLKMPLNKDMPFHTQPFEREYPSDHISILCEMEILD 476
            E  +SL+ FE+ N + ++GLLKMP +K+M  H  P++ EYPSDH+ ++ ++E+L+
Sbjct: 443 HEKVDSLKTFERENNVKLRGLLKMPQSKEMCEHAIPYKGEYPSDHLCMMIQLELLE 498

>KLLA0C06248g Chr3 complement(552493..554043) [1551 bp, 516 aa] {ON}
           similar to uniprot|Q03264 Saccharomyces cerevisiae
           YMR285C
          Length = 516

 Score =  430 bits (1105), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 225/463 (48%), Positives = 308/463 (66%), Gaps = 18/463 (3%)

Query: 21  EIRKQREIFKSKKREKKLIQGEDPDHPIELSFIKRPILYLPH--HGHSNRKGFKFSLMTY 78
           E+R +RE  K  K+E  + QG DP  P +L FIKRP+L +P    G S R+    S+MTY
Sbjct: 63  EMRAKREAAKIAKKEALIAQGIDPKLPADLRFIKRPMLAVPRDSSGQSTREVCPISIMTY 122

Query: 79  NCLAQAMIRREVFSDSGPALKWFRRSKVLMNEITYYNPDILCLQEIDDFQYENFWKDQLE 138
           NCLAQA+IRR +F  SG A+KWF+RS+VL+NE  YYN D+LCLQEID  QY++FWK +  
Sbjct: 123 NCLAQALIRRTLFPTSGNAVKWFKRSQVLLNEFKYYNVDVLCLQEIDTVQYKSFWKMEFT 182

Query: 139 SNLNMNTFYYKQKIKHHGVLIAWKKSIFKQVDHMVVDFDDVKTSNIARRTITRNIAMYVA 198
               M  F++    K+HGVLIAWK+ +F   D M++D+D   T  I  RT T+N+ M ++
Sbjct: 183 KLGYMCQFHF-NPTKNHGVLIAWKEDLFDMTDKMLIDYDKETTGAIEPRTTTKNVGMLLS 241

Query: 199 LKFNDEFITKNFPNLLHSFDQNDIGFIISTTHLFWHPFGTFERTRQCYILLEKMKKFIDI 258
           LKF  + + K +P      D    G II TTHLFWHPFGT+ERTRQCYI+L+K+K+F + 
Sbjct: 242 LKFKKKVLEK-YP------DTKVSGIIIGTTHLFWHPFGTYERTRQCYIVLKKVKEFQNR 294

Query: 259 LNV----KDHLKTHWYPFICGDFNSTPRDAPYLSMTSKPIEYTGREKKVIECSTAYKFSK 314
           +NV    KD   +HW  F CGDFNS P DAPYLS+TSKP+EYTGR K VIECST++ FSK
Sbjct: 295 INVLQNEKDGDNSHWPAFFCGDFNSQPFDAPYLSITSKPVEYTGRAKTVIECSTSFTFSK 354

Query: 315 RRNGEIGDSDEEE--EKKLINQPKDMVPDSFTPTIEQAKLVHQLQSLHNQLALRATSLYG 372
            R+G+ G+ +E    EK    QP+  VP+SF+   EQ +L   +++LHN + +RA SLY 
Sbjct: 355 LRDGDEGEGEEGGNIEKFGKGQPETPVPESFSGNEEQKQLCENMKTLHNDIDMRAISLYS 414

Query: 373 LAYKIVDPSNVNINNDRGEPEFTSWAKSWHGVLDYIMYVDNWDINEPPSEIGESLEEFEK 432
           +AY  V P N  ++N R EPE ++WA +W G+LDY+ YV +WD  +  ++I E L  FE+
Sbjct: 415 IAYSKVHPENSGLDNKRNEPEISNWAHAWRGLLDYLYYVTSWDGCD-CTKIDE-LSTFEQ 472

Query: 433 NNQLLIKGLLKMPLNKDMPFHTQPFEREYPSDHISILCEMEIL 475
           N  + +  LL++P  K+M  H QP E EYPSDH+ ++ ++ I+
Sbjct: 473 NYGVQVLELLRIPPAKEMTEHGQPHEGEYPSDHLCMIVKLGII 515

>Kwal_27.10204 s27 complement(239835..241319) [1485 bp, 494 aa] {ON}
           YMR285C (NGL2) - DNase/RNase (putative); CCR4 C-terminal
           homolog; displays homology to drosophila Angelgene;
           homolog to ngl1 and ngl3  [contig 39] FULL
          Length = 494

 Score =  421 bits (1083), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 207/442 (46%), Positives = 292/442 (66%), Gaps = 17/442 (3%)

Query: 38  LIQGEDPDHPIELSFIKRPILYLPHHGHSNRKGFKFSLMTYNCLAQAMIRREVFSDSGPA 97
           L +G DP+ P +L FI RP+L  P   + + +GF F +MTYNCLAQA+IRR++F  SG A
Sbjct: 63  LARGLDPEFPPDLQFISRPML--PLDSNYSPEGFVFKIMTYNCLAQALIRRKLFPTSGNA 120

Query: 98  LKWFRRSKVLMNEITYYNPDILCLQEIDDFQYENFWKDQLESNLNMNTFYYKQKIKHHGV 157
           LKWF+RS+VL+NE  +Y  D+ CLQEID  QY++FWK++    L  ++ +++   K+HG+
Sbjct: 121 LKWFKRSRVLLNEFMHYKADVHCLQEIDYIQYQSFWKEEF-GKLGYDSQFHRHGTKNHGI 179

Query: 158 LIAWKKSIFKQVDHMVVDFDDVKTSNIARRTITRNIAMYVALKFNDEFITKNFPNLLHSF 217
            I WK+ +F  VD M+VD+D   + ++  RT T+N+ + +AL F+ + + K +P      
Sbjct: 180 AIVWKRDLFTMVDKMLVDYDKEPSGSLKPRTTTKNVGLVLALAFSKKVLDK-YPG----- 233

Query: 218 DQNDIGFIISTTHLFWHPFGTFERTRQCYILLEKMKKFIDILNV---KDHLKTHWYPFIC 274
             +  G ++ TTHLFWHPFGTFERTRQCY+LL KMK FI  +NV       +  WYPF C
Sbjct: 234 -TSKRGILVGTTHLFWHPFGTFERTRQCYVLLNKMKDFIHRVNVLQDGSSPEKKWYPFFC 292

Query: 275 GDFNSTPRDAPYLSMTSKPIEYTGREKKVIECSTAYKFSKRRNGEIGDSDEEE--EKKLI 332
           GDFN+ P D PYLSM+SKP+ Y  R K VIECST+Y FSK R+GE  D +E    EK   
Sbjct: 293 GDFNAQPFDTPYLSMSSKPVVYKDRAKTVIECSTSYTFSKARDGEECDDEEGGNIEKFGD 352

Query: 333 NQPKDMVPDSFTPTIEQAKLVHQLQSLHNQLALRATSLYGLAYKIVDPSNVNINNDRGEP 392
            QP+  VPD++    EQ +LV  +  LHN L +RA S+Y +AYK V P N   +N   EP
Sbjct: 353 GQPEHPVPDTYEAAPEQKELVQTMAELHNSLDMRAISVYSVAYKHVHPENAGRDNTHNEP 412

Query: 393 EFTSWAKSWHGVLDYIMYVDNWDINEPPSEIGESLEEFEKNNQLLIKGLLKMPLNKDMPF 452
           E ++WA++W G+LDYI ++  W+  +  ++  E L+ FEK N + I  LL+MP +++MP 
Sbjct: 413 EISNWAETWRGLLDYIFFIKQWNFTD--NKRPEELQTFEKENDVKILSLLRMPPSEEMPN 470

Query: 453 HTQPFEREYPSDHISILCEMEI 474
           H QP E EY SDH+S++CE+E+
Sbjct: 471 HGQPHEGEYGSDHLSLMCEIEL 492

>Ecym_4619 Chr4 (1212417..1213880) [1464 bp, 487 aa] {ON} similar to
           Ashbya gossypii ABL118W
          Length = 487

 Score =  420 bits (1080), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 208/431 (48%), Positives = 291/431 (67%), Gaps = 16/431 (3%)

Query: 48  IELSFIKRPILYLPHHGHSNRKGFKFSLMTYNCLAQAMIRREVFSDSGPALKWFRRSKVL 107
           + L FI RP+L L     +  KGF FSLMTYNCLAQ++IRR +F  SG ALKW +RS VL
Sbjct: 67  LNLEFIARPMLPL-KVTQTVHKGFSFSLMTYNCLAQSLIRRSLFPTSGRALKWTKRSMVL 125

Query: 108 MNEITYYNPDILCLQEIDDFQYENFWKDQLESNLNMNTFYYKQKIKHHGVLIAWKKSIFK 167
           + E  +YN D+LCLQEID  QY +FW ++L SNL   + +++   K HGV I WKK +F 
Sbjct: 126 LKEFKHYNADVLCLQEIDYTQYYSFWMNRL-SNLGYGSRFHRMDNKSHGVAIFWKKDLFI 184

Query: 168 QVDHMVVDFDDVKTSNIARRTITRNIAMYVALKFNDEFITKNFPNLLHSFDQNDIGFIIS 227
            +D M+++FD+  +  I  R  T N+ M +AL F+D+ + ++FP  + S      G I+ 
Sbjct: 185 WMDQMLINFDNEDSGEIEPRKTTNNVGMILALGFSDK-VKQSFPGTVKS------GIIVG 237

Query: 228 TTHLFWHPFGTFERTRQCYILLEKMKKFIDILNVKDHLK----THWYPFICGDFNSTPRD 283
           T+HLFWHPFGT+ERTRQCY++L KMK+FI  +++  +      T WYPF CGDFNS P D
Sbjct: 238 TSHLFWHPFGTYERTRQCYVILNKMKEFIHRVHLSQNEHHTDLTKWYPFFCGDFNSQPFD 297

Query: 284 APYLSMTSKPIEYTGREKKVIECSTAYKFSKRRNGEIGDSDEEEEKKLINQPKDMVPDSF 343
           APYLS+TSKP+ Y+GR K VIECS AYKF     G  G ++E+      ++P D VP+SF
Sbjct: 298 APYLSITSKPVLYSGRAKTVIECSAAYKFPDLGAGARG-ANEDGGTVGEDRPVDPVPESF 356

Query: 344 TPTIEQAKLVHQLQSLHNQLALRATSLYGLAYKIVDPSNVNINNDRGEPEFTSWAKSWHG 403
            PT E + LV +++ LHN L +RA SLY +AYK V P N  ++N+RGEPE ++WA +W G
Sbjct: 357 QPTAEVSSLVQKMEKLHNSLDMRAISLYAVAYKHVHPDNAGLDNERGEPEISNWAYTWRG 416

Query: 404 VLDYIMYVDNWDINEPPSEIGESLEEFEKNNQLLIKGLLKMPLNKDMPFHTQPFEREYPS 463
           +LDYIMY+  W  +    E+ +SLE FEK + + ++ +L+MP  K+M  H QP + EYPS
Sbjct: 417 LLDYIMYITPWQASN-NVEV-DSLESFEKLSHITVQEMLRMPPAKEMSSHGQPHDGEYPS 474

Query: 464 DHISILCEMEI 474
           DH++++C++E+
Sbjct: 475 DHLAMMCKLEV 485

>CAGL0B02387g Chr2 complement(228209..229624) [1416 bp, 471 aa] {ON}
           weakly similar to uniprot|Q03264 Saccharomyces
           cerevisiae YMR285c or uniprot|Q03210 Saccharomyces
           cerevisiae YML118w
          Length = 471

 Score =  365 bits (937), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 201/468 (42%), Positives = 272/468 (58%), Gaps = 44/468 (9%)

Query: 23  RKQREIFKSKKREKKLIQGEDPDHPIELSFIKRPILYLPHHGHSNRKGFKFSLMTYNCLA 82
           R+ R + K K RE+ L +G DPD P E  FI+RPIL +PH G +  +G   S+MTYNCLA
Sbjct: 31  REARRLKKQKLREELLSRGLDPDFPAECQFIERPILLVPH-GDNYERGLPLSIMTYNCLA 89

Query: 83  QAMIRREVFSDSGPALKWFRRSKVLMNEITYYNPDILCLQEIDDFQYENFWKDQLESNLN 142
           Q +IRRE+F +SGPALKWF RSKVL++EI +YN DI CLQEIDD QY+ FW ++L     
Sbjct: 90  QTLIRREMFPESGPALKWFVRSKVLLHEIKHYNADICCLQEIDDVQYDLFWSEEL-PKFG 148

Query: 143 MNTFYYKQKIKHHGVLIAWKKSIFKQVDHMVVDFDDVKTSNIARRTITRNIAMYVALKFN 202
             T Y+ Q  K HGV+IAWK+ +F+   HM ++FD    + I  RT T N+ + VAL F 
Sbjct: 149 YKTIYFHQDSKSHGVMIAWKEELFQLESHMNIEFDKEAPAGIQPRTRTNNVGLLVALAFT 208

Query: 203 DEFITKNFPNLLHSFDQNDIGFIISTTHLFWHPFGTFERTRQCYILLEKMKKFIDILNVK 262
           D F  +N     +    +  G II T HLFWHPFGT++RTRQC ++ +K      IL   
Sbjct: 209 DAFRARN-----NRIRTSRSGVIIGTFHLFWHPFGTYDRTRQCLVIKKK------ILEFA 257

Query: 263 DHLKTHWYPFICGDFNSTPRDAPYLSMTSKPIEYTGREKKVIECSTAYKFSKRRN----- 317
             +K  +     GDFNS P   PYL +T    +   +++  IE STAY++S+RRN     
Sbjct: 258 GTVKGDYCKMFTGDFNSQPNSVPYLVLTQPRAQLNTQQRTSIEASTAYRYSERRNLGKEY 317

Query: 318 -----------GEIGDSDEEEEKKLINQPKDMVPDSFTPTIEQAKLVHQLQSLHNQLALR 366
                       E  + + ++     N P+   PD F  T EQ +LV+ L    N + L 
Sbjct: 318 SMEEEEEEEEEEEKREYEYDQGTDPWNTPR---PDEFDSTEEQRQLVNNLIDRCNDVPLC 374

Query: 367 ATSLYGLAYKIVDPSNVNINNDRGEPEFTSWAKSWHGVLDYIMYVDNWDINEPPSEIGES 426
           ATSLY + Y  VDP+++    D  EPE +SW+  W G+LDYI YV     N+ PS    +
Sbjct: 375 ATSLYSIGYHTVDPTHI---ADHHEPELSSWSTKWAGLLDYIFYV-----NQRPS----T 422

Query: 427 LEEFEKNNQLLIKGLLKMPLNKDMPFHTQPFEREYPSDHISILCEMEI 474
              FE  N + I G L+MP +  M  H+QP+  EYPSDHIS++C +EI
Sbjct: 423 PATFETANNIAIAGYLQMPTHAQMHNHSQPYTGEYPSDHISMMCALEI 470

>Suva_13.25 Chr13 (32137..33645) [1509 bp, 502 aa] {ON} YML118W
           (REAL)
          Length = 502

 Score =  358 bits (918), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 195/478 (40%), Positives = 282/478 (58%), Gaps = 39/478 (8%)

Query: 16  ELSQDEIRKQREIFKSKKREKK---LIQGEDPDHPI-ELSFIKRPILYLPHH-----GHS 66
           +L++++++K RE    K++ ++   + QG+DPD P  +L FIKRP L+L H        S
Sbjct: 41  QLTKEQVKKIREERAQKRQSRRNSLISQGKDPDFPTPDLQFIKRPFLHLHHEIAQGSTES 100

Query: 67  NRKGFKFSLMTYNCLAQAMIRREVFSDSGPALKWFRRSKVLMNEITYYNPDILCLQEIDD 126
                   +MTYN LAQ +IRR  F  SG ALKW +RSKVL++E+  Y PDI+ LQE+D 
Sbjct: 101 TPNSLDVKIMTYNTLAQTLIRRNFFPQSGSALKWHKRSKVLVHELKTYKPDIVSLQEVD- 159

Query: 127 FQYENFWKDQLESNLNMNTFYYKQKIKHHGVLIAWKKSIFKQVDHMVVDFDDVKTSN-IA 185
           +    FW++     L  +  + +   K HG+LIAW    F+  +  ++D+D++   N I 
Sbjct: 160 YNELKFWQENFRK-LGFDLTFKRHDGKTHGLLIAWNSGKFQLENEWMLDYDNILAGNAIP 218

Query: 186 RRTITRNIAMYVALKFNDEFITKNFPNLLHSFDQNDIGFIISTTHLFWHPFGTFERTRQC 245
            RT T+NIA+  +L+       KN        D +  G I++ THLFWHPFG FER RQ 
Sbjct: 219 ARTRTKNIALIASLRL------KNIS------DPSTDGVIVANTHLFWHPFGVFERLRQS 266

Query: 246 YILLEKMKKFIDILNVKDHLKTHWYPFICGDFNSTPRDAPYLSMTSKPIEYTGREKKVIE 305
           Y++L K+++              W+  + GDFN+ P + PYL++T KP+  TG  + + E
Sbjct: 267 YLVLAKIQEIKACPKYNG-----WHSVLMGDFNTEPEEPPYLAITRKPVALTGSARVMAE 321

Query: 306 CSTAYKFSKRRNGEIGDSDEEE------EKKLINQPKDMVPDSFTPTIEQAKLVHQLQSL 359
           CS AY++SK+RNGE G  D+EE       +   NQP++  P SFT T EQ  LV QL +L
Sbjct: 322 CSLAYRYSKKRNGEEGGQDDEECDEQSRGEGRFNQPQNPKPKSFTATSEQKALVDQLVAL 381

Query: 360 HNQLALRATSLYGLAYKIVDPSNVNINNDRGEPEFTSWAKSWHGVLDYIMYVDNWDINEP 419
           HN L +R  SLYGL Y  V P N + +N  GEPE ++WA SW G+LDYI Y+++ D  E 
Sbjct: 382 HNSLHVRGVSLYGLGYGKVQPENSHESN--GEPELSNWANSWCGLLDYIFYIEHSD--EH 437

Query: 420 PSEIGESLEEFEKNNQLLIKGLLKMPLNKDMPFHTQPFEREYPSDHISILCEMEILDS 477
            +     +++FE  N L + G LKMP  K+MP H+QPFE EY SDH+S++C++  L  
Sbjct: 438 SAHDQNPVDDFENKNNLRVMGYLKMPRAKEMPKHSQPFEGEYASDHVSLMCQLRFLSG 495

>Smik_13.16 Chr13 (28600..30108) [1509 bp, 502 aa] {ON} YML118W
           (REAL)
          Length = 502

 Score =  357 bits (915), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 188/455 (41%), Positives = 280/455 (61%), Gaps = 43/455 (9%)

Query: 40  QGEDPDHPI-ELSFIKRPILYLPHHGHSN----------RKGFKFSLMTYNCLAQAMIRR 88
           QG+DPD P  +L FI+RP+L++    ++N                 +MTYN LAQ +IRR
Sbjct: 66  QGKDPDFPTPDLQFIERPLLHISSEKNANDFKSSFIQATSSSLDIKIMTYNTLAQTLIRR 125

Query: 89  EVFSDSGPALKWFRRSKVLMNEITYYNPDILCLQEIDDFQYENFWKDQLESNLNMNTFYY 148
           + F  SG ALKW +RSKVL++E+  Y PDI+ LQE+D +    FW++     L  +  + 
Sbjct: 126 DFFPQSGSALKWHKRSKVLVHELKTYTPDIVSLQEVD-YNELKFWRENFHK-LGFDLSFR 183

Query: 149 KQKIKHHGVLIAWKKSIFKQVDHMVVDFDDVKTSN-IARRTITRNIAMYVALKFNDEFIT 207
           +   K HG+L+AW    F+  +  ++D+D +   N I+ RT T+NIA+ V+L+F D   T
Sbjct: 184 RNGGKTHGLLVAWNNEKFQLDNEWMLDYDQILAGNVISARTRTKNIALIVSLRFKD---T 240

Query: 208 KNFPNLLHSFDQNDIGFIISTTHLFWHPFGTFERTRQCYILLEKMKKFIDILNVKDHLKT 267
           +N          +  G +++ THLFWHPFG FER RQ Y++L+K+++      +KD  K 
Sbjct: 241 RN---------ASTNGIVVANTHLFWHPFGVFERLRQSYLVLQKIQE------IKDFPKY 285

Query: 268 H-WYPFICGDFNSTPRDAPYLSMTSKPIEYTGREKKVIECSTAYKFSKRRNGEIGDSDEE 326
           H W+  + GDFN+ P + PYL++TSKP+  TG  + ++ECS AY++SK+RNGE  D D+E
Sbjct: 286 HGWHSLLMGDFNTEPEEPPYLAITSKPLTLTGSTRAMVECSLAYRYSKKRNGEESDQDDE 345

Query: 327 E------EKKLINQPKDMVPDSFTPTIEQAKLVHQLQSLHNQLALRATSLYGLAYKIVDP 380
           +       ++ +NQPK+  P  F  T E+  LV+QL +LHN L ++  SLYGL Y  V P
Sbjct: 346 DYDENSRGERNLNQPKNPKPKHFAATKEEKDLVNQLITLHNSLHVKGISLYGLGYGKVHP 405

Query: 381 SNVNINNDRGEPEFTSWAKSWHGVLDYIMYVDNWDINEPPSEIGESLEEFEKNNQLLIKG 440
            N   N   GEPE ++WA +W G+LDYI Y+++ D N    E  +SL  FE+NN + + G
Sbjct: 406 ENA--NEGHGEPELSNWANTWCGLLDYIFYIESDDNNSAQQE--KSLNVFEENNGVNVIG 461

Query: 441 LLKMPLNKDMPFHTQPFEREYPSDHISILCEMEIL 475
            L+MP  ++MP H+QPFE EY SDHIS++C++ + 
Sbjct: 462 YLRMPCKQEMPKHSQPFEGEYASDHISLMCQIRLF 496

>KAFR0A02860 Chr1 complement(596779..598215) [1437 bp, 478 aa] {ON}
           Anc_8.850 YMR285C
          Length = 478

 Score =  351 bits (900), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 204/470 (43%), Positives = 284/470 (60%), Gaps = 50/470 (10%)

Query: 32  KKREKKLIQGEDPDHPIELS----FIKRPILYLPHHGHSNRKGFKFSLMTYNCLAQAMIR 87
           K REKK  + E+ ++P  L+    FIKR IL LP+    +       +MTYN L+Q++IR
Sbjct: 30  KLREKKRAENEE-NNPEFLNSKYDFIKRAILQLPNVEELD-NSVDLKIMTYNTLSQSLIR 87

Query: 88  REVFSDSGPALKWFRRSKVLMNEITYYNPDILCLQEIDDFQYENFWKDQLESNLNMNTFY 147
           RE++ D+  A+KW  RSKV++NEI YYN DI+C QE+D  Q++ FW  +L S L     +
Sbjct: 88  REIYPDAHDAIKWHVRSKVILNEIKYYNCDIMCFQEVDVIQWDKFWLPEL-SKLGYEGEF 146

Query: 148 YK--QKIKHHGVLIAWKKSIFKQVDHMVVDFDDVKTSN-IARRTITRNIAMYVALKF--- 201
           YK  +  K HGV I W+ ++F+Q D + ++FDD+   N I++ T T N+ + VALKF   
Sbjct: 147 YKDFRGPKVHGVAIFWRSNLFEQFDVIKINFDDIVAGNAISKTTRTWNVGLIVALKFKSS 206

Query: 202 NDEFITKNFPNLLHSFDQNDIGFIISTTHLFWHPFGTFERTRQCYILLEKMKKFIDILNV 261
           N +F +               G +I TTHLFWHPFGTFERTRQ  ILL+K +K ID LN 
Sbjct: 207 NAKFRS---------------GIVIGTTHLFWHPFGTFERTRQLAILLKKFRKLIDNLNT 251

Query: 262 K----DHLKTHWYPFICGDFNSTPRDAPYLSMTSKPIEYTGREKKVIECSTAYKFSKRRN 317
           +    + +   W P + GDFNS P D PYLS+TSKP+  +G  K VIECSTAYKFS+RR+
Sbjct: 252 ECGHINEMSNRWLPILTGDFNSQPCDMPYLSITSKPVSASGEAKTVIECSTAYKFSRRRS 311

Query: 318 GEIGDSDE----EEEKK---------LINQPKDMVPDSFTPTIEQAKLVHQLQSLHNQLA 364
           G I  S+E    EE +            + P D  P  F  T EQ  L+ +L+ +HN + 
Sbjct: 312 GSINSSEEVDHNEETQSEKEVEEEEDEESNPIDPRPSHFEATSEQKDLIAKLEKVHNSIN 371

Query: 365 LRATSLYGLAYKIVDPSNVNINNDRGEPEFTSWAKSWHGVLDYIMYVDNWDINEPPSEIG 424
           L+ATSL+G+AYK V    +N  N   EPE +  +  W G+LDYI  ++ W  NE      
Sbjct: 372 LKATSLFGIAYKKVHSIGLNCKN---EPELSHTSIFWTGLLDYIFILEPW--NEVEKTDW 426

Query: 425 ESLEEFEKNNQLLIKGLLKMPLNKDMPFHTQPFEREYPSDHISILCEMEI 474
            SLE+FEK   L +KGLLKMP  K++P + QP + +YPSDH+S++C++ +
Sbjct: 427 GSLEDFEKRMSLRVKGLLKMPEMKELPKNVQPHQGQYPSDHLSMICDLNV 476

>YML118W Chr13 (32334..33851) [1518 bp, 505 aa] {ON}  NGL33'-5'
           exonuclease specific for poly-A RNAs; has a domain
           similar to a magnesium-dependent endonuclease motif in
           mRNA deadenylase Ccr4p; similar to Ngl1p and Ngl2p
          Length = 505

 Score =  350 bits (899), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 197/483 (40%), Positives = 289/483 (59%), Gaps = 49/483 (10%)

Query: 16  ELSQDEIRKQREIFKSKK--REKKLI-QGEDPDHPI-ELSFIKRPILYLPHHGHSNRKGF 71
           +LS D+I+K RE    K+  R   LI QG+DPD P  +L FI+RP L +    H N KG 
Sbjct: 39  QLSVDQIKKIREERAQKRQVRRNSLISQGKDPDFPTPDLQFIERPFLPI---NHDNSKGL 95

Query: 72  K------------FSLMTYNCLAQAMIRREVFSDSGPALKWFRRSKVLMNEITYYNPDIL 119
                          +MTYN LAQ +IRR+ F +SGPALKW +RSKVL++E+  Y PD++
Sbjct: 96  TPATIQVTQDSLDVKIMTYNTLAQTLIRRDFFPESGPALKWHKRSKVLVHELKKYRPDVV 155

Query: 120 CLQEIDDFQYENFWKDQLESNLNMNTFYYKQKIKHHGVLIAWKKSIFKQVDHMVVDFDDV 179
            LQE+ D+   NFW++     L  +  + + + K HG+L+AW    F+  +  ++D+D++
Sbjct: 156 SLQEV-DYNELNFWQENFHK-LGFDVIFKRHEGKTHGLLVAWNNKKFQLDNDWMLDYDNI 213

Query: 180 KTSN-IARRTITRNIAMYVALKFNDEFITKNFPNLLHSFDQNDIGFIISTTHLFWHPFGT 238
              N I+ RT T+NIA+ ++L F    IT          D +  G I++ THLFWHPFG 
Sbjct: 214 LAGNVISARTRTKNIALIISLYFKG--IT----------DSSSRGIIVANTHLFWHPFGV 261

Query: 239 FERTRQCYILLEKMKKFIDILNVKDHLKTHWYPFICGDFNSTPRDAPYLSMTSKPIEYTG 298
           FER RQ Y++L+K+++              W+  + GDFN+ P + PYL++T +P+   G
Sbjct: 262 FERLRQSYLVLQKIQEIKACSKYNG-----WHSLLMGDFNTEPEEPPYLAITKRPLILKG 316

Query: 299 REKKVIECSTAYKFSKRRNGEIGDSDEEE--EKKL----INQPKDMVPDSFTPTIEQAKL 352
             + ++ECS AY++SK+RNGE  D D+EE  EK       +QP++  P+SFT T E+  L
Sbjct: 317 PIRAMVECSLAYRYSKKRNGEESDQDDEECDEKSRGEGHSDQPQNPKPESFTATKEEKAL 376

Query: 353 VHQLQSLHNQLALRATSLYGLAYKIVDPSNVNINNDRGEPEFTSWAKSWHGVLDYIMYVD 412
           V+QL +LHN L ++  SLYG+ Y  V P N   N   GEP  ++WA +W G+LDYI Y++
Sbjct: 377 VNQLVALHNSLHVKGVSLYGIGYGKVHPENA--NGSHGEPGLSNWANTWCGLLDYIFYIE 434

Query: 413 NWDINEPPSEIGESLEEFEKNNQLLIKGLLKMPLNKDMPFHTQPFEREYPSDHISILCEM 472
             D N+   +  E L  FE NN + I G L+MP  ++MP H+QPFE EY SDHIS++C++
Sbjct: 435 G-DHNQDTRQ-KEPLNAFEGNNNVKIIGYLRMPCAQEMPKHSQPFEGEYASDHISLMCQI 492

Query: 473 EIL 475
            + 
Sbjct: 493 RLF 495

>Skud_13.23 Chr13 (32056..33552) [1497 bp, 498 aa] {ON} YML118W
           (REAL)
          Length = 498

 Score =  339 bits (869), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 189/476 (39%), Positives = 282/476 (59%), Gaps = 49/476 (10%)

Query: 21  EIRKQREIFKSKKREKKLIQGEDPDHPI-ELSFIKRPILYLPHHGHSNRK---------G 70
           +IR++R   +  +R   + QG+DPD P  +L FI+RP L++      + K          
Sbjct: 49  KIREERAQRRQSRRNSLISQGKDPDFPTPDLQFIERPFLHVYREVSQDSKTSGMQVPPSS 108

Query: 71  FKFSLMTYNCLAQAMIRREVFSDSGPALKWFRRSKVLMNEITYYNPDILCLQEID----D 126
               +MTYN LAQ +IRR+ F  SG ALKW +RSKVL++E+  Y PDI+ LQE+D     
Sbjct: 109 LDVQIMTYNTLAQTLIRRDFFPQSGSALKWHKRSKVLVHELKTYKPDIVSLQEVDYNELG 168

Query: 127 FQYENFWKDQLESNLNMNTFYYKQKIKHHGVLIAWKKSIFKQVDHMVVDFDDVKTSN-IA 185
           F +ENF K      L   + + + + K HG+++AW    F+Q +  ++D+D +   N I+
Sbjct: 169 FWHENFHK------LGFGSTFRRHEGKTHGLMVAWNNEKFQQDNEWMLDYDTILAGNAIS 222

Query: 186 RRTITRNIAMYVALKFNDEFITKNFPNLLHSFDQNDIGFIISTTHLFWHPFGTFERTRQC 245
            RT T+NIA+ V+L        KN  NL  S      G I++ THLFWHPFG FER RQ 
Sbjct: 223 ARTRTKNIALIVSLS------VKNMTNLSTS------GVIVANTHLFWHPFGVFERLRQS 270

Query: 246 YILLEKMKKFIDILNVKDHLKTH-WYPFICGDFNSTPRDAPYLSMTSKPIEYTGREKKVI 304
           +++L+K+++      +K   K + W+  + GDFN+ P + PY+++T +P+  TG  + + 
Sbjct: 271 FLVLKKIEE------IKTCPKYYGWHSLLMGDFNTEPEEPPYMAITRRPLTLTGSARAMT 324

Query: 305 ECSTAYKFSKRRNGEIGDSDEEEEKKLI-----NQPKDMVPDSFTPTIEQAKLVHQLQSL 359
           ECS AY++SK RNGE  D DEE +++       +QP++  P  F  T EQ  LV+QL +L
Sbjct: 325 ECSLAYRYSKMRNGEESDQDEECDEESTGEGQHDQPQNPKPKYFVATKEQKNLVNQLVAL 384

Query: 360 HNQLALRATSLYGLAYKIVDPSNVNINNDRGEPEFTSWAKSWHGVLDYIMYVDNWDINEP 419
           HN L ++  SLYGL+Y  V P N   N+  GEPE ++WA +W G+LDYI Y++  D    
Sbjct: 385 HNSLHVKGISLYGLSYGKVHPDNSKENH--GEPELSNWANTWCGLLDYIFYIERND--NV 440

Query: 420 PSEIGESLEEFEKNNQLLIKGLLKMPLNKDMPFHTQPFEREYPSDHISILCEMEIL 475
            S   E ++ FE  N + I G L+MP  ++MP H+QPFE EY SDHIS++C++ + 
Sbjct: 441 SSSKDEPVKNFEDQNNVKIIGYLRMPRAEEMPKHSQPFEGEYASDHISLMCQLRLF 496

>KNAG0G03470 Chr7 complement(743425..744825) [1401 bp, 466 aa] {ON}
           Anc_8.850 YMR285C
          Length = 466

 Score =  322 bits (824), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 183/477 (38%), Positives = 276/477 (57%), Gaps = 39/477 (8%)

Query: 15  GELSQDEIRKQREIFKSKKREKKLIQGEDPDHPIELSFIKRPILYLPHHGH-SNRKGF-K 72
            E++ + I + R + + +KRE++  +  D    I   FIKRP+L +P+ G    R G+ +
Sbjct: 10  SEITPEYIERIRAL-RREKREREKAERADVAREI---FIKRPLLEVPYVGGVPCRDGYVR 65

Query: 73  FSLMTYNCLAQAMIRREVFSDSGPALKWFRRSKVLMNEITYYNPDILCLQEIDDFQYENF 132
             +MTYN LAQ +IRR  F D+  A+KW RRS+VL+ E+ YY+ D++CLQE D  Q++ F
Sbjct: 66  VKIMTYNTLAQTLIRRTTFPDAKDAIKWHRRSQVLIQELEYYDADVVCLQETDRIQWDKF 125

Query: 133 WKDQLESNLNMNTFYYKQKIKHHGVLIAWKKSIFKQ--VDHMVVDFDD-VKTSNIARRTI 189
           W ++ +  L     ++    K HGV I WK S+F+   +D + +  DD V   +IA  T 
Sbjct: 126 WVEEFD-RLGYKGGFFNFPGKVHGVAIVWKTSMFEDTPLDKLPLCLDDYVAGDDIAATTG 184

Query: 190 TRNIAMYVALKFNDEFITKNFPNLLHSFDQNDIGFIISTTHLFWHPFGTFERTRQCYILL 249
           TR +A+ VAL+      ++                I STTHLFWH FGTFERTRQ +++L
Sbjct: 185 TRTVALAVALRLKHHKTSR--------------PIIFSTTHLFWHLFGTFERTRQLFVIL 230

Query: 250 EKMKKFI-DILNVKDHLKTHWYPFICGDFNSTPRDAPYLSMTSKPIEYTGREKKVIECST 308
            ++ KFI  + +         Y F  GDFNS P DAPYLS+T KP++  GR K +IECS 
Sbjct: 231 SELNKFIKKVTDAHCPRGQRCYTFFTGDFNSQPCDAPYLSLTDKPVQLKGRAKSIIECSL 290

Query: 309 AYKFSKRRNGEIGD---------SDEEEEKKLINQPKDMVPDSFTPTIEQAKLVHQLQSL 359
           +Y++SKRRN  + D         SD+E  +   N+P+D  P ++    EQ + V  LQ+L
Sbjct: 291 SYRYSKRRNSILEDDEDSMVREPSDQESVEDETNRPQDPRPYTYDAMPEQVERVQHLQNL 350

Query: 360 HNQLALRATSLYGLAYKIVDPSNVN--INNDRGEPEFTSWAKSWHGVLDYIMYVDNWDIN 417
           HN + L+  SLYG+ Y +V P N N    +   EP+ +  A  W G+LDYI  +  W  +
Sbjct: 351 HNCIPLQGVSLYGIGYHLVHPENSNKYSTSVNQEPQLSHRALHWSGLLDYIFLITEW--S 408

Query: 418 EPPSEIGESLEEFEKNNQLLIKGLLKMPLNKDMPFHTQPFEREYPSDHISILCEMEI 474
           E  ++I + L+  E+   + I G L+MPL ++M  HT+P E EYPSDH++++C++ +
Sbjct: 409 ENATKISD-LQALERQTGIKINGYLRMPLKEEMCDHTEPHENEYPSDHLAMMCDISL 464

>KAFR0K00670 Chr11 complement(148398..150785) [2388 bp, 795 aa] {ON}
           Anc_7.78 YAL021C
          Length = 795

 Score = 79.0 bits (193), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 68/234 (29%), Positives = 104/234 (44%), Gaps = 38/234 (16%)

Query: 73  FSLMTYNCLAQAMIRREVFSDSGP-ALKWFRRSKVLMNEITYYNPDILCLQEIDDFQYEN 131
           F++++YN L Q     +++  +   AL+W  R + L  +I  Y  DILCLQE++   YE+
Sbjct: 466 FTILSYNTLCQHYATPKMYRYTPSWALRWDYRREKLKEQILSYGCDILCLQEVESKTYED 525

Query: 132 FWKDQLESNLNMNTFYYKQKIKH---------HGVLIAWKKSIFKQVDHMVVDFDDV--- 179
           FW   LE N     F+ K + K           G  + +KKS FK +    +DF      
Sbjct: 526 FWAPLLEKNGYTGYFHCKTRAKTMQAKDSKKVDGCCVFYKKSKFKLITKEALDFSGAWQK 585

Query: 180 -----KTSNIARRTITR-NIAMYVALKFNDEFITKNFPNLLHSFDQNDIGFIISTTHLFW 233
                +T +   R + + N+A+Y+ L+                  Q+     + TTHL W
Sbjct: 586 HKRFQRTEDYLNRAMNKDNVAIYMKLQ----------------HVQSGEYLWVVTTHLHW 629

Query: 234 HPFGTFERTRQCYILLEKMKKFIDILNVKDHLKTHWYP-FICGDFNSTPRDAPY 286
            P     +T Q  +LL+ M+  I   N K  +K   +P  I GDFNS    A Y
Sbjct: 630 DPKFNDVKTFQVGVLLDHMESIIKEENPKQDVKK--FPIIITGDFNSYLTSAVY 681

>Kwal_26.7112 s26 complement(221318..223546) [2229 bp, 742 aa] {ON}
           YAL021C (CCR4) - 95 kDa containng leucine rich tandem
           repeats [contig 47] FULL
          Length = 742

 Score = 75.9 bits (185), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 93/347 (26%), Positives = 135/347 (38%), Gaps = 83/347 (23%)

Query: 65  HSNRKGFK--FSLMTYNCLAQ--AMIRREVFSDSGPALKWFRRSKVLMNEITYYNPDILC 120
           H NR+  K  F+L++YN L Q  A  +   F+ S  AL W  R + L  +I YY+ DI+C
Sbjct: 400 HLNRETAKKSFTLLSYNTLCQHYATPKMYRFTPSW-ALSWDYRREKLKEQILYYSTDIIC 458

Query: 121 LQEIDDFQYENFWKDQLESNLNMNTFYYKQKI---------KHHGVLIAWKKSIFKQVDH 171
           LQE++   YE+FW   L        F+ K +          K  G  + ++ S FK +  
Sbjct: 459 LQEVECKTYEDFWAPLLREEGYTGIFHAKTRARTMQGKDSKKVDGCCLFYRDSEFKLIFK 518

Query: 172 MVVDFDDV--------KTSNIARRTITR-NIAMYVALKFNDEFITKNFPNLLHSFDQNDI 222
             VDF  V        +T +   R + + N+A+ V L+             L S +    
Sbjct: 519 DTVDFSSVWMKHKKFQRTEDYLNRAMNKDNVALLVKLQH------------LKSGEH--- 563

Query: 223 GFIISTTHLFWHPFGTFERTRQCYILLEKMKKFI---DILNVKDHLKTHWYP-FICGDFN 278
               +TTHL W P     +T Q  +LL+ M+K I      N    LK    P  ICGDFN
Sbjct: 564 -VWAATTHLHWDPQFNDVKTFQVGVLLDHMEKVIKEHSGYNNSQELKK--VPVIICGDFN 620

Query: 279 STPRDAPYLSMTSKPI----EYTGRE---------------KKVIECSTAYKFSK----- 314
           S    A Y  +++  +    +  GR+               K   EC     F+      
Sbjct: 621 SQVDSAVYELLSTGSVRQHCDIEGRDFGFMSQKNYAHNLPLKSSYECIGELPFTNLTPTY 680

Query: 315 --------------RRNGEIGDSDEEEEKKLINQPKDMVPDSFTPTI 347
                         R  G +G  D +   K I  P D  P    P +
Sbjct: 681 TDVIDYIWYSSQGLRVRGVLGQIDPDYASKFIGFPNDKFPSDHIPLL 727

>CAGL0H06149g Chr8 complement(598643..601264) [2622 bp, 873 aa] {ON}
           similar to uniprot|P31384 Saccharomyces cerevisiae
           YAL021c CCR4
          Length = 873

 Score = 75.1 bits (183), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 72/240 (30%), Positives = 108/240 (45%), Gaps = 30/240 (12%)

Query: 73  FSLMTYNCLAQAMIRREVFSDSGP-ALKWFRRSKVLMNEITYYNPDILCLQEIDDFQYEN 131
           F++++YN L Q     +++  +   AL W  R + L  +I  +N DI+CLQE++   +E+
Sbjct: 538 FTMLSYNTLCQHYATPKMYRYTPSWALSWDYRREKLKEQILNFNTDIICLQEVEAKTFED 597

Query: 132 FWKDQLESNLNMNTFYYKQKIKH---------HGVLIAWKKSIFKQVDHMVVDFDDV--K 180
           FW+  LE +     F+ K + K           G    +K S FK +    VDF  +  K
Sbjct: 598 FWQPLLEKHGYTGLFHAKTRAKTMQSKDSKKVDGCCAFYKTSKFKMLFKECVDFSGLWMK 657

Query: 181 TSNIARRTITRNIAMYVALKFNDEFITKNFPNLLHSFDQNDIGFIISTTHLFWHPFGTFE 240
                R     N AM    K N   + K     L      +I +++ TTHL W P     
Sbjct: 658 HKKFQRTEDYLNRAMN---KDNVAIVMK-----LQHIQSGEIMWLV-TTHLHWDPKFNDV 708

Query: 241 RTRQCYILLEKMKKFIDILNVKDHLKTHWYPF-ICGDFNSTPRDAPYLSMTSKPIEYTGR 299
           +T Q  +LL+ M+  +   N K  +K   YP  ICGD NS      YLS +   +  TGR
Sbjct: 709 KTFQVGVLLDHMETLLKEQNPKQDVKK--YPLVICGDLNS------YLSSSVYELFSTGR 760

>NDAI0H02520 Chr8 (614487..617183) [2697 bp, 898 aa] {ON} Anc_7.78
          Length = 898

 Score = 74.3 bits (181), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 84/338 (24%), Positives = 130/338 (38%), Gaps = 74/338 (21%)

Query: 73  FSLMTYNCLAQAMIRREVFSDSGP-ALKWFRRSKVLMNEITYYNPDILCLQEIDDFQYEN 131
           F++++YN L Q     +++  +   AL W  R + L  +I  Y  DILCLQE++   +E 
Sbjct: 569 FTILSYNTLCQHYATPKMYRYTPSWALSWDYRREKLKEQILSYQSDILCLQEVESKTFEE 628

Query: 132 FWKDQLESNLNMNTFYYKQKIKH---------HGVLIAWKKSIFKQVDHMVVDFDDV--- 179
           FW   LE       F+ K + K           G  I +KKS FK +    +DF      
Sbjct: 629 FWGPLLEKYDYQGVFHIKTRAKTMQTKESKKVDGCCIFFKKSKFKLLAKEAMDFSGTWMK 688

Query: 180 -----KTSNIARRTITR-NIAMYVALKFNDEFITKNFPNLLHSFDQNDIGFIISTTHLFW 233
                +T +   R + + N+A+Y+ L+               S    +  +++ TTHL W
Sbjct: 689 HKKFQRTEDYLNRAMNKDNVALYMKLQ---------------SITSGETVWVV-TTHLHW 732

Query: 234 HPFGTFERTRQCYILLEKMKKFIDILNVKDHLKTHWYPFICGDFNSTPRDAPY-LSMTSK 292
            P     +T Q  ILL+ M+  +   N K  +K      ICGD NS    A Y L  T +
Sbjct: 733 DPKFNDVKTFQVGILLDHMETLLKEENPKQDVKKANV-VICGDLNSYLDSAVYELFTTGR 791

Query: 293 PIEYT---GRE---------------KKVIECSTAYKF-------------------SKR 315
            + +    GR+               K    C     F                   S R
Sbjct: 792 VVNHQDNKGRDFGYMTQKHFAHNLSLKSSYNCIGELPFTNFTPSFTDVIDYIWFSTQSLR 851

Query: 316 RNGEIGDSDEEEEKKLINQPKDMVPDSFTPTIEQAKLV 353
             G +G+ D +   K +  P D  P    P + + + V
Sbjct: 852 VRGLLGEVDPDYAAKFVGFPNDKFPSDHIPLLARFEFV 889

>KNAG0D04840 Chr4 (874511..876850) [2340 bp, 779 aa] {ON} Anc_7.78
           YAL021C
          Length = 779

 Score = 73.9 bits (180), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 65/242 (26%), Positives = 110/242 (45%), Gaps = 36/242 (14%)

Query: 73  FSLMTYNCLAQAMIRREVFSDSGP-ALKWFRRSKVLMNEITYYNPDILCLQEIDDFQYEN 131
           F++++YN L Q     +++  +   AL W  R   L ++I  Y+ DI+CLQE++   +E+
Sbjct: 435 FTVLSYNTLCQHYATPKMYRYTPSWALSWEYRRAKLRDQILSYSCDIMCLQEVEARTFED 494

Query: 132 FWKDQLESNLNMNTFYYKQKIK--HH-------GVLIAWKKSIFKQVDHMVVDFDDV--- 179
           FW   LE +    +F+ K + K   H       G  + +K++ F+ +    VDF      
Sbjct: 495 FWLPLLEKHGYSGSFHAKTRAKLLQHRDSKKVDGCCVFFKRTKFRLIKKEEVDFSSTWMK 554

Query: 180 -----KTSNIARRTITR-NIAMYVALKFNDEFITKNFPNLLHSFDQNDIGFIISTTHLFW 233
                +T +   R + + NIA+Y  L+              H      I   ++TTHL W
Sbjct: 555 HEKFQRTEDFLNRAMNKDNIALYFKLQ--------------HIASGEHI--WVATTHLHW 598

Query: 234 HPFGTFERTRQCYILLEKMKKFIDILNVKDHLKTHWYPFICGDFNSTPRDAPYLSMTSKP 293
            P     +T Q  +LL+ ++  I   N +  +K      ICGDFNS    A Y  ++S  
Sbjct: 599 DPKFNDVKTFQVGVLLDHLQTLIRQDNPRQDVKKAPV-IICGDFNSYIDSAVYELLSSGS 657

Query: 294 IE 295
           ++
Sbjct: 658 VK 659

>Ecym_7354 Chr7 (736001..738358) [2358 bp, 785 aa] {ON} similar to
           Ashbya gossypii ACR288W
          Length = 785

 Score = 73.9 bits (180), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 72/248 (29%), Positives = 105/248 (42%), Gaps = 45/248 (18%)

Query: 63  HGHSNRKGFK--FSLMTYNCLAQ--AMIRREVFSDSGPALKWFRRSKVLMNEITYYNPDI 118
           + H N+   K  F+L++YN L Q  A  +   F  S  AL W  R + L  E+  Y  D+
Sbjct: 433 NSHVNQDTLKRSFTLLSYNTLCQHYATPKMYRFVPSW-ALSWDYRREKLKEEVLSYQTDV 491

Query: 119 LCLQEIDDFQYENFWKDQLESNLNMNTFYYKQKI---------KHHGVLIAWKKSIFKQV 169
           +CLQE++   YE FW   LE       F+ K +          K  G  I +K S F  +
Sbjct: 492 ICLQEVESKTYEEFWLPLLEKQGYSGVFHAKTRARTMQVKDAKKVDGCCIFYKNSEFSCI 551

Query: 170 DHMVVDFDDV--------KTSNIARRTITR-NIAMYVALKFNDEFITKNFPNLLHSFDQN 220
               +DF  V        +T +   R + + NIA+ V LK              H     
Sbjct: 552 FKDAIDFSSVWMKHKKFQRTEDYLNRAMNKDNIALIVKLK--------------HELSGE 597

Query: 221 DIGFIISTTHLFWHPFGTFERTRQCYILLEKMKKFI----DILNVKDHLKTHWYPFICGD 276
            +  +  TTHL W P     +T Q  +LL+ ++K +    +I N ++  K      ICGD
Sbjct: 598 HVWVV--TTHLHWDPHFNDVKTFQVGVLLDYIEKLLKQQSNIGNPQEKKKVPL--IICGD 653

Query: 277 FNSTPRDA 284
           FNS    A
Sbjct: 654 FNSQSHSA 661

>SAKL0B10032g Chr2 (853065..855260) [2196 bp, 731 aa] {ON} similar
           to uniprot|P31384 Saccharomyces cerevisiae YAL021C CCR4
           Component of the CCR4-NOT transcriptional complex which
           is involved in regulation of gene expression component
           of the major cytoplasmic deadenylase which is involved
           in mRNA poly(A) tail shortening
          Length = 731

 Score = 73.6 bits (179), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 67/243 (27%), Positives = 110/243 (45%), Gaps = 37/243 (15%)

Query: 73  FSLMTYNCLAQAMIRREVFSDSGP-ALKWFRRSKVLMNEITYYNPDILCLQEIDDFQYEN 131
           F+L++YN L Q     +++  +   AL W  R   L  +I  +  D++CLQE++   +E+
Sbjct: 399 FTLLSYNTLCQHYATPKMYRYTPSWALSWDYRRDKLKEQIISFQADVVCLQEVECKTFED 458

Query: 132 FWKDQLESNLNMNTFYYKQKI---------KHHGVLIAWKKSIFKQVDHMVVDFDDV--- 179
           FW   L+ +     F+ K +          K  G  + +K S FK V    VDF  V   
Sbjct: 459 FWAPFLQKHGYTGVFHAKTRARTMQSKDSKKVDGCCVFYKNSEFKLVFKDAVDFSSVWMK 518

Query: 180 -----KTSNIARRTITR-NIAMYVALKFNDEFITKNFPNLLHSFDQNDIGFIISTTHLFW 233
                +T +   R + + N+A++V L+             L + +Q      ++TTHL W
Sbjct: 519 HKKFQRTEDYLNRAMNKDNVALFVKLQH------------LKTNEQ----IWVTTTHLHW 562

Query: 234 HPFGTFERTRQCYILLEKMKKFI-DILNVKDHLKTHWYPF-ICGDFNSTPRDAPYLSMTS 291
            P     +T Q  +LL+ M+K + D   V ++ +    P  ICGDFNS    A Y   +S
Sbjct: 563 DPQFNDVKTFQVGVLLDYMEKLLRDQNGVGNNQEMKKVPLVICGDFNSQLDSAVYELFSS 622

Query: 292 KPI 294
             +
Sbjct: 623 GTV 625

>KLTH0D02310g Chr4 complement(230632..232851) [2220 bp, 739 aa] {ON}
           similar to uniprot|P31384 Saccharomyces cerevisiae
           YAL021C CCR4 Component of the CCR4-NOT transcriptional
           complex which is involved in regulation of gene
           expression component of the major cytoplasmic
           deadenylase which is involved in mRNA poly(A) tail
           shortening
          Length = 739

 Score = 72.4 bits (176), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 73/247 (29%), Positives = 108/247 (43%), Gaps = 41/247 (16%)

Query: 64  GHSNRKGFK--FSLMTYNCLAQ--AMIRREVFSDSGPALKWFRRSKVLMNEITYYNPDIL 119
            H +R+  K  F++++YN L Q  A  +   F+ S  AL W  R + L  +I  YN DI+
Sbjct: 397 AHQSRETLKKSFTILSYNTLCQHYATPKMYRFTPSW-ALSWEYRREKLKEQILSYNTDIV 455

Query: 120 CLQEIDDFQYENFWKDQLE---------SNLNMNTFYYKQKIKHHGVLIAWKKSIFKQVD 170
           CLQE++   YE+FW   L          +     T + K   K  G    +K S FK + 
Sbjct: 456 CLQEVECKTYEDFWAPLLREKGYSGIFHTKTRARTMHSKDSKKVDGCCFFYKDSEFKLMF 515

Query: 171 HMVVDFDDV--------KTSNIARRTITR-NIAMYVALKFNDEFITKNFPNLLHSFDQND 221
              VDF  V        +T +   R + + N+A+ V L+             + S +   
Sbjct: 516 KEAVDFSSVWMKHKKFQRTEDYLNRAMNKDNVALVVKLQH------------IKSGEH-- 561

Query: 222 IGFIISTTHLFWHPFGTFERTRQCYILLEKMKKFI-DILNVKDHLKTHWYP-FICGDFNS 279
                +TTHL W P     +T Q  +LL+ M+K I +  N  +  +    P  ICGDFNS
Sbjct: 562 --VWAATTHLHWDPQFNDVKTFQVGVLLDYMEKVIKEQNNCNNTQELKKVPVVICGDFNS 619

Query: 280 TPRDAPY 286
               A Y
Sbjct: 620 QTNSAVY 626

>Kpol_1040.14 s1040 complement(42093..44447) [2355 bp, 784 aa] {ON}
           complement(42093..44447) [2355 nt, 785 aa]
          Length = 784

 Score = 72.4 bits (176), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 66/244 (27%), Positives = 109/244 (44%), Gaps = 37/244 (15%)

Query: 73  FSLMTYNCLAQAMIRREVFSDSGP-ALKWFRRSKVLMNEITYYNPDILCLQEIDDFQYEN 131
           F++++YN L Q     +++  +   AL W  R + L ++I  +  D++CLQE++   YE 
Sbjct: 452 FTVLSYNTLCQHYATPKMYRYTPSWALSWDYRREKLKDQILSFKSDVICLQEVESKSYEE 511

Query: 132 FWKDQLESNLNMNTFYYKQKIKH---------HGVLIAWKKSIFKQVDHMVVDFDDV--- 179
           FW   L+ N    TFY K + K           G  I +K+S F  +    VDF  V   
Sbjct: 512 FWLPLLQKNGYAGTFYAKTRAKTMQTKDSKKVDGCCIFYKESEFNVLYKDSVDFSGVWMK 571

Query: 180 -----KTSNIARRTITR-NIAMYVALKFNDEFITKNFPNLLHSFDQNDIGFIISTTHLFW 233
                +T +   R + + N+A+Y+ L    E I            ++     + TTHL W
Sbjct: 572 HKKFQRTEDYLNRAMNKDNVALYMKL----EHI------------KSGESVWVVTTHLHW 615

Query: 234 HPFGTFERTRQCYILLEKMKKFI-DILNVKDHLKTHWYP-FICGDFNSTPRDAPYLSMTS 291
            P     +T Q  ILL+ +++ + D  N     +    P  ICGD NS    A Y  +++
Sbjct: 616 DPQFNDVKTFQVGILLDHLEELLKDNNNASSKQEIRKCPVIICGDLNSHLDSAVYELLST 675

Query: 292 KPIE 295
             ++
Sbjct: 676 GHVQ 679

>Skud_1.40 Chr1 complement(86326..88935) [2610 bp, 869 aa] {ON}
           YAL021C (REAL)
          Length = 869

 Score = 71.6 bits (174), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 81/338 (23%), Positives = 133/338 (39%), Gaps = 79/338 (23%)

Query: 73  FSLMTYNCLAQAMIRREVFSDSGP-ALKW-FRRSKVLMNEITYYNPDILCLQEIDDFQYE 130
           FS+++YN L Q     +++  +   AL W +RRSK L  +I  Y+ D+LCLQE++   +E
Sbjct: 537 FSVLSYNTLCQHYATPKMYRYTPSWALTWDYRRSK-LKEQILSYDSDVLCLQEVESKTFE 595

Query: 131 NFWKDQLESNLNMNTFYYKQKIKH---------HGVLIAWKKSIFKQVDHMVVDFDDV-- 179
           ++W   L+ +     FY K + K           G  I +K+  FK V    +DF     
Sbjct: 596 DYWVPLLDKHGYTGIFYAKARAKTMHSKDSKKVDGCCIFFKRDQFKLVTKDAMDFSGAWM 655

Query: 180 ------KTSNIARRTITR-NIAMYVALKFNDEFITKNFPNLLHSFDQNDIGFIISTTHLF 232
                 +T +   R + + N+A+++ L+                    D  +++ TTHL 
Sbjct: 656 KHKKFQRTEDYLNRAMNKDNVALFLKLQH---------------VSSGDTIWVV-TTHLH 699

Query: 233 WHPFGTFERTRQCYILLEKMKKFI---DILNVKDHLKTHWYPFICGDFNSTPRDAPYLSM 289
           W P     +T Q  +LL+ ++  +      N +  +K      ICGDFNS    A Y  +
Sbjct: 700 WDPKFNDVKTFQVGVLLDHLESLLKEDTTHNSRQDIKKSPV-LICGDFNSYINSAVYELI 758

Query: 290 TSKPI----EYTGRE---------------KKVIECSTAYKFSK---------------- 314
           ++  +    E  GR+               K    C     F+                 
Sbjct: 759 STGRVQVHQEGNGRDFGYMSEKNFSHNLALKSSYNCIGELPFTNFTPSFTDVIDYIWFSA 818

Query: 315 ---RRNGEIGDSDEEEEKKLINQPKDMVPDSFTPTIEQ 349
              R  G +G+ D E   K I  P D  P    P + +
Sbjct: 819 HALRVRGLLGEVDPEYVSKFIGFPNDKFPSDHIPLLAR 856

>TPHA0H02680 Chr8 (627935..630553) [2619 bp, 872 aa] {ON} Anc_7.78
           YAL021C
          Length = 872

 Score = 70.9 bits (172), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 79/336 (23%), Positives = 130/336 (38%), Gaps = 75/336 (22%)

Query: 73  FSLMTYNCLAQAMIRREVFSDSGP-ALKWFRRSKVLMNEITYYNPDILCLQEIDDFQYEN 131
           F++++YN L Q     +++  +    L W  R + L N+I     D++CLQE++   YE+
Sbjct: 540 FTVLSYNTLCQHYATPKMYRYTPSWVLSWDTRREQLKNQILGIQSDVICLQEVEAQTYED 599

Query: 132 FWKDQLESNLNMNTFYYKQKIKH---------HGVLIAWKKSIFKQVDHMVVDFDDV--- 179
           FW   L+    +  F+ K + K           G  I +K+S FK      VDF  V   
Sbjct: 600 FWLPLLQKRGYLGIFHAKTRAKTMQSKDSKKVDGCCIFYKESEFKLQHQESVDFSGVWMK 659

Query: 180 -----KTSNIARRTITR-NIAMYVALKFNDEFITKNFPNLLHSFDQNDIGFIISTTHLFW 233
                +T +   R + + N+A++V L+                 +  +  +++ TTHL W
Sbjct: 660 HKKFQRTEDYLNRAMNKDNVALFVKLE---------------HINSGESVWVV-TTHLHW 703

Query: 234 HPFGTFERTRQCYILLEKMKKFI-DILNVKDHLKTHWYP-FICGDFNSTPRDAPY--LS- 288
            P     +T Q  +LL+ ++  + D  N     +    P  ICGD NS  + A Y  LS 
Sbjct: 704 DPQFNDVKTFQVGVLLDHLESLLKDYNNASSKQEIRKCPVIICGDLNSHLQSAVYELLST 763

Query: 289 ----------------MTSKPIEYTGREKKVIECSTAYKFSK------------------ 314
                           M+ K   ++   +   +C     F+                   
Sbjct: 764 GHVKVHEDIQDRFYGFMSQKNFSHSLSLRSTYDCIGELPFTNFTPSFTSVIDYIWYSTQA 823

Query: 315 -RRNGEIGDSDEEEEKKLINQPKDMVPDSFTPTIEQ 349
            R  G +G  DEE   K I  P D  P    P + +
Sbjct: 824 LRVRGVLGPIDEEYVSKFIGFPNDKFPSDHIPLLAR 859

>TBLA0A04660 Chr1 complement(1156426..1159116) [2691 bp, 896 aa]
           {ON} Anc_7.78 YAL021C
          Length = 896

 Score = 70.9 bits (172), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 72/282 (25%), Positives = 124/282 (43%), Gaps = 53/282 (18%)

Query: 73  FSLMTYNCLAQAMIRREVFSDSGP-ALKWFRRSKVLMNEITYYNPDILCLQEIDDFQYEN 131
           F++++YN L Q     +++  +   AL W  R   L ++I  +  DILCLQE++   Y++
Sbjct: 564 FTVLSYNTLCQHYATPKMYRYTPSWALSWEYRRDKLKDQILSFKSDILCLQEVESRTYDD 623

Query: 132 FWKDQLESNLNMNTFYYKQKIKH---------HGVLIAWKKSIFKQVDHMVVDFDDV--- 179
           FW+  L+ +     F+ K + K           G  I +K+S FK +    VDF  +   
Sbjct: 624 FWEPLLQKHGYKGIFHAKTRAKTMQTKDSKKVDGCCIFYKESEFKVLFKEAVDFSGIWMK 683

Query: 180 -----KTSNIARRTITR-NIAMYVALKFNDEFITKNFPNLLHSFDQNDIGFIISTTHLFW 233
                +T +   R + + N+A+Y+ L+                    ++ +I+ TTHL W
Sbjct: 684 HKNFQRTEDYLNRAMNKDNVAIYMKLQH---------------IKSGEVTWIV-TTHLHW 727

Query: 234 HPFGTFERTRQCYILLEKMKKFIDILNVKDHLKTHWYP-------FICGDFNSTPRDAPY 286
            P     +T Q  +LL+ ++  +     K+H   H           ICGD NS    A Y
Sbjct: 728 DPQFNDVKTFQVGVLLDHLESLL-----KEHSNIHSKQDVKKCPIIICGDLNSYLDSAVY 782

Query: 287 LSMTSKPIE----YTGREKKVI-ECSTAYKFSKRRN-GEIGD 322
             +++  +E      GR+   I +   A+  S R + G IG+
Sbjct: 783 ELLSTGHVEAHEDVEGRDYGFISQKHYAHNLSLRSSYGYIGE 824

>ACR288W Chr3 (882345..884555) [2211 bp, 736 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YAL021C (CCR4)
          Length = 736

 Score = 68.9 bits (167), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 64/231 (27%), Positives = 99/231 (42%), Gaps = 43/231 (18%)

Query: 73  FSLMTYNCLAQ--AMIRREVFSDSGPALKWFRRSKVLMNEITYYNPDILCLQEIDDFQYE 130
           F+L++YN L Q  A  +   F  S  AL W  R + L +E+  Y  DI+CLQE++   YE
Sbjct: 398 FTLLSYNTLCQHYATPKMYRFVPSW-ALSWDYRREKLKDEVLAYQTDIICLQEVESKTYE 456

Query: 131 NFWKDQLESNLNMNTFYYKQKI---------KHHGVLIAWKKSIFKQVDHMVVDFDDV-- 179
            FW   LE       F+ K +          K  G  I +K S F  V    +DF  V  
Sbjct: 457 EFWLPILEKQGYSGIFHAKTRARTMQSKDAKKVDGCCIFYKNSEFTAVFKDAIDFSSVWM 516

Query: 180 ------KTSNIARRTITR-NIAMYVALKFNDEFITKNFPNLLHSFDQNDIGFIISTTHLF 232
                 +T +   R + + N+A+ + L+                 ++      + TTHL 
Sbjct: 517 KHKKFQRTEDYLNRAMNKDNVALIIKLR----------------HERTGEHVWVVTTHLH 560

Query: 233 WHPFGTFERTRQCYILLEKMKKFI----DILNVKDHLKTHWYPFICGDFNS 279
           W P     +T Q  ++L+ ++K +     + + +D  K      ICGDFNS
Sbjct: 561 WDPHFNDVKTFQVAVMLDYIEKLLKQHGGVGSPQDKKKIPL--VICGDFNS 609

>Suva_1.45 Chr1 complement(87201..89696) [2496 bp, 831 aa] {ON}
           YAL021C (REAL)
          Length = 831

 Score = 68.6 bits (166), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 60/236 (25%), Positives = 103/236 (43%), Gaps = 39/236 (16%)

Query: 73  FSLMTYNCLAQAMIRREVFSDSGP-ALKWFRRSKVLMNEITYYNPDILCLQEIDDFQYEN 131
           F++++YN L Q     +++  +   AL W  R   L  +I  Y+ D+LCLQE++   +E+
Sbjct: 499 FTVLSYNTLCQHYATPKMYRYTPSWALSWDYRRNKLKEQILSYSSDVLCLQEVESKTFED 558

Query: 132 FWKDQLESNLNMNTFYYKQKIKH---------HGVLIAWKKSIFKQVDHMVVDFDDV--- 179
           +W   LE +     F+ K + K           G  I +K+  FK V+   +DF      
Sbjct: 559 YWVPLLEKHGYTGVFHAKARAKTMHSKDSKKVDGCCIFFKRDQFKMVNRDSMDFSGAWMK 618

Query: 180 -----KTSNIARRTITR-NIAMYVALKFNDEFITKNFPNLLHSFDQNDIGFIISTTHLFW 233
                +T +   R + + N+A+++ L+                    D  +++ TTHL W
Sbjct: 619 HKKFQRTEDYLNRAMNKDNVALFLKLQH---------------VSSGDTIWVV-TTHLHW 662

Query: 234 HPFGTFERTRQCYILLEKMKKFI---DILNVKDHLKTHWYPFICGDFNSTPRDAPY 286
            P     +T Q  +LL+ ++  +      N +  +K      ICGDFNS    A Y
Sbjct: 663 DPKFNDVKTFQVGVLLDHLETLLKEDTTHNSRQDIKKSPV-LICGDFNSYINSAVY 717

>NCAS0F01640 Chr6 (330064..332631) [2568 bp, 855 aa] {ON} Anc_7.78
          Length = 855

 Score = 65.5 bits (158), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 66/236 (27%), Positives = 105/236 (44%), Gaps = 36/236 (15%)

Query: 63  HGHSNRKGFKFSLMTYNCLAQAMIRREVFSDSGP-ALKWFRRSKVLMNEITYYNPDILCL 121
           +G+ + +   F+L++YN L Q     +++  +   AL W  R + L ++I  Y  DILCL
Sbjct: 516 NGNPDLEKKSFTLLSYNTLCQHYATPKMYRYTPSWALSWDYRREKLKDQILSYQSDILCL 575

Query: 122 QEIDDFQYENFWKDQLESNLNMNTFYYKQKIKH---------HGVLIAWKKSIFKQVDHM 172
           QE++   +E FW   LE       F+ K + K           G  I +KKS FK +   
Sbjct: 576 QEVESKTFEEFWSPLLEKYDYQGIFHIKTRAKTMQSKDSKKVDGCCIFFKKSKFKLLFKE 635

Query: 173 VVDFDDV--------KTSNIARRTITR-NIAMYVALKFNDEFITKNFPNLLHSFDQNDIG 223
            +DF           +T +   R + + N+A+Y+ L+               S    +  
Sbjct: 636 AMDFSGTWMKHKKFQRTEDYLNRAMNKDNVALYLKLQ---------------SLTSGESV 680

Query: 224 FIISTTHLFWHPFGTFERTRQCYILLEKMKKFIDILNVKDHLKTHWYPFICGDFNS 279
           +++ TTHL W P     +T Q  ILL+ M+  +   N K  +K      ICGD NS
Sbjct: 681 WVV-TTHLHWDPKFNDVKTFQVGILLDHMEALLKEENPKQDVKKANV-VICGDLNS 734

>ZYRO0D05302g Chr4 complement(453024..455597) [2574 bp, 857 aa] {ON}
           similar to uniprot|P31384 Saccharomyces cerevisiae
           YAL021C CCR4 Component of the CCR4-NOT transcriptional
           complex which is involved in regulation of gene
           expression component of the major cytoplasmic
           deadenylase which is involved in mRNA poly(A) tail
           shortening
          Length = 857

 Score = 65.1 bits (157), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 65/244 (26%), Positives = 98/244 (40%), Gaps = 55/244 (22%)

Query: 73  FSLMTYNCLAQAMIRREVFSDSGP-ALKWFRRSKVLMNEITYYNPDILCLQEIDDFQYEN 131
           F++M+YN L Q     +++  +   AL W  R + L  E+  Y  DI+CLQE++   YE 
Sbjct: 524 FTIMSYNILCQHYATPKMYRYTPSWALSWDHRRQRLTEEVMSYMTDIVCLQEVEAKTYEE 583

Query: 132 FWKDQL---------ESNLNMNTFYYKQKIKHHGVLIAWKKSIFKQVDHMVVDFDDV--- 179
            W   +          +     T + K   K  G  + +K+S FK      VDF      
Sbjct: 584 HWAPLMLKQGYSGVFHAKTRAKTMHSKDSKKVDGCCVFYKESEFKLQFKDEVDFSSTWMK 643

Query: 180 -----KTSNIARRTITR-NIAMYVALKFNDEFITKNFPNLLHSFDQNDIGFIISTTHLFW 233
                +T +   R + + N+ +Y+ L            N L S +       I+TTHL W
Sbjct: 644 HKKFQRTEDYLNRAMNKDNVVIYIKL------------NHLKSGES----VWIATTHLHW 687

Query: 234 HPFGTFERTRQCYILLEKMKKFIDILNVKDHLKTHWYP-----------FICGDFNSTPR 282
            P     +T Q  IL++ +++ I         K H  P            ICGDFNS   
Sbjct: 688 DPQFNDVKTFQVGILMDHLEELI---------KEHGSPSSRQDPKKSPVIICGDFNSQKD 738

Query: 283 DAPY 286
            A Y
Sbjct: 739 SAVY 742

>Smik_1.45 Chr1 complement(93751..96270) [2520 bp, 839 aa] {ON}
           YAL021C (REAL)
          Length = 839

 Score = 64.7 bits (156), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 76/337 (22%), Positives = 129/337 (38%), Gaps = 77/337 (22%)

Query: 73  FSLMTYNCLAQAMIRREVFSDSGP-ALKWFRRSKVLMNEITYYNPDILCLQEIDDFQYEN 131
           F++++YN L Q     +++  +   AL W  R   L  +I  Y+ D+LCLQE++   +E+
Sbjct: 507 FTVLSYNTLCQHYATPKMYRYTPSWALSWDYRRNKLKEQILSYDSDLLCLQEVESKTFED 566

Query: 132 FWKDQLESNLNMNTFYYKQKIKH---------HGVLIAWKKSIFKQVDHMVVDFDDV--- 179
           +W   L+ +     F+ K + K           G  I +KK  FK +    +DF      
Sbjct: 567 YWVPLLDKHGYTGIFHAKARAKTMHSKDSKKVDGCCIFFKKDQFKLITKDAMDFSGAWMK 626

Query: 180 -----KTSNIARRTITR-NIAMYVALKFNDEFITKNFPNLLHSFDQNDIGFIISTTHLFW 233
                +T +   R + + N+A+++ L+              H    + I  +  TTHL W
Sbjct: 627 HKKFQRTEDYLNRAMNKDNVALFLKLQ--------------HIPSGDTIWAV--TTHLHW 670

Query: 234 HPFGTFERTRQCYILLEKMKKFI---DILNVKDHLKTHWYPFICGDFNSTPRDAPYLSMT 290
            P     +T Q  +LL+ ++  +      N +  +K      ICGDFNS    A Y  ++
Sbjct: 671 DPKFNDVKTFQVGVLLDHLETLLREETTHNFRQDIKKSPV-LICGDFNSYINSAVYELIS 729

Query: 291 SKPI----EYTGRE---------------KKVIECSTAYKFSK----------------- 314
           +  +    E  GR+               K    C     F+                  
Sbjct: 730 TGRVQINQEGNGRDFGYMSEKNFSHNLALKSSYNCIGELPFTNFTPSFTDVIDYIWFSTH 789

Query: 315 --RRNGEIGDSDEEEEKKLINQPKDMVPDSFTPTIEQ 349
             R  G +G+ D +   K I  P D  P    P + +
Sbjct: 790 ALRVRGLLGEVDPDYVSKFIGFPNDKFPSDHIPLLAR 826

>YAL021C Chr1 complement(110846..113359) [2514 bp, 837 aa] {ON}
           CCR4Component of the CCR4-NOT transcriptional complex,
           which is involved in regulation of gene expression;
           component of the major cytoplasmic deadenylase, which is
           involved in mRNA poly(A) tail shortening
          Length = 837

 Score = 63.9 bits (154), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 77/338 (22%), Positives = 129/338 (38%), Gaps = 79/338 (23%)

Query: 73  FSLMTYNCLAQAMIRREVFSDSGP-ALKWFRRSKVLMNEITYYNPDILCLQEIDDFQYEN 131
           F++++YN L Q     +++  +   AL W  R   L  +I  Y+ D+LCLQE++   +E 
Sbjct: 505 FTVLSYNTLCQHYATPKMYRYTPSWALSWDYRRNKLKEQILSYDSDLLCLQEVESKTFEE 564

Query: 132 FWKDQLESNLNMNTFYYKQKIKH---------HGVLIAWKKSIFKQVDHMVVDFDDV--- 179
           +W   L+ +     F+ K + K           G  I +K+  FK +    +DF      
Sbjct: 565 YWVPLLDKHGYTGIFHAKARAKTMHSKDSKKVDGCCIFFKRDQFKLITKDAMDFSGAWMK 624

Query: 180 -----KTSNIARRTITR-NIAMYVALKFNDEFITKNFPNLLHSFDQNDIGFIISTTHLFW 233
                +T +   R + + N+A+++ L+              H    + I  +  TTHL W
Sbjct: 625 HKKFQRTEDYLNRAMNKDNVALFLKLQ--------------HIPSGDTIWAV--TTHLHW 668

Query: 234 HPFGTFERTRQCYILLEKMKKFI---DILNVKDHLKTHWYP-FICGDFNSTPRDAPYLSM 289
            P     +T Q  +LL+ ++  +      N +  +K   +P  ICGDFNS    A Y  +
Sbjct: 669 DPKFNDVKTFQVGVLLDHLETLLKEETSHNFRQDIKK--FPVLICGDFNSYINSAVYELI 726

Query: 290 TSKPI----EYTGRE---------------KKVIECSTAYKFSK---------------- 314
            +  +    E  GR+               K    C     F+                 
Sbjct: 727 NTGRVQIHQEGNGRDFGYMSEKNFSHNLALKSSYNCIGELPFTNFTPSFTDVIDYIWFST 786

Query: 315 ---RRNGEIGDSDEEEEKKLINQPKDMVPDSFTPTIEQ 349
              R  G +G+ D E   K I  P D  P    P + +
Sbjct: 787 HALRVRGLLGEVDPEYVSKFIGFPNDKFPSDHIPLLAR 824

>ACR277C Chr3 complement(857936..859072) [1137 bp, 378 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL042W
           (NGL1)
          Length = 378

 Score = 61.6 bits (148), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 68/286 (23%), Positives = 115/286 (40%), Gaps = 58/286 (20%)

Query: 36  KKLIQGEDPDHPIELSFIKRPIL--YLPHHGHSNRKGFKFSLMTYNCLAQAMIRREVFS- 92
           ++L+    P   +    I R +L  Y        R   +F+L+TYN L+   +  +V++ 
Sbjct: 3   RRLLPTMAPSKALPARMINRQLLPVYSGSASAGCRSERRFNLLTYNMLSPYYMWPQVYTY 62

Query: 93  DSGPALKWFRRSKVLMNEITY-YNPDILCLQEIDDFQYENFWKDQLESNLN--------- 142
              P  KW  R K+L  E+ + Y+ DILCLQE+    YE FW+ Q++  +N         
Sbjct: 63  VPEPFKKWEYRHKLLEYELFHKYHADILCLQELTGKDYEKFWRKQMKRRMNFESQYAQKP 122

Query: 143 --------------MNTFYYKQKIKH-----------HGVLIAWKKSIFKQVDHMVVDFD 177
                         + TFY   K +H            GVL   +K    Q    V D  
Sbjct: 123 PPAYWKRSQEEMDGVGTFYNADKFEHVATDLEYLSDTLGVLTPTEKEWMAQTQVEVTD-- 180

Query: 178 DVKTSNIARRTITRNIAMYVALKFNDEFITKNFPNLLHSFDQNDIGFIISTTHLFWHPFG 237
                  A   +    ++   L   ++     F  LLH        F++  T L+W    
Sbjct: 181 -------ATGHVVEKQSLKTVLTQRNQVCL--FVTLLHK--PTGSLFVVVNTQLYWK--- 226

Query: 238 TFERTR--QCYILLEKMKKFID-ILNVKDHLKTHWYPFICGDFNST 280
            ++  +  QC+I++ ++K  +  +L  KD   ++    + GD NS+
Sbjct: 227 -YDEVKLAQCFIIMRRLKAIVKRLLTRKDTSYSNIKVLLSGDLNSS 271

>CAGL0F01001g Chr6 (106796..107875) [1080 bp, 359 aa] {ON} highly
           similar to uniprot|Q08213 Saccharomyces cerevisiae
           YOL042w
          Length = 359

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 58/239 (24%), Positives = 106/239 (44%), Gaps = 39/239 (16%)

Query: 73  FSLMTYNCLAQAMIRREVFSDSGPALK-WFRRSKVLMNEIT-YYNPDILCLQEIDDFQYE 130
           F+L++YN L+ + +  +V++      K W  R K+L  E+   Y  DI+CLQE+    Y 
Sbjct: 22  FTLLSYNLLSPSYMWPQVYTYVPEKYKDWNYRHKLLEQELLDKYRADIMCLQELTSEDYS 81

Query: 131 NFWKDQLESNLNMNTFYYKQKIKHHGVLIAWKKSIFKQVDHMVVDFDDVKTSNIARRTIT 190
           NFWK  L++N+N  + Y  +    +     WK+ + +Q+D + + ++  K   I+R  I 
Sbjct: 82  NFWKKALQTNMNYGSNYIAKTPPQY-----WKRPV-EQMDGVGIFYNLDKFEFISRSGIY 135

Query: 191 RNIAMYVALKFNDEFI-------------------------TKNFPNLLHSFDQNDIG-- 223
            N  + V      E++                         +KN   L  S    + G  
Sbjct: 136 LNQLLGVFSNNELEYLEKKPVTLTDGAGNQVGEQSLLQILKSKNQVALFVSLKHKETGNV 195

Query: 224 FIISTTHLFWHPFGTFERTRQCYILLEKMKKFID--ILNVKDHLKTHWYPFICGDFNST 280
           F++  THL+W       +  QC I++ ++ + I+  ++ +++           GD NST
Sbjct: 196 FVVINTHLYWKYDDV--KLTQCMIIMRELARIIEKHLVGLENVTDDKIKILFTGDLNST 252

>TDEL0H03730 Chr8 (623125..625518) [2394 bp, 797 aa] {ON} Anc_7.78
           YAL021C
          Length = 797

 Score = 60.8 bits (146), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 55/244 (22%), Positives = 106/244 (43%), Gaps = 37/244 (15%)

Query: 73  FSLMTYNCLAQAMIRREVFSDSGP-ALKWFRRSKVLMNEITYYNPDILCLQEIDDFQYEN 131
           F++++YN L Q     +++  +   AL W  R + L  +I  Y  D++CLQE++   +E 
Sbjct: 464 FTVLSYNTLCQHYATPKMYRYTPSWALSWDYRREKLTEQILSYMTDVICLQEVEAKTFEE 523

Query: 132 FWKDQLESNLNMNTFYYKQKIKH---------HGVLIAWKKSIFKQVDHMVVDFDDV--- 179
           +W   ++ +     F+ K + K           G  + ++++ FK      VDF  V   
Sbjct: 524 YWAPLMQKHGYSGLFHAKTRAKTMHSKDSKKVDGCCVFYRENEFKLAYKDAVDFSGVWQK 583

Query: 180 -----KTSNIARRTITR-NIAMYVALKFNDEFITKNFPNLLHSFDQNDIGFIISTTHLFW 233
                +T +   R + + N+A+Y+ L+                  ++     I TTHL W
Sbjct: 584 HKKFQRTEDYLNRAMNKDNVAIYLKLQ----------------HIKSGESVWIVTTHLHW 627

Query: 234 HPFGTFERTRQCYILLEKMKKFI-DILNVKDHLKTHWYPFI-CGDFNSTPRDAPYLSMTS 291
            P     +T Q  +L++ ++  + +  N +   +    P I CGD NS    A Y  +++
Sbjct: 628 DPQFNDVKTFQVGVLMDHIENLLKEQSNAQSKQEAKKCPVILCGDLNSEIHSAVYELLST 687

Query: 292 KPIE 295
             ++
Sbjct: 688 GRVQ 691

>KLLA0F15884g Chr6 complement(1468612..1470984) [2373 bp, 790 aa]
           {ON} similar to uniprot|P31384 Saccharomyces cerevisiae
           YAL021C CCR4 Component of the CCR4-NOT transcriptional
           complex which is involved in regulation of gene
           expression component of the major cytoplasmic
           deadenylase which is involved in mRNA poly(A) tail
           shortening
          Length = 790

 Score = 60.1 bits (144), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 60/231 (25%), Positives = 99/231 (42%), Gaps = 43/231 (18%)

Query: 73  FSLMTYNCLAQ--AMIRREVFSDSGPALKWFRRSKVLMNEITYYNPDILCLQEIDDFQYE 130
           F+L++YN L    A  +   F+ S  AL W  R + L  ++  ++ D++CLQE++   YE
Sbjct: 454 FTLLSYNTLCHHYATPKMYRFTPSW-ALSWDYRREKLKEQLLDFDTDVICLQEVETLTYE 512

Query: 131 NFWKDQLE---------SNLNMNTFYYKQKIKHHGVLIAWKKSIFKQVDHMVVDFDDV-- 179
            +W   +E         +     T + K   K  G  I +KK  F+ V    +DF     
Sbjct: 513 EYWVPLMEKYNYSCLFHAKTRAKTMHAKDSKKVDGCAIFYKKDQFQLVFQDSIDFSSAWR 572

Query: 180 ------KTSNIARRTITR-NIAMYVALKFNDEFITKNFPNLLHSFDQNDIGFIISTTHLF 232
                 +T +   R + + N+A+   LK                 + N+  +++ TTHL 
Sbjct: 573 SHKKFHRTEDYLNRAMNKDNVALIAELKH---------------LNTNENVWVV-TTHLH 616

Query: 233 WHPFGTFERTRQCYILLEKMKKFID----ILNVKDHLKTHWYPFICGDFNS 279
           W P     +T Q  ++L+ ++  I     + N  D  K      ICGDFNS
Sbjct: 617 WDPQFNDVKTFQVGVMLDYLETLIKQHHHVNNNNDIKKIPM--VICGDFNS 665

>KLTH0D02574g Chr4 (257847..258953) [1107 bp, 368 aa] {ON} similar
           to uniprot|Q08213 Saccharomyces cerevisiae YOL042W
          Length = 368

 Score = 59.3 bits (142), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 54/240 (22%), Positives = 105/240 (43%), Gaps = 32/240 (13%)

Query: 73  FSLMTYNCLAQAMIRREVFSDSGPALK-WFRRSKVLMNEI-TYYNPDILCLQEIDDFQYE 130
           F+LMTYN L+   +  +V++      K W  R ++L  EI   Y  DI+C+QE+    YE
Sbjct: 30  FTLMTYNMLSPYYMWPQVYTYVPEKYKDWSYRHRLLEREILNLYRADIMCVQELTCKDYE 89

Query: 131 NFWKDQLESNLNMNTFYYKQKIKHH---------GVLIAWKKSIFKQVDHMVVDFDD-VK 180
            FWK+  ++ +N  + Y  +    +         GV I +  + F+ +    +  +D + 
Sbjct: 90  GFWKNHFKTKMNYGSSYIAKTPPKYWKRPEDEMDGVGIFYNLNKFEHISTSSIYLNDLIG 149

Query: 181 TSNIARRTITRNIAMYVALKFNDEFITKNFPNLLHSFDQNDIG-----------FIISTT 229
             NI+     ++  + +     +     +  N+LH  +Q  +            F++  T
Sbjct: 150 LFNISELNYLKSTIITLTNGAGEPIDKDSLLNVLHGRNQVSLFVSLLHKETRTLFVVVNT 209

Query: 230 HLFWHPFGTFERTR--QCYILLEKMKKFID--ILNVKDHLKTHWYPFICGDFNSTPRDAP 285
           HL+W     ++  +  QC  ++ K+ + I   ++ ++    +       GD NS P D+P
Sbjct: 210 HLYW----KYDEVKLCQCLTIMRKLHRVIKSLLMGMEGVTYSKVKILFAGDLNSAP-DSP 264

>Skud_15.115 Chr15 (208773..209864) [1092 bp, 363 aa] {ON} YOL042W
           (REAL)
          Length = 363

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 74/259 (28%), Positives = 114/259 (44%), Gaps = 55/259 (21%)

Query: 64  GHSNRKGFKFSLMTYNCLAQAMIRREVFSDSGPALK-WFRRSKVLMNEI-TYYNPDILCL 121
           G   RK  +F+L+TYN L+ + +  +V++      K W  R K+L  E+   +  DI+CL
Sbjct: 18  GKYVRKDARFTLLTYNMLSPSYMWPQVYTYVAERYKSWSYRHKLLEKELLNSFKADIMCL 77

Query: 122 QEIDDFQYENFWKDQLESNLNMNT-FYYKQKIKHHGVLIAWKK--------SIFKQVDHM 172
           QE+    YE++W D +  N+N  + F  K   K+      WKK        SIF  +D  
Sbjct: 78  QEMTRRDYEDYWHDSIGVNINYGSKFISKTPPKY------WKKPLEDMDGVSIFYNLDK- 130

Query: 173 VVDFDDVKTSNIA------------------RRTITRNIAMYVALK--FNDEFITKN--- 209
              FD + +S I                   +R I  + A  V  +    D    KN   
Sbjct: 131 ---FDFISSSGIYLNQLLNVFNERELKYLYNKRVILTDGASNVVGEDSLLDVLKGKNQVC 187

Query: 210 -FPNLLHSFDQNDIGFIISTTHLFWHPFGTFERTRQCYILLEKMKKFIDIL---NVKDHL 265
            F +L H   + D  F++  THL+W  +   + T QC I++ ++ K I+ L   + K   
Sbjct: 188 LFVSLKHK--ETDTIFVVLNTHLYW-KYDEVKLT-QCMIIMRELSKIIEQLLPGDAKGRG 243

Query: 266 KTHWYPFICGDFNSTPRDA 284
           K        GD NST RD+
Sbjct: 244 KVK--ILFTGDLNST-RDS 259

>SAKL0B09768g Chr2 complement(823496..824602) [1107 bp, 368 aa] {ON}
           similar to uniprot|Q08213 Saccharomyces cerevisiae
           YOL042W
          Length = 368

 Score = 56.6 bits (135), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 56/233 (24%), Positives = 97/233 (41%), Gaps = 27/233 (11%)

Query: 72  KFSLMTYNCLAQAMIRREVFSDSGPALK-WFRRSKVLMNEI-TYYNPDILCLQEIDDFQY 129
           KF+L+TYN L+   +  +V++      K W  R ++L +E+   Y  DI+CLQE+    Y
Sbjct: 29  KFTLLTYNMLSPCYMWPQVYTYVPEKFKEWGYRHRLLEDELFKTYKADIMCLQELTTKDY 88

Query: 130 ENFWKDQLESNLNMNT---------FYYKQKIKHHGVLIAWKKSIFKQVDHMVVDFDDVK 180
            NFW  Q++  LN  +         ++ +   +  GV I +    F+ +    +  +DV 
Sbjct: 89  HNFWDKQMKETLNYGSNFISKTPPKYWKRPTDEMDGVGIFYNLDKFEYISSSSIYLNDVL 148

Query: 181 TSNIARRTITRNIAMYVALKFNDEFITK-NFPNLLHSFDQ-----------NDIGFIIST 228
                R        M        E I K N  N+L   +Q            +  F++  
Sbjct: 149 GIFNVRELKYMKETMITLTNGAGEAIGKDNLMNILQGRNQVCLFVSLRHKDTNTVFVVIN 208

Query: 229 THLFWHPFGTFERTRQCYILLEKMKKFID--ILNVKDHLKTHWYPFICGDFNS 279
           THL+W       +  QC  ++ K+++ I   ++ V+    +       GD NS
Sbjct: 209 THLYWKYDEV--KLSQCLTIMRKLERIIKSLLMGVEGVTYSKVKILFSGDLNS 259

>YOL042W Chr15 (249825..250916) [1092 bp, 363 aa] {ON}  NGL1Putative
           endonuclease, has a domain similar to a
           magnesium-dependent endonuclease motif in mRNA
           deadenylase Ccr4p; the authentic, non-tagged protein is
           detected in highly purified mitochondria in
           high-throughput studies
          Length = 363

 Score = 56.6 bits (135), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 67/254 (26%), Positives = 112/254 (44%), Gaps = 45/254 (17%)

Query: 64  GHSNRKGFKFSLMTYNCLAQAMIRREVFSDSG-PALKWFRRSKVLMNEI-TYYNPDILCL 121
           G   RK  +F+L+TYN L+ + +  +V++    P   W  R ++L  E+   +  DI+CL
Sbjct: 18  GKYVRKDARFTLLTYNMLSPSYMWPQVYTYVAEPYKNWSYRHRLLEKELLNTFKADIMCL 77

Query: 122 QEIDDFQYENFWKDQLESNLNMNT-FYYKQKIKHHGVLIAWKKSIFKQVDHM-----VVD 175
           QE+    YE++W D +  ++N  + F  K   K+      WKK + K +D +     +  
Sbjct: 78  QEMTARDYEDYWHDSIGVDVNYGSKFISKTPPKY------WKKPV-KDMDGVSIFYNLAK 130

Query: 176 FDDVKTSNI-------------------ARRTITRNIAMYVAL-KFNDEFITKNFPNLLH 215
           FD + +S I                    + T+T   +  +      D    KN   L  
Sbjct: 131 FDFISSSGIYLNQLLNVFNQRELKYLYNKKVTLTDGASNVIGEDSLLDVLKGKNQVCLFV 190

Query: 216 SFDQNDIG--FIISTTHLFWHPFGTFERTRQCYILLEKMKKFIDIL---NVKDHLKTHWY 270
           S    + G  F++  THL+W  +   + T QC I++ ++ K I  L   +VK   +    
Sbjct: 191 SLRHKETGTIFVVLNTHLYWK-YDEVKLT-QCMIIMRELSKIIKQLLPGDVKGQERVK-- 246

Query: 271 PFICGDFNSTPRDA 284
               GD NST RD+
Sbjct: 247 ILFTGDLNST-RDS 259

>Smik_15.125 Chr15 (215988..217079) [1092 bp, 363 aa] {ON} YOL042W
           (REAL)
          Length = 363

 Score = 56.6 bits (135), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 66/249 (26%), Positives = 114/249 (45%), Gaps = 35/249 (14%)

Query: 64  GHSNRKGFKFSLMTYNCLAQAMIRREVFSDSG-PALKWFRRSKVLMNEI-TYYNPDILCL 121
           G   +K  +F+L+TYN L+ + +  +V++    P   W  R K+L  E+   +  DI+CL
Sbjct: 18  GKYVQKDARFTLLTYNMLSPSYMWPQVYTYVAEPYKNWSYRHKLLERELLNTFKADIMCL 77

Query: 122 QEIDDFQYENFWKDQLESNLNMNT--------FYYKQKIK-HHGVLIAWKKSIFKQV--- 169
           QE+    YE++W+D +  ++N  +         Y+K  +K   GV I +    F  +   
Sbjct: 78  QEMTARDYEDYWRDYIGVDINYGSKFIPKTPPKYWKNPVKDMDGVSIFYNLEKFDYISST 137

Query: 170 ----DHMVVDFDDVKTSNIARRTIT-----RNIAMYVALKFNDEFITKNFPNLLHSFDQN 220
               + ++  F++ +   +  + +T      NI    +L   D    KN   L  S    
Sbjct: 138 GIYLNQLLNVFNERELKYLFNKKVTLTDGASNIVGEDSLL--DVLKGKNQVCLFVSLKHK 195

Query: 221 DIG--FIISTTHLFWHPFGTFERTRQCYILLEKMKKFIDIL---NVKDHLKTHWYPFICG 275
           + G  F++  THL+W  +   + T QC I++ ++ K I  L   +VK   K        G
Sbjct: 196 ETGTVFVVLNTHLYWK-YDEVKLT-QCMIIMRELSKIIKQLLSGDVKSQRKVK--ILFTG 251

Query: 276 DFNSTPRDA 284
           D NST RD+
Sbjct: 252 DLNST-RDS 259

>NCAS0I00500 Chr9 (81492..82661) [1170 bp, 389 aa] {ON} Anc_7.90
           YOL042W
          Length = 389

 Score = 55.8 bits (133), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 64/242 (26%), Positives = 102/242 (42%), Gaps = 41/242 (16%)

Query: 72  KFSLMTYNCLAQAMIRREVFS-DSGPALKWFRRSKVLMNEI-TYYNPDILCLQEIDDFQY 129
           KF+L+TYN L+ + +  +V++    P   W  R K+L +E+   Y  DI+CLQE+    Y
Sbjct: 29  KFTLLTYNMLSPSYMWPQVYTYVPDPYKDWQYRHKLLESELLGSYKADIMCLQEMTSRDY 88

Query: 130 ENFWKDQLESNLNMNTFYYKQKIKHHGVLIAWKKSIFKQVDHMVV-----DFDDVKTSNI 184
              WK  L S +      Y  K       + W++ +  ++D + +      FD + +S I
Sbjct: 89  NENWKRLLGSGIG-----YGSKFIAKSPPLYWEREV-DEIDGVGIFYNLKKFDFISSSGI 142

Query: 185 -------------------ARRTITRNIAMYVALK-FNDEFITKNFPNLLHSFDQNDIG- 223
                               R  +T    + +  K   D    KN   L  S    + G 
Sbjct: 143 YLNQFLNVFSSTELEYLHSKRLVLTDGAGVPIGEKNLLDVISGKNQVCLFVSLKHKETGE 202

Query: 224 -FIISTTHLFWHPFGTFERTRQCYILLEKMKKFIDIL--NVKDHLKTHWYPFICGDFNST 280
            F++  THL+W  +   + T QC I++ ++ K ID L   V D  K        GD NST
Sbjct: 203 MFVVINTHLYWK-YDEVKLT-QCMIIMRELSKIIDELVKGVDDPGKVK--ILFTGDLNST 258

Query: 281 PR 282
            +
Sbjct: 259 KK 260

>Suva_15.127 Chr15 (222266..223357) [1092 bp, 363 aa] {ON} YOL042W
           (REAL)
          Length = 363

 Score = 55.8 bits (133), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 63/254 (24%), Positives = 115/254 (45%), Gaps = 45/254 (17%)

Query: 64  GHSNRKGFKFSLMTYNCLAQAMIRREVFSDSGPALK-WFRRSKVLMNEI-TYYNPDILCL 121
           G   RK  +F+L+TYN L+ + +  +V++      K W  R K+L  E+ T +  DI+CL
Sbjct: 18  GKYVRKDARFTLLTYNMLSPSYMWPQVYTYVAERYKNWNYRHKLLEKELLTTFKADIMCL 77

Query: 122 QEIDDFQYENFWKDQLESNLN-----------------------MNTFYYKQK---IKHH 155
           QE+    YEN+W + +  ++N                       ++ FY  +K   I   
Sbjct: 78  QEMTTRDYENYWHNSIGVDINYGSKFISKTPPKYWEKPVKDMDGVSIFYNLEKFDYISSS 137

Query: 156 GVLIAWKKSIFKQVDHMVVDFDDVKTSNIARRTITRNIAMYVALKFNDEFITKNFPNLLH 215
           G+ +    ++F + +   +    V  ++ A   I  + ++   LK  ++     F +L H
Sbjct: 138 GIYLNQLLNVFNERELKYLYNKKVTLTDGASNVIGED-SLLDVLKGKNQVCL--FVSLKH 194

Query: 216 SFDQNDIGFIISTTHLFWHPFGTFERTRQCYILLEKMKKFIDIL-----NVKDHLKTHWY 270
              + +  F++  THL+W  +   + T QC I++ ++ K I  L     N ++ +K    
Sbjct: 195 K--ETNTIFVVLNTHLYW-KYDEVKLT-QCMIIMRELSKIIKQLLPGDANAQEKVKI--- 247

Query: 271 PFICGDFNSTPRDA 284
               GD NST RD+
Sbjct: 248 -LFTGDLNST-RDS 259

>KNAG0L00550 Chr12 (84534..85679) [1146 bp, 381 aa] {ON} Anc_7.90
           YOL042W
          Length = 381

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 63/257 (24%), Positives = 111/257 (43%), Gaps = 48/257 (18%)

Query: 65  HSNRKGFKFSLMTYNCLAQAMIRREVFSDSGPALK-WFRRSKVLMNEI-TYYNPDILCLQ 122
           H NR    F+L+TYN L+ A +  +V++      K W  R  +L  E+   Y  DI+C+Q
Sbjct: 35  HDNR----FTLLTYNILSPAYMWPQVYTYVPEQCKQWEFRHDLLEQELLGKYKADIMCIQ 90

Query: 123 EIDDFQYENFWKDQLESNLNMNT---------FYYKQKIKHHGVLIAWKKSIFKQV---- 169
           E+    Y+ FW        +M +         ++ ++  +  GV I + + +F  V    
Sbjct: 91  EMTKRDYQQFWSPIASGKCDMGSEFISKTAPKYWKREPDELDGVAIFYNRKMFDFVSSKG 150

Query: 170 ---DHMVVDFDDVK-----------TSNIARRTITRNIAMYVALKFNDEFITKNFPNLLH 215
              + M+  F+D +           T      T   N+  ++ L        KN  +L  
Sbjct: 151 IYLNQMLDAFNDHELEYLGQKKLGLTDGAGNPTGETNLLNFLKL--------KNQVSLFV 202

Query: 216 SFDQNDIG--FIISTTHLFWHPFGTFERTRQCYILLEKMKKFIDIL--NVKDHLKTHWYP 271
           S      G  F++  THL+W  +   + T QC +++ ++ + ID L  +V D  K     
Sbjct: 203 SLQHKSTGMYFVVINTHLYWK-YDEVKLT-QCMVIMRELSQIIDDLLKDVPDVTKEKVKI 260

Query: 272 FICGDFNSTPRDAPYLS 288
              GD NST +++P ++
Sbjct: 261 IFTGDLNST-KNSPVIN 276

>TBLA0E02260 Chr5 complement(556705..557871) [1167 bp, 388 aa] {ON}
           Anc_7.90 YOL042W
          Length = 388

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 50/225 (22%), Positives = 94/225 (41%), Gaps = 31/225 (13%)

Query: 61  PHHGHSNRKGFKFSLMTYNCLAQAMIRREVFSDSGPALK-WFRRSKVLMNEIT-YYNPDI 118
           PH      K   F+ ++YN L+   +  +V++      K W  R  +L  EI   Y  DI
Sbjct: 32  PHQTLPAAKNPTFTFLSYNMLSPHYMWPQVYTYVPQEYKDWKYRHNLLEKEILDKYRSDI 91

Query: 119 LCLQEIDDFQYENFWKDQLESNLNMNT---------FYYKQKIKHHGVLIAWKKSIFKQV 169
           +C+QE+    Y +FW+D L    N  +         ++ K  ++  GV I +   +F  +
Sbjct: 92  MCVQELTTIDYYSFWRDSLRKGFNYGSRFIAKNPPNYWTKSLVEMDGVGIFYNLDMFDYI 151

Query: 170 DHMVVDFDDVKTSNIARRTITRNIAMYVALKFNDEFITKNFPNLLHSFDQNDIG------ 223
               ++ +D+  S   R+ +    A  + +   +  +T        +  +N +       
Sbjct: 152 GSRSINLNDL-ASTFDRKELDYMAAKEITILNGNGDVTGKESLYELALSKNQVCLFVMVE 210

Query: 224 -------FIISTTHLFWHPFGTFERTR--QCYILLEKMKKFIDIL 259
                  F+I  THL+W     +E  +  QC I++ K+ K ++ L
Sbjct: 211 HKISKDVFVIINTHLYW----KYEEVKLTQCMIIMRKLAKIVNEL 251

>Kwal_26.7170 s26 (247186..248304) [1119 bp, 372 aa] {ON} YOL042W
           (NGL1) - DNase/RNase (putative); CCR4 C-terminal
           homolog, homology to drosophila Angel gene [contig 47]
           FULL
          Length = 372

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 58/240 (24%), Positives = 104/240 (43%), Gaps = 32/240 (13%)

Query: 73  FSLMTYNCLAQAMIRREVFSDSGPALK-WFRRSKVLMNEI-TYYNPDILCLQEIDDFQYE 130
           F+ MTYN L+   +  +V++      K W  R ++L  EI   Y  DI+C+QE+    Y+
Sbjct: 34  FTFMTYNMLSPYYMWPQVYTYVPEKYKEWSYRHRLLEREILNLYRADIMCVQELTCKDYD 93

Query: 131 NFWKDQLESNLNM-NTFYYKQKIKH--------HGVLIAWKKSIFKQVDHMVVDFDD-VK 180
            FWK   +S +N  ++F  K   K+         GV I +    F+ +    +  +D + 
Sbjct: 94  GFWKGHFKSKMNYGSSFISKTPPKYWQRPPDEMDGVGIFYNLDKFEHISTTSIYLNDLIG 153

Query: 181 TSNIARRTITRNIAMYVALKFNDEFITKNFPNLLHSFDQNDIG-----------FIISTT 229
             NI+     ++  + +     +     +  N+LH  +Q  +            F++  T
Sbjct: 154 LFNISELNYLKSTIITLTNGAGEPVDKDSLLNVLHGRNQVSLFVSLMHKETRTLFVVINT 213

Query: 230 HLFWHPFGTFERTR--QCYILLEKMKKFIDILNVKDHLKTHWYPFI--CGDFNSTPRDAP 285
           HL+W     ++  +  QC  ++ K+ + I  L +     T+    I   GD NS P D+P
Sbjct: 214 HLYW----KYDEVKLCQCLTIMRKLHRVIKSLLMGREGVTYSKVKILFAGDLNSAP-DSP 268

>TDEL0H03600 Chr8 complement(593714..594814) [1101 bp, 366 aa] {ON}
           Anc_7.90 YOL042W
          Length = 366

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 69/266 (25%), Positives = 112/266 (42%), Gaps = 60/266 (22%)

Query: 60  LPHHGHSNRKGFKFSLMTYNCLAQAMIRREVFSDSGPALK-WFRRSKVLMNEI-TYYNPD 117
           LP  G       KF+ MTYN L+   +  +V++      K W  R K+L  EI   Y  D
Sbjct: 16  LPKSGSKRLIDDKFTFMTYNMLSPHYMWPQVYTYVPDEYKDWNYRHKLLEKEILNSYRAD 75

Query: 118 ILCLQEIDDFQYENFWKDQLESNLNMNT---------FYYKQKIKHHGVLIAWKKSIFKQ 168
           I+CLQE+    Y  +W++ ++ + +  +         ++ K      GV I +  + F  
Sbjct: 76  IMCLQELTASDYHQYWEEVIDRDFHYGSRFIAKPPPQYWQKDAKDVDGVGIFYNLNKFDY 135

Query: 169 VDHMVVDFDD-----------------VKTSNIA-----RRTI-----TRN-IAMYVALK 200
           +    +  +D                 VK ++ A      +T+     +RN + ++VALK
Sbjct: 136 ISSTSIHLNDLIGSFDLDELSYLKSKQVKLTDGAGNPKGEKTLLEILKSRNQVGLFVALK 195

Query: 201 FNDEFITKNFPNLLHSFDQNDIGFIISTTHLFWHPFGTFERTRQCYILLEKMKKFIDILN 260
                            D N I F++  THL+W  +   + T QC I++ K+ K I  L 
Sbjct: 196 HK---------------DTNTI-FVVINTHLYW-KYDEVKLT-QCLIIMRKLAKIIRDLL 237

Query: 261 VKDHLKTH--WYPFICGDFNSTPRDA 284
           V +H  T+        GD NST RD+
Sbjct: 238 VGEHGTTYNKMKVVFAGDLNST-RDS 262

>KAFR0D01250 Chr4 (254384..255454) [1071 bp, 356 aa] {ON} Anc_7.90
           YOL042W
          Length = 356

 Score = 53.9 bits (128), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 66/237 (27%), Positives = 105/237 (44%), Gaps = 40/237 (16%)

Query: 73  FSLMTYNCLAQAMIRREVFSDSGPALK-WFRRSKVLMNEIT-YYNPDILCLQEIDDFQYE 130
           F+L+TYN L+Q+ +  +V+       K W  R K+L  EI   YN DI+CLQE+    YE
Sbjct: 22  FTLLTYNILSQSYMWPQVYKYVPAKYKSWEYRHKLLEYEILKLYNADIICLQELTSRDYE 81

Query: 131 NFWKDQLESNLNMNTFYYKQKIKH--------HGVLIAWKKSIFKQVDH--------MVV 174
            +W+ +L      + F  K   K+         GV I +   +F+ +D         ++ 
Sbjct: 82  YYWRKKLSKFNKGSDFICKTPPKYWTKAADDLDGVGIFYNLDMFELIDSNGIRLSDFLIS 141

Query: 175 DFDDVKTSNIARRTIT------RNIAMYVALKFNDEFITKNFPNLLHSFDQNDIG--FII 226
           DF+  +   +A R +       R I +   L   +E   KN   L  +      G   ++
Sbjct: 142 DFEQPELDYLASRKLVLTDGEGRQIKVSNILDVLEE---KNQVCLFMTLKHKRTGATVVV 198

Query: 227 STTHLFWHPFGTFERTRQCYILLEKMKKFIDILNVKDHLKTHWYPFI----CGDFNS 279
            TTHL+W  +   + T QC I++ ++ K +     KD LK     F+     GD NS
Sbjct: 199 VTTHLYW-KYDEIKLT-QCMIIMRQLSKIM-----KDQLKKDGSSFVKVLFAGDLNS 248

>KLLA0F07733g Chr6 (731317..732432) [1116 bp, 371 aa] {ON} similar
           to uniprot|Q08213 Saccharomyces cerevisiae YOL042W
          Length = 371

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 61/245 (24%), Positives = 112/245 (45%), Gaps = 42/245 (17%)

Query: 72  KFSLMTYNCLAQAMIRREVFSDSGPALK-WFRRSKVLMNEITY-YNPDILCLQEIDDFQY 129
           +F+++TYN L+   +  +V++      K W  R ++L +E+ Y Y  DI+CLQE+    Y
Sbjct: 33  RFTMLTYNMLSPYYMWPQVYTYVKDEYKDWDYRHRLLEHELFYKYKSDIICLQELTTNDY 92

Query: 130 ENFWKDQLESNLNMNT-FYYKQKIKH--------HGVLIAWKKSIFK-------QVDHMV 173
             FWK Q+ + +N  + F  K   K+         GV I +    F+        ++ +V
Sbjct: 93  NEFWKKQMMNRMNYGSNFTAKTPPKYWTKPLECMDGVGIFYNLDKFEYLFSSSLYLNDLV 152

Query: 174 VDFD----------DVKTSNIARRTITRNIAMYVALKFNDEFITKNFPNLLHSFDQNDIG 223
             FD          ++  +N A   I  +    VA   N   +   F  L H   ++ I 
Sbjct: 153 GTFDQQELHYLTHHNITLTNGAGDVIGEDSLYNVAKARNQVCL---FVMLRHRESKSII- 208

Query: 224 FIISTTHLFWHPFGTFERTR--QCYILLEKMKKFID--ILNVKDHLKTHWYPFICGDFNS 279
            ++  THL+W     ++  +  QC I++ K+++ I   ++ ++    ++      GDFNS
Sbjct: 209 -VVINTHLYW----KYDEVKLVQCLIIMRKLQRIIKGLLMGIEGVTYSNVKILFSGDFNS 263

Query: 280 TPRDA 284
           + RD+
Sbjct: 264 S-RDS 267

>Kpol_1044.6 s1044 (12595..13362,13366..13545,13548..13718) [1119
           bp, 372 aa] {ON}
           (12595..13362,13366..13545,13548..13718) [1119 nt, 373
           aa]
          Length = 372

 Score = 50.4 bits (119), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 63/245 (25%), Positives = 111/245 (45%), Gaps = 39/245 (15%)

Query: 70  GFKFSLMTYNCLAQAMIRREVFSDSGPALK-WFRRSKVLMNEIT-YYNPDILCLQEIDDF 127
           G KF+L+TYN L+   +  +V++      K W  R  +L +E+   Y  D++CLQE+   
Sbjct: 34  GHKFTLLTYNMLSPYYMWPQVYNYVPDEFKDWKYRHMLLEDELLRTYKADVMCLQELTWE 93

Query: 128 QYENFWKDQLESNLNMNTFYY-----------KQKIKHHGVLIAWKKSIFKQVDHMVVDF 176
            Y ++WK      LN  + +            +Q++   G+     K  F+ +    +  
Sbjct: 94  DYLSYWKPVFGKQLNYGSKFVAKTPPKYWDKTEQQMDGEGIFFNLDK--FEYISSTRLFL 151

Query: 177 DDVKTS------NIARRTITRNI----------AMYVALKFNDEFITKNFPNLLHSFDQN 220
           +DV  +      N  +R I +             +Y  LK  ++     F +L H  + N
Sbjct: 152 NDVVNTFEEHELNYMKRKIVKLTDGAGNPVGEETLYEILKNRNQVCL--FVSLKHK-ETN 208

Query: 221 DIGFIISTTHLFWHPFGTFERTRQCYILLEKMKKFI-DILNVKDHLKTHWYPFICGDFNS 279
           ++ F++  THL+W  +   + T QC I++ K+ + I ++L   D   +    FI GD NS
Sbjct: 209 NV-FVVINTHLYWK-YDEVKLT-QCMIIMRKLSQIINELLIGADPSLSKDVIFITGDLNS 265

Query: 280 TPRDA 284
           T RD+
Sbjct: 266 T-RDS 269

>Ecym_2636 Chr2 complement(1225559..1226662) [1104 bp, 367 aa] {ON}
           similar to Ashbya gossypii ACR277C
          Length = 367

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 58/252 (23%), Positives = 102/252 (40%), Gaps = 58/252 (23%)

Query: 73  FSLMTYNCLAQAMIRREVFSDSGPALK-WFRRSKVLMNEITY-YNPDILCLQEIDDFQYE 130
            S++TYN L+   +  +V++      K W  R K+L  E+ Y +  DILCLQE+    Y 
Sbjct: 30  LSVLTYNMLSPYYMWPQVYTYVPDKFKDWNYRHKLLEYELFYKHKADILCLQELTTEDYN 89

Query: 131 NFWKDQLESNLN-----------------------MNTFYYKQKIKHHGVLIAWKKSIFK 167
            FW+ Q++  L+                       + TFY  +K++     + +      
Sbjct: 90  QFWRKQMKRRLSYGSNFISKPPPKYWTAGLQEMDGVGTFYNTEKLEFISSTVIYLNDFLS 149

Query: 168 QVDHMVVDFDDVKTSNIARRTITRNIAMYVALKFNDEFITKNFPNLLHSFDQNDIGF--- 224
                 +D+       ++RR IT+          ND   T++  ++L   D+N +     
Sbjct: 150 MFSKRELDW-------MSRRQITQTNGA------NDPVTTRSLLSIL--LDRNQVCLFVC 194

Query: 225 ----------IISTTHLFWHPFGTFERTRQCYILLEKMKKFIDILNVKDHLKTHWY--PF 272
                     ++  THL+W       +  QC  ++ K+K+ I+ L       T+      
Sbjct: 195 LREKDTKSLIVVVNTHLYWKYDEV--KLSQCLTIMRKLKQVINKLTTTLEGVTYSQIKII 252

Query: 273 ICGDFNSTPRDA 284
           + GD NST RD+
Sbjct: 253 LGGDLNST-RDS 263

>ZYRO0D05588g Chr4 (482402..483472) [1071 bp, 356 aa] {ON} similar
           to uniprot|Q08213 Saccharomyces cerevisiae YOL042W
          Length = 356

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 58/248 (23%), Positives = 100/248 (40%), Gaps = 48/248 (19%)

Query: 72  KFSLMTYNCLAQAMIRREVFSDSGPALK-WFRRSKVLMNEI-TYYNPDILCLQEIDDFQY 129
           K S++TYN L+   +  +V++      K W  R K+L  EI   Y  DI+CLQE+    Y
Sbjct: 21  KLSVLTYNMLSPYYMWPQVYTYVPDEYKKWNYRHKLLQKEILGLYRADIMCLQELTSLDY 80

Query: 130 ENFWKDQLESNLNMNTFYYKQKIKHHGVLIAWKKSIFKQVDHMVVDFDDVKTSNIARRTI 189
           + +W   L    N  + Y  +    +     W++S+  ++D + V +D  K   I+   I
Sbjct: 81  QQYWNKVLMEKYNYGSKYIAKPPPKY-----WERSL-SEMDGVGVFYDLNKFDYISSTGI 134

Query: 190 TRNIAMYV-------------------------ALKFNDEFITKN----FPNLLHSFDQN 220
             N                               +  +D    +N    F +L H     
Sbjct: 135 YLNDLFGTFDLKEQNYLEHKMLQLTDGQGNPMEKMTLSDVLKGRNQVCMFVSLRHK--AT 192

Query: 221 DIGFIISTTHLFWHPFGTFERTR--QCYILLEKMKKFID--ILNVKDHLKTHWYPFICGD 276
           +   I+  THL+W     ++  +  QC I++ ++ K I   ++ V+D           GD
Sbjct: 193 NTFLIVINTHLYW----KYDEVKLAQCMIIMRRLSKIIKDLLIGVQDTTYNKVKIIFAGD 248

Query: 277 FNSTPRDA 284
            NS+ RD+
Sbjct: 249 MNSS-RDS 255

>TPHA0L00530 Chr12 (91623..92798) [1176 bp, 391 aa] {ON} Anc_7.90
           YOL042W
          Length = 391

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 49/218 (22%), Positives = 96/218 (44%), Gaps = 25/218 (11%)

Query: 72  KFSLMTYNCLAQAMIRREVFSDSGPALK-WFRRSKVLMNEITY-YNPDILCLQEIDDFQY 129
           KF+++TYN L+   +  +V++      K W  R K+L  E+   Y  DI+CLQE+    Y
Sbjct: 47  KFTMLTYNMLSPHYMWPQVYTYVPDQYKDWKYRHKLLEFELMQKYKADIMCLQELTWEDY 106

Query: 130 ENFWKDQLESNLNMNT---------FYYKQKIKHHGVLIAWKKSIFKQV-------DHMV 173
            ++WK +    +N  +         ++ K K +  G  I + +  F+ +       + +V
Sbjct: 107 ISYWKPKCNEKMNYGSKFVAKTPPAYWEKTKQEMDGEGIFFNQEKFEYISSTKLFLNDVV 166

Query: 174 VDFDDVKTSNIARRTITRNIAMYVALKFNDEFITKNFPNLLHSF-----DQNDIGFIIST 228
             F++ +   + ++ +T           N+ F      N +  F        +  F++  
Sbjct: 167 GTFEEHEIEYMKKKIVTLTDGAGKPTGTNNLFTVATTRNQVCLFVSLRHKATNTVFVVIN 226

Query: 229 THLFWHPFGTFERTRQCYILLEKMKKFIDILNVKDHLK 266
           THL+W  +   + T QC I++ K+   I+ L +  + K
Sbjct: 227 THLYWK-YDEVKLT-QCMIIMRKLSHIINELLIGSNAK 262

>NDAI0A08530 Chr1 complement(1963920..1965017) [1098 bp, 365 aa]
           {ON} Anc_7.90 YOL042W
          Length = 365

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 53/232 (22%), Positives = 105/232 (45%), Gaps = 26/232 (11%)

Query: 72  KFSLMTYNCLAQAMIRREVFSDSGPALK-W-FRRSKVLMNEITYYNPDILCLQEIDDFQY 129
           KF++++YN L+ + +  +V++      K W +R + + +  +  Y  DI+C+QE+    Y
Sbjct: 29  KFTVLSYNMLSPSYMWPQVYTYVPDQYKDWNYRHTLLELELLDKYKADIMCVQEMTKRDY 88

Query: 130 ENFWKDQLESNLNMNT---------FYYKQKIKHHGVLIAWKKSIFKQVDHMVV---DFD 177
            ++W+ +L + +   +         ++ +  +   GV I +    F  +    +   +F 
Sbjct: 89  IDYWQLKLGTTIGYGSKFIAKSPPKYWERHLLDLDGVAIFYNLQKFDFISSSGIYLNEFL 148

Query: 178 DV----KTSNIARRT--ITRNIAMYVALKFNDEFIT-KNFPNLLHSFDQNDIG--FIIST 228
           DV    +   +  +T  +T    + +  K   E ++ KN  +L       + G  FII  
Sbjct: 149 DVFNPEELQYLKEKTLELTDGAGIKIDEKTLFEILSVKNQVSLFVCLKHKETGQVFIIIN 208

Query: 229 THLFWHPFGTFERTRQCYILLEKMKKFIDILNVKDHLKTHWYPFICGDFNST 280
           THL+W       +  QC I++ ++ K ID L ++D   +       GD NST
Sbjct: 209 THLYWKYDEV--KLSQCIIIMRELSKIIDEL-LQDVRHSKVKIIFAGDLNST 257

>YDL056W Chr4 (352877..355378) [2502 bp, 833 aa] {ON}
           MBP1Transcription factor involved in regulation of cell
           cycle progression from G1 to S phase, forms a complex
           with Swi6p that binds to MluI cell cycle box regulatory
           element in promoters of DNA synthesis genes
          Length = 833

 Score = 32.0 bits (71), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 23/99 (23%), Positives = 45/99 (45%), Gaps = 5/99 (5%)

Query: 237 GTFERTRQCYILLEKMKKFIDILNVKDHLKTHWYPFICGDFNSTPRDAPYLSMTSKPIEY 296
           G F + +  ++ L   K+  +  +V D LK   + F   D +++P  AP     SK    
Sbjct: 68  GGFGKYQGTWVPLNIAKQLAEKFSVYDQLKP-LFDFTQTDGSASPPPAPKHHHASK---- 122

Query: 297 TGREKKVIECSTAYKFSKRRNGEIGDSDEEEEKKLINQP 335
             R+K +   ST+     +RN +  + ++ +  K++  P
Sbjct: 123 VDRKKAIRSASTSAIMETKRNNKKAEENQFQSSKILGNP 161

>Suva_16.445 Chr16 (767762..775252) [7491 bp, 2496 aa] {ON} YPR117W
           (REAL)
          Length = 2496

 Score = 32.0 bits (71), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 39/70 (55%), Gaps = 4/70 (5%)

Query: 168 QVDHMVVDFDDVK-TSNIARRTITRNIAMYVALKF---NDEFITKNFPNLLHSFDQNDIG 223
           ++ H+V  FD+ K TSN + +++  NI  +   +F   N E I  NF + LH  ++ ++ 
Sbjct: 395 EILHLVDKFDNSKATSNTSTKSMALNILDFDIDRFPSFNFELIMSNFVSRLHISNEENVT 454

Query: 224 FIISTTHLFW 233
           F + +TH  +
Sbjct: 455 FNVFSTHALF 464

>Suva_4.193 Chr4 (342458..344989) [2532 bp, 843 aa] {ON} YDL056W
           (REAL)
          Length = 843

 Score = 31.6 bits (70), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 23/99 (23%), Positives = 45/99 (45%), Gaps = 5/99 (5%)

Query: 237 GTFERTRQCYILLEKMKKFIDILNVKDHLKTHWYPFICGDFNSTPRDAPYLSMTSKPIEY 296
           G F + +  ++ L   K+  +  +V D LK   + F   D +++P  AP     SK    
Sbjct: 68  GGFGKYQGTWVPLNIAKRLAEKFSVYDQLKP-LFDFTQTDGSASPPPAPKHHHASK---- 122

Query: 297 TGREKKVIECSTAYKFSKRRNGEIGDSDEEEEKKLINQP 335
             R+K +   ST+     +RN +  + ++ +  K++  P
Sbjct: 123 VDRKKAIRSVSTSAIMDTKRNSKKSEDNQFQNSKILGNP 161

>KLTH0F02200g Chr6 complement(176232..177281) [1050 bp, 349 aa] {ON}
           similar to uniprot|P53839 Saccharomyces cerevisiae
           YNL274C Putative hydroxyisocaproate dehydrogenase
          Length = 349

 Score = 30.8 bits (68), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 25/50 (50%)

Query: 250 EKMKKFIDILNVKDHLKTHWYPFICGDFNSTPRDAPYLSMTSKPIEYTGR 299
           EK+ K  D++ ++D      +  +C D NS    A  +S T   ++ TGR
Sbjct: 20  EKLAKIADVVTIEDSTTRPEFLKMCQDPNSAVSKAQIVSRTFASVQQTGR 69

>Smik_16.360 Chr16 (638042..645514) [7473 bp, 2490 aa] {ON} YPR117W
           (REAL)
          Length = 2490

 Score = 31.2 bits (69), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 24/94 (25%), Positives = 45/94 (47%), Gaps = 10/94 (10%)

Query: 150 QKIKHHGVLIAWKKSIFKQVD------HMVVDFDDVKTSNIARRTITRNIAMYVAL---- 199
           QK K   +L     S+F  +       H+V  FD+ +TS+  + T + +  + + +    
Sbjct: 371 QKTKISSILNIINPSVFLNIHQVLEIFHLVDRFDNSETSSYTKATDSSSNILDLDIDRMP 430

Query: 200 KFNDEFITKNFPNLLHSFDQNDIGFIISTTHLFW 233
            FN E +  NF + LH  D+ ++ F + +TH  +
Sbjct: 431 SFNFELLMSNFISRLHISDEENVTFKVFSTHALF 464

>TPHA0A03410 Chr1 (748156..749253) [1098 bp, 365 aa] {ON} Anc_3.392
           YBR129C
          Length = 365

 Score = 30.8 bits (68), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 27/47 (57%)

Query: 216 SFDQNDIGFIISTTHLFWHPFGTFERTRQCYILLEKMKKFIDILNVK 262
           +FD N+   II TT L+ H    F RT+  ++  E   +F++I +VK
Sbjct: 254 TFDPNNKSHIIFTTLLYVHVKSRFNRTKWKHLKCELTNQFLNIYSVK 300

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.137    0.414 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 57,563,764
Number of extensions: 2809303
Number of successful extensions: 10193
Number of sequences better than 10.0: 88
Number of HSP's gapped: 10240
Number of HSP's successfully gapped: 90
Length of query: 480
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 367
Effective length of database: 40,524,141
Effective search space: 14872359747
Effective search space used: 14872359747
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 68 (30.8 bits)