Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0D03290singletonON40040020700.0
TBLA0E03220singletonON40040019900.0
TBLA0C01370singletonON42339716060.0
SAKL0H22044g5.58ON40040015420.0
SAKL0C00396gsingletonON40039915400.0
Kpol_1054.16singletonON40039915360.0
CAGL0I02024gsingletonON40040015360.0
Kpol_1018.121na 1ON40039715350.0
CAGL0I02574g5.58ON40140115260.0
KAFR0F03530singletonON40039715010.0
Kpol_534.36singletonON39939914980.0
NCAS0D012805.58ON40040014970.0
NDAI0A08130singletonON40139814950.0
KAFR0E023405.58ON40039714940.0
NCAS0J01750singletonON40040014780.0
TPHA0A02230na 1ON40040014770.0
YHR179W (OYE2)5.58ON40039714740.0
Skud_8.2435.58ON40039714720.0
NCAS0C02260singletonON45240014720.0
Suva_15.3795.58ON40040014630.0
Smik_8.2635.58ON40039714610.0
KNAG0E007905.58ON39739714560.0
TDEL0G008205.58ON39839714470.0
NDAI0C034605.58ON39940014450.0
KLTH0E07920g5.58ON40039714390.0
TBLA0G03670singletonON40039714390.0
TBLA0I03570singletonON40040014370.0
CAGL0K10890gsingletonON40040014320.0
KLTH0E07898gsingletonON40039714250.0
TBLA0A10550singletonON40040014240.0
Kwal_47.16561singletonON39939914220.0
NDAI0B009205.58ON42639714200.0
NCAS0B00730singletonON39539514010.0
TBLA0J00530singletonON40039714000.0
KAFR0B07070singletonON40039613940.0
NDAI0E00850singletonON39939513900.0
YPL171C (OYE3)na 2ON40039713670.0
CAGL0L09537gsingletonON40040013660.0
NCAS0B01090na 3ON39539513610.0
NDAI0A00330singletonON39739513600.0
Kpol_370.3singletonON40039813520.0
NCAS0E038905.58ON39339113470.0
KNAG0G03460singletonON40040013440.0
ZYRO0C11902g5.58ON40039513380.0
KAFR0F03540singletonON40040013320.0
KLLA0A09075g5.58ON39839513230.0
Suva_16.139na 2ON39139713180.0
TBLA0D00160singletonON41839413071e-179
NDAI0E01890singletonON39939513011e-179
TDEL0E00270singletonON40238212951e-178
KNAG0B05410singletonON39839712861e-177
KNAG0L00690singletonON39839712751e-175
KAFR0F03550singletonON40040012721e-174
TPHA0H02440singletonON39739712691e-174
TBLA0B02130singletonON39839712681e-174
TBLA0G00610singletonON39940012481e-171
KLTH0G01584gsingletonON40039612461e-171
KAFR0E00120singletonON40040012341e-169
KNAG0D03170singletonON41339512161e-166
ZYRO0F13618gsingletonON40239512061e-164
AGR329CsingletonON39938911981e-163
ZYRO0F12144gsingletonON39739711961e-163
KNAG0J00330na 3ON39839711871e-162
NCAS0C04110singletonON38838911751e-160
NCAS0D04260singletonON41939711651e-158
TBLA0E00660singletonON39538611391e-154
TBLA0C07300singletonON30630610791e-147
TBLA0D03340singletonON28928910311e-140
TPHA0P01030singletonON39339810421e-140
Kpol_370.4singletonON38939510111e-135
ZYRO0C11924gsingletonON38838210091e-135
TBLA0A04730singletonON2692708031e-105
KAFR0I00110singletonON2071936216e-79
ZYRO0F16852gsingletonON3373486222e-77
NDAI0A07930singletonON1471475618e-71
ZYRO0G15444gsingletonON3393534421e-50
TBLA0D03350singletonON1611433941e-45
Smik_6.368singletonOFF3283693688e-40
NDAI0C04500singletonON81722656e-28
KAFR0B044855.58ON2723412622e-25
CAGL0K05687g1.53ON3883482322e-20
SAKL0C01738g1.53ON4292512304e-20
KAFR0D040901.53ON3812592242e-19
KLLA0C01672g1.53ON4092261914e-15
Kpol_2000.911.53ON3822451523e-10
Skud_16.110singletonON70401153e-07
TPHA0B047401.53ON3932391265e-07
Kwal_47.175195.58ON65381065e-06
Skud_16.109na 2ON3428966e-05
NDAI0F043701.53ON4352231081e-04
KNAG0F003001.53ON343219840.067
NDAI0C039205.285ON862114760.89
Ecym_52963.206ON10843691.6
TPHA0G034302.519ON42260731.7
CAGL0E06226g5.285ON92498722.7
NCAS0F024305.285ON86279695.4
KLLA0C11715g8.210ON709110687.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0D03290
         (400 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0D03290 Chr4 complement(821240..822442) [1203 bp, 400 aa] {O...   801   0.0  
TBLA0E03220 Chr5 complement(808667..809869) [1203 bp, 400 aa] {O...   771   0.0  
TBLA0C01370 Chr3 (311585..312856) [1272 bp, 423 aa] {ON}              623   0.0  
SAKL0H22044g Chr8 (1926684..1927886) [1203 bp, 400 aa] {ON} high...   598   0.0  
SAKL0C00396g Chr3 complement(35526..36728) [1203 bp, 400 aa] {ON...   597   0.0  
Kpol_1054.16 s1054 (39314..40516) [1203 bp, 400 aa] {ON} (39314....   596   0.0  
CAGL0I02024g Chr9 complement(172231..173433) [1203 bp, 400 aa] {...   596   0.0  
Kpol_1018.121 s1018 complement(320805..322007) [1203 bp, 400 aa]...   595   0.0  
CAGL0I02574g Chr9 (232393..233598) [1206 bp, 401 aa] {ON} highly...   592   0.0  
KAFR0F03530 Chr6 (702060..703262) [1203 bp, 400 aa] {ON}              582   0.0  
Kpol_534.36 s534 (89925..90272,90276..91127) [1200 bp, 399 aa] {...   581   0.0  
NCAS0D01280 Chr4 complement(232270..233472) [1203 bp, 400 aa] {O...   581   0.0  
NDAI0A08130 Chr1 complement(1863451..1864656) [1206 bp, 401 aa] ...   580   0.0  
KAFR0E02340 Chr5 (470967..472169) [1203 bp, 400 aa] {ON} Anc_5.5...   580   0.0  
NCAS0J01750 Chr10 complement(324339..325541) [1203 bp, 400 aa] {...   573   0.0  
TPHA0A02230 Chr1 (461324..462526) [1203 bp, 400 aa] {ON}              573   0.0  
YHR179W Chr8 (462502..463704) [1203 bp, 400 aa] {ON}  OYE2Conser...   572   0.0  
Skud_8.243 Chr8 (433873..435075) [1203 bp, 400 aa] {ON} YHR179W ...   571   0.0  
NCAS0C02260 Chr3 complement(425626..426984) [1359 bp, 452 aa] {O...   571   0.0  
Suva_15.379 Chr15 (668836..670038) [1203 bp, 400 aa] {ON} YHR179...   568   0.0  
Smik_8.263 Chr8 (439298..440500) [1203 bp, 400 aa] {ON} YHR179W ...   567   0.0  
KNAG0E00790 Chr5 (142962..144155) [1194 bp, 397 aa] {ON} Anc_5.5...   565   0.0  
TDEL0G00820 Chr7 complement(168417..169613) [1197 bp, 398 aa] {O...   561   0.0  
NDAI0C03460 Chr3 (792929..794128) [1200 bp, 399 aa] {ON} Anc_5.58     561   0.0  
KLTH0E07920g Chr5 (728285..729487) [1203 bp, 400 aa] {ON} highly...   558   0.0  
TBLA0G03670 Chr7 complement(974043..975245) [1203 bp, 400 aa] {O...   558   0.0  
TBLA0I03570 Chr9 complement(855914..857116) [1203 bp, 400 aa] {O...   558   0.0  
CAGL0K10890g Chr11 (1063220..1064422) [1203 bp, 400 aa] {ON} hig...   556   0.0  
KLTH0E07898g Chr5 (725950..727152) [1203 bp, 400 aa] {ON} highly...   553   0.0  
TBLA0A10550 Chr1 (2607210..2608412) [1203 bp, 400 aa] {ON}            553   0.0  
Kwal_47.16561 s47 (4316..5515) [1200 bp, 399 aa] {ON} YHR179W (O...   552   0.0  
NDAI0B00920 Chr2 (212588..213868) [1281 bp, 426 aa] {ON} Anc_5.58     551   0.0  
NCAS0B00730 Chr2 (110836..112023) [1188 bp, 395 aa] {ON}              544   0.0  
TBLA0J00530 Chr10 complement(103254..104456) [1203 bp, 400 aa] {...   543   0.0  
KAFR0B07070 Chr2 complement(1474959..1476161) [1203 bp, 400 aa] ...   541   0.0  
NDAI0E00850 Chr5 complement(170233..171432) [1200 bp, 399 aa] {O...   540   0.0  
YPL171C Chr16 complement(226169..227371) [1203 bp, 400 aa] {ON} ...   531   0.0  
CAGL0L09537g Chr12 (1029031..1030233) [1203 bp, 400 aa] {ON} hig...   530   0.0  
NCAS0B01090 Chr2 (180367..181554) [1188 bp, 395 aa] {ON}              528   0.0  
NDAI0A00330 Chr1 (47534..48727) [1194 bp, 397 aa] {ON}                528   0.0  
Kpol_370.3 s370 (3999..5201) [1203 bp, 400 aa] {ON} (3999..5201)...   525   0.0  
NCAS0E03890 Chr5 complement(763948..765129) [1182 bp, 393 aa] {O...   523   0.0  
KNAG0G03460 Chr7 (741939..743141) [1203 bp, 400 aa] {ON}              522   0.0  
ZYRO0C11902g Chr3 (931466..932668) [1203 bp, 400 aa] {ON} highly...   520   0.0  
KAFR0F03540 Chr6 (703965..705167) [1203 bp, 400 aa] {ON}              517   0.0  
KLLA0A09075g Chr1 complement(792171..793367) [1197 bp, 398 aa] {...   514   0.0  
Suva_16.139 Chr16 complement(235387..236562) [1176 bp, 391 aa] {...   512   0.0  
TBLA0D00160 Chr4 complement(36313..37569) [1257 bp, 418 aa] {ON}      508   e-179
NDAI0E01890 Chr5 complement(384211..385410) [1200 bp, 399 aa] {O...   505   e-179
TDEL0E00270 Chr5 (60549..61757) [1209 bp, 402 aa] {ON}                503   e-178
KNAG0B05410 Chr2 complement(1046164..1047360) [1197 bp, 398 aa] ...   499   e-177
KNAG0L00690 Chr12 complement(110526..111722) [1197 bp, 398 aa] {...   495   e-175
KAFR0F03550 Chr6 (706557..707759) [1203 bp, 400 aa] {ON}              494   e-174
TPHA0H02440 Chr8 complement(575387..576580) [1194 bp, 397 aa] {O...   493   e-174
TBLA0B02130 Chr2 (488878..490074) [1197 bp, 398 aa] {ON}              493   e-174
TBLA0G00610 Chr7 complement(133711..134910) [1200 bp, 399 aa] {O...   485   e-171
KLTH0G01584g Chr7 complement(114328..115530) [1203 bp, 400 aa] {...   484   e-171
KAFR0E00120 Chr5 (19340..20542) [1203 bp, 400 aa] {ON}                479   e-169
KNAG0D03170 Chr4 complement(567087..568328) [1242 bp, 413 aa] {O...   473   e-166
ZYRO0F13618g Chr6 (1122697..1123905) [1209 bp, 402 aa] {ON} simi...   469   e-164
AGR329C Chr7 complement(1346011..1347210) [1200 bp, 399 aa] {ON}...   466   e-163
ZYRO0F12144g Chr6 complement(986860..988053) [1194 bp, 397 aa] {...   465   e-163
KNAG0J00330 Chr10 complement(52717..53913) [1197 bp, 398 aa] {ON}     461   e-162
NCAS0C04110 Chr3 (838638..839804) [1167 bp, 388 aa] {ON}              457   e-160
NCAS0D04260 Chr4 complement(805403..806662) [1260 bp, 419 aa] {O...   453   e-158
TBLA0E00660 Chr5 complement(130778..131965) [1188 bp, 395 aa] {O...   443   e-154
TBLA0C07300 Chr3 complement(1778734..1779654) [921 bp, 306 aa] {...   420   e-147
TBLA0D03340 Chr4 (832010..832879) [870 bp, 289 aa] {ON}               401   e-140
TPHA0P01030 Chr16 (207281..208462) [1182 bp, 393 aa] {ON}             405   e-140
Kpol_370.4 s370 (5694..6863) [1170 bp, 389 aa] {ON} (5694..6863)...   394   e-135
ZYRO0C11924g Chr3 (932751..933917) [1167 bp, 388 aa] {ON} simila...   393   e-135
TBLA0A04730 Chr1 complement(1173457..1174266) [810 bp, 269 aa] {...   313   e-105
KAFR0I00110 Chr9 (21926..22549) [624 bp, 207 aa] {ON}                 243   6e-79
ZYRO0F16852g Chr6 complement(1402055..1403068) [1014 bp, 337 aa]...   244   2e-77
NDAI0A07930 Chr1 complement(1823416..1823859) [444 bp, 147 aa] {...   220   8e-71
ZYRO0G15444g Chr7 (1256468..1257487) [1020 bp, 339 aa] {ON} weak...   174   1e-50
TBLA0D03350 Chr4 (835570..836055) [486 bp, 161 aa] {ON}  OYE fam...   156   1e-45
Smik_6.368 Chr6 (596883..597008,597012..597242,597246..597401,59...   146   8e-40
NDAI0C04500 Chr3 complement(1020217..1020462) [246 bp, 81 aa] {O...   106   6e-28
KAFR0B04485 Chr2 (930962..931780) [819 bp, 272 aa] {ON}               105   2e-25
CAGL0K05687g Chr11 (555370..556536) [1167 bp, 388 aa] {ON} simil...    94   2e-20
SAKL0C01738g Chr3 complement(147860..149149) [1290 bp, 429 aa] {...    93   4e-20
KAFR0D04090 Chr4 (808332..809477) [1146 bp, 381 aa] {ON} Anc_1.53      91   2e-19
KLLA0C01672g Chr3 complement(131543..132772) [1230 bp, 409 aa] {...    78   4e-15
Kpol_2000.91 s2000 (205107..206255) [1149 bp, 382 aa] {ON} (2051...    63   3e-10
Skud_16.110 Chr16 complement(198564..198761,198765..198776) [210...    49   3e-07
TPHA0B04740 Chr2 (1116411..1117592) [1182 bp, 393 aa] {ON} Anc_1...    53   5e-07
Kwal_47.17519 s47 (437989..438186) [198 bp, 65 aa] {ON} YHR179W ...    45   5e-06
Skud_16.109 Chr16 complement(198429..198530) [102 bp, 34 aa] {ON...    42   6e-05
NDAI0F04370 Chr6 (1070446..1071753) [1308 bp, 435 aa] {ON} Anc_1...    46   1e-04
KNAG0F00300 Chr6 complement(35309..36340) [1032 bp, 343 aa] {ON}...    37   0.067
NDAI0C03920 Chr3 (890187..892775) [2589 bp, 862 aa] {ON} Anc_5.285     34   0.89 
Ecym_5296 Chr5 complement(599170..599454,599532..599573) [327 bp...    31   1.6  
TPHA0G03430 Chr7 (731482..732750) [1269 bp, 422 aa] {ON} Anc_2.519     33   1.7  
CAGL0E06226g Chr5 complement(623237..625826,626688..626872) [277...    32   2.7  
NCAS0F02430 Chr6 (480483..483071) [2589 bp, 862 aa] {ON} Anc_5.2...    31   5.4  
KLLA0C11715g Chr3 (1008738..1010867) [2130 bp, 709 aa] {ON} simi...    31   7.5  

>TBLA0D03290 Chr4 complement(821240..822442) [1203 bp, 400 aa] {ON} 
          Length = 400

 Score =  801 bits (2070), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 390/400 (97%), Positives = 390/400 (97%)

Query: 1   MPFNTESKPVALKDTDLFKPLKVGNTTVLNRVVLPPLTRMRAHYPGNVPNRDWTLEYYDQ 60
           MPFNTESKPVALKDTDLFKPLKVGNTTVLNRVVLPPLTRMRAHYPGNVPNRDWTLEYYDQ
Sbjct: 1   MPFNTESKPVALKDTDLFKPLKVGNTTVLNRVVLPPLTRMRAHYPGNVPNRDWTLEYYDQ 60

Query: 61  RSKRPGTMLITEGVFPSAKAGGYDNAPGIWTEEQMVEWKKIFDKIHENESFVWPQLWVLG 120
           RSKRPGTMLITEGVFPSAKAGGYDNAPGIWTEEQMVEWKKIFDKIHENESFVWPQLWVLG
Sbjct: 61  RSKRPGTMLITEGVFPSAKAGGYDNAPGIWTEEQMVEWKKIFDKIHENESFVWPQLWVLG 120

Query: 121 READPLSLARDGLRYDSASDNVWRTXXXXXXXXXXGIEQHGITKDEIKQYIKDYVQGARN 180
           READPLSLARDGLRYDSASDNVWRT          GIEQHGITKDEIKQYIKDYVQGARN
Sbjct: 121 READPLSLARDGLRYDSASDNVWRTKEAEEEAKKAGIEQHGITKDEIKQYIKDYVQGARN 180

Query: 181 SIKCGADGIEIHAANGYLLNQFLDPVSNKRTDEYGGSIKNRACFTLEVVDALVDAIGEDK 240
           SIKCGADGIEIHAANGYLLNQFLDPVSNKRTDEYGGSIKNRACFTLEVVDALVDAIGEDK
Sbjct: 181 SIKCGADGIEIHAANGYLLNQFLDPVSNKRTDEYGGSIKNRACFTLEVVDALVDAIGEDK 240

Query: 241 VGIRLAPYNTNGDMSGSWDPTVFAHYAYVLGKLEKRAQAGKRLAFVHIFEPRVSNPWDNE 300
           VGIRLAPYNTNGDMSGSWDPTVFAHYAYVLGKLEKRAQAGKRLAFVHIFEPRVSNPWDNE
Sbjct: 241 VGIRLAPYNTNGDMSGSWDPTVFAHYAYVLGKLEKRAQAGKRLAFVHIFEPRVSNPWDNE 300

Query: 301 GDGAYNGGTTDYVYSIWKGVVIRTGNLAIHPEIAKEFLKQPNTLLGYGRYFISNPDLVDR 360
           GDGAYNGGTTDYVYSIWKGVVIRTGNLAIHPEIAKEFLKQPNTLLGYGRYFISNPDLVDR
Sbjct: 301 GDGAYNGGTTDYVYSIWKGVVIRTGNLAIHPEIAKEFLKQPNTLLGYGRYFISNPDLVDR 360

Query: 361 LEKGLPLNLYDRPRFYAMPDKGYIDYPTYDEAIKMGWGEK 400
           LEKGLPLNLYDRPRFYAMPDKGYIDYPTYDEAIKMGWGEK
Sbjct: 361 LEKGLPLNLYDRPRFYAMPDKGYIDYPTYDEAIKMGWGEK 400

>TBLA0E03220 Chr5 complement(808667..809869) [1203 bp, 400 aa] {ON} 
          Length = 400

 Score =  771 bits (1990), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/400 (93%), Positives = 383/400 (95%)

Query: 1   MPFNTESKPVALKDTDLFKPLKVGNTTVLNRVVLPPLTRMRAHYPGNVPNRDWTLEYYDQ 60
           MPFNTE KPVALKDTDLFKPLKVGNTTVLNRVVLPPLTRMRAHYPGNVPNRDWTLEYYDQ
Sbjct: 1   MPFNTEFKPVALKDTDLFKPLKVGNTTVLNRVVLPPLTRMRAHYPGNVPNRDWTLEYYDQ 60

Query: 61  RSKRPGTMLITEGVFPSAKAGGYDNAPGIWTEEQMVEWKKIFDKIHENESFVWPQLWVLG 120
           RSKRPGTMLITEGVFPSA+AGGYDNAPGIWT+EQMVEWKKIFDKIH+N SFVWPQLWVLG
Sbjct: 61  RSKRPGTMLITEGVFPSAQAGGYDNAPGIWTKEQMVEWKKIFDKIHKNGSFVWPQLWVLG 120

Query: 121 READPLSLARDGLRYDSASDNVWRTXXXXXXXXXXGIEQHGITKDEIKQYIKDYVQGARN 180
           READPLSLARDGLRYDSASDNVWRT          GIEQHGITKDEIKQYIKDYVQGA+N
Sbjct: 121 READPLSLARDGLRYDSASDNVWRTKETEEEAKKAGIEQHGITKDEIKQYIKDYVQGAKN 180

Query: 181 SIKCGADGIEIHAANGYLLNQFLDPVSNKRTDEYGGSIKNRACFTLEVVDALVDAIGEDK 240
           SIKCGADGIEIHAANGYLLNQFLDPVSNKRTDEYGGSI+NRA FTLEVVDALVDAIGEDK
Sbjct: 181 SIKCGADGIEIHAANGYLLNQFLDPVSNKRTDEYGGSIENRARFTLEVVDALVDAIGEDK 240

Query: 241 VGIRLAPYNTNGDMSGSWDPTVFAHYAYVLGKLEKRAQAGKRLAFVHIFEPRVSNPWDNE 300
           VGIRLAPYNTNG MSGSWDP VFAHYAYVLG+LEKRAQAGKRLAFVHIFEPRVSNPWDNE
Sbjct: 241 VGIRLAPYNTNGGMSGSWDPCVFAHYAYVLGELEKRAQAGKRLAFVHIFEPRVSNPWDNE 300

Query: 301 GDGAYNGGTTDYVYSIWKGVVIRTGNLAIHPEIAKEFLKQPNTLLGYGRYFISNPDLVDR 360
           GDGAYNGGTT+YVYSIWKGVVIRTGNLAIHPE+AKEFLK PNTLLGYGRYFISNPDLVDR
Sbjct: 301 GDGAYNGGTTEYVYSIWKGVVIRTGNLAIHPEVAKEFLKYPNTLLGYGRYFISNPDLVDR 360

Query: 361 LEKGLPLNLYDRPRFYAMPDKGYIDYPTYDEAIKMGWGEK 400
           LEKGLPLNLYDRPRFYAM DKGYIDYPTYDEAIKMGWG++
Sbjct: 361 LEKGLPLNLYDRPRFYAMTDKGYIDYPTYDEAIKMGWGKE 400

>TBLA0C01370 Chr3 (311585..312856) [1272 bp, 423 aa] {ON} 
          Length = 423

 Score =  623 bits (1606), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/397 (73%), Positives = 338/397 (85%)

Query: 1   MPFNTESKPVALKDTDLFKPLKVGNTTVLNRVVLPPLTRMRAHYPGNVPNRDWTLEYYDQ 60
           MPFN + KPVAL DT+LFKP+ VGN  + NRVVL PLTRMRA +PGNVPN+ W +EYYDQ
Sbjct: 23  MPFNKDFKPVALGDTNLFKPITVGNCKLKNRVVLAPLTRMRAEHPGNVPNKKWAVEYYDQ 82

Query: 61  RSKRPGTMLITEGVFPSAKAGGYDNAPGIWTEEQMVEWKKIFDKIHENESFVWPQLWVLG 120
           RSK PGT+LITE VF SA+AGGYDNAPGIW+EEQM EWKKIF KIHEN SFVWPQLW LG
Sbjct: 83  RSKTPGTLLITEAVFISAQAGGYDNAPGIWSEEQMAEWKKIFAKIHENGSFVWPQLWNLG 142

Query: 121 READPLSLARDGLRYDSASDNVWRTXXXXXXXXXXGIEQHGITKDEIKQYIKDYVQGARN 180
           R+A P  + RDGLRYDSASDN+W            GIEQHGIT+DEIKQYIKDYVQ A+N
Sbjct: 143 RQAFPECMKRDGLRYDSASDNIWMDDEVKEKAKNAGIEQHGITEDEIKQYIKDYVQAAKN 202

Query: 181 SIKCGADGIEIHAANGYLLNQFLDPVSNKRTDEYGGSIKNRACFTLEVVDALVDAIGEDK 240
            I+CGADGI+IH+AN YLLNQFLDPVSNKRTD+YGGSI+NRA FTLEVVDA+VDAIG ++
Sbjct: 203 CIECGADGIQIHSANSYLLNQFLDPVSNKRTDKYGGSIENRARFTLEVVDAIVDAIGAER 262

Query: 241 VGIRLAPYNTNGDMSGSWDPTVFAHYAYVLGKLEKRAQAGKRLAFVHIFEPRVSNPWDNE 300
             IRL+PYNT G MSG +DPT+ A YAYV+G+LEKRA  GKRLAF+ IFEPRVSNP+ +E
Sbjct: 263 TAIRLSPYNTFGGMSGGYDPTLLAQYAYVIGELEKRAINGKRLAFLDIFEPRVSNPFVDE 322

Query: 301 GDGAYNGGTTDYVYSIWKGVVIRTGNLAIHPEIAKEFLKQPNTLLGYGRYFISNPDLVDR 360
           G GAY+ GTT++V+SIWKG+V+RTGNLA+HPE+AKE+LK  NTLLGYGRY+ISNPDLV+R
Sbjct: 323 GVGAYDQGTTEFVFSIWKGIVVRTGNLALHPEVAKEYLKNKNTLLGYGRYYISNPDLVER 382

Query: 361 LEKGLPLNLYDRPRFYAMPDKGYIDYPTYDEAIKMGW 397
           L KGLPL+ YDRP FYAM DKGY DYPTY+EA+K+GW
Sbjct: 383 LRKGLPLSSYDRPSFYAMSDKGYTDYPTYEEAVKLGW 419

>SAKL0H22044g Chr8 (1926684..1927886) [1203 bp, 400 aa] {ON} highly
           similar to uniprot|Q03558 Saccharomyces cerevisiae
           YHR179W OYE2 Widely conserved NADPH oxidoreductase
           containing flavin mononucleotide (FMN) homologous to
           Oye3p with slight differences in ligand binding and
           catalytic properties may be involved in sterol
           metabolism
          Length = 400

 Score =  598 bits (1542), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/400 (70%), Positives = 333/400 (83%), Gaps = 1/400 (0%)

Query: 1   MPFNTESKPVALKDTDLFKPLKVGNTTVLNRVVLPPLTRMRAHYPGNVPNRDWTLEYYDQ 60
           MPF  + KP+ LK+T+LFKP+K+GNTTV +RVV+PPLTRMRAH+PGN+PNRDW +EYYDQ
Sbjct: 1   MPFVQDYKPIPLKNTNLFKPIKIGNTTVQHRVVMPPLTRMRAHHPGNIPNRDWAVEYYDQ 60

Query: 61  RSKRPGTMLITEGVFPSAKAGGYDNAPGIWTEEQMVEWKKIFDKIHENESFVWPQLWVLG 120
           RS+RPGTM+I+EG FPS ++GGYDNAPGIW+EEQ+ EWKKIF KIHEN+SFVW QLWVLG
Sbjct: 61  RSRRPGTMIISEGAFPSPQSGGYDNAPGIWSEEQITEWKKIFAKIHENKSFVWVQLWVLG 120

Query: 121 READPLSLARDGLRYDSASDNVWRTXXXXXXXXXXGIEQHGITKDEIKQYIKDYVQGARN 180
           R+A    LARDGLRYDSASD ++            G +QHGITKDEIKQYIK+YVQ A+N
Sbjct: 121 RQAFADVLARDGLRYDSASDEIYMDEDSKKRALTSGNKQHGITKDEIKQYIKEYVQAAKN 180

Query: 181 SIKCGADGIEIHAANGYLLNQFLDPVSNKRTDEYGGSIKNRACFTLEVVDALVDAIGEDK 240
           SI  GADG+EIH+ANGYLLNQFLDP+SNKRTDEYGGSI+NRA FTLEVVDA+VDAIG DK
Sbjct: 181 SIAAGADGVEIHSANGYLLNQFLDPISNKRTDEYGGSIENRARFTLEVVDAVVDAIGADK 240

Query: 241 VGIRLAPYNTNGDMSGSWDPTVFAHYAYVLGKLEKRAQAGKRLAFVHIFEPRVSNPWDNE 300
           VGIR +PY T G +SG  DPT+ A YAYV+G+LEKRA  GKRLAFVH+ EPRV+NP+  E
Sbjct: 241 VGIRFSPYGTFGSVSGGSDPTLLAQYAYVIGELEKRAHEGKRLAFVHLVEPRVTNPFFTE 300

Query: 301 GDGAYNGGTTDYVYSIWKGVVIRTGNLAIHPE-IAKEFLKQPNTLLGYGRYFISNPDLVD 359
           G+G Y  GT D+VYSIWKG +IR GN A+HPE  A++      TL+GYGR+FISNPDLVD
Sbjct: 301 GEGVYKDGTNDFVYSIWKGPIIRAGNYALHPEAAARDVGVDERTLIGYGRFFISNPDLVD 360

Query: 360 RLEKGLPLNLYDRPRFYAMPDKGYIDYPTYDEAIKMGWGE 399
           R+EKGLPLN Y+R  FYAM DKGY DYPTYDEAIK+GWG+
Sbjct: 361 RVEKGLPLNKYNRDLFYAMTDKGYTDYPTYDEAIKLGWGK 400

>SAKL0C00396g Chr3 complement(35526..36728) [1203 bp, 400 aa] {ON}
           highly similar to uniprot|Q03558 Saccharomyces
           cerevisiae YHR179W OYE2 Widely conserved NADPH
           oxidoreductase containing flavin mononucleotide (FMN)
           homologous to Oye3p with slight differences in ligand
           binding and catalytic properties may be involved in
           sterol metabolism
          Length = 400

 Score =  597 bits (1540), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/399 (70%), Positives = 332/399 (83%), Gaps = 1/399 (0%)

Query: 1   MPFNTESKPVALKDTDLFKPLKVGNTTVLNRVVLPPLTRMRAHYPGNVPNRDWTLEYYDQ 60
           MPF  + KP  LK+T+LFKP+K+GNTTV +RVV+PPLTRMRAH+PGN+PNRDW +EYYDQ
Sbjct: 1   MPFAQDFKPQPLKNTNLFKPIKIGNTTVQHRVVMPPLTRMRAHHPGNIPNRDWAVEYYDQ 60

Query: 61  RSKRPGTMLITEGVFPSAKAGGYDNAPGIWTEEQMVEWKKIFDKIHENESFVWPQLWVLG 120
           RS+RPGTM+ITEG FPS ++GGYDNAPGIW+EEQ+ EWKKIF KIHEN+SFVW QLWVLG
Sbjct: 61  RSRRPGTMIITEGTFPSPQSGGYDNAPGIWSEEQITEWKKIFAKIHENKSFVWVQLWVLG 120

Query: 121 READPLSLARDGLRYDSASDNVWRTXXXXXXXXXXGIEQHGITKDEIKQYIKDYVQGARN 180
           R+A    LARDGLRYDSASD ++            G +QHGITKDEIKQYIK+YVQ A+N
Sbjct: 121 RQAFADVLARDGLRYDSASDEIYMDEDSKKRALTSGNKQHGITKDEIKQYIKEYVQAAKN 180

Query: 181 SIKCGADGIEIHAANGYLLNQFLDPVSNKRTDEYGGSIKNRACFTLEVVDALVDAIGEDK 240
           SI  GADG+EIH+ANGYLLNQFLDP+SNKRTDEYGGSI+NRA FTLEVVDA+VDAIG DK
Sbjct: 181 SIAAGADGVEIHSANGYLLNQFLDPISNKRTDEYGGSIENRARFTLEVVDAVVDAIGADK 240

Query: 241 VGIRLAPYNTNGDMSGSWDPTVFAHYAYVLGKLEKRAQAGKRLAFVHIFEPRVSNPWDNE 300
           VGIR +PY T G +SG  DPT+ A YAYV+G+LEKRA+AGKRLAFVH+ EPRV+NP+  E
Sbjct: 241 VGIRFSPYGTFGSVSGGSDPTLLAQYAYVIGELEKRARAGKRLAFVHLVEPRVTNPFFTE 300

Query: 301 GDGAYNGGTTDYVYSIWKGVVIRTGNLAIHPE-IAKEFLKQPNTLLGYGRYFISNPDLVD 359
           G+G Y  GT D+VYSIWKG +IR GN A+HPE  AK+      TL+GYGR+FISNPDLVD
Sbjct: 301 GEGVYKDGTNDFVYSIWKGPIIRAGNYALHPEAAAKDVGVDERTLIGYGRFFISNPDLVD 360

Query: 360 RLEKGLPLNLYDRPRFYAMPDKGYIDYPTYDEAIKMGWG 398
           R+EKGLPLN YDR  FYAM DKGY DYPTY++A+ +GWG
Sbjct: 361 RVEKGLPLNKYDRDLFYAMTDKGYTDYPTYEQALALGWG 399

>Kpol_1054.16 s1054 (39314..40516) [1203 bp, 400 aa] {ON}
           (39314..40516) [1203 nt, 401 aa]
          Length = 400

 Score =  596 bits (1536), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 273/399 (68%), Positives = 335/399 (83%)

Query: 1   MPFNTESKPVALKDTDLFKPLKVGNTTVLNRVVLPPLTRMRAHYPGNVPNRDWTLEYYDQ 60
           MPF  + KP+ALKDT++FKP+K+GNT + +R VLPPLTRMRAH+PGNVPN+DW +EYY+Q
Sbjct: 1   MPFVQDFKPIALKDTNMFKPIKIGNTELKHRAVLPPLTRMRAHHPGNVPNKDWAVEYYNQ 60

Query: 61  RSKRPGTMLITEGVFPSAKAGGYDNAPGIWTEEQMVEWKKIFDKIHENESFVWPQLWVLG 120
           RSKR GTMLITEGVFPSA++GGYDNAPG+W+EEQ+ EWKKIF K+HEN+SF+WPQLWVLG
Sbjct: 61  RSKREGTMLITEGVFPSAQSGGYDNAPGVWSEEQLAEWKKIFAKVHENKSFIWPQLWVLG 120

Query: 121 READPLSLARDGLRYDSASDNVWRTXXXXXXXXXXGIEQHGITKDEIKQYIKDYVQGARN 180
           R++   +LARDGLRYDSASD+V+ +             QHG+TKDEIKQYIK+YVQ A+N
Sbjct: 121 RQSYADTLARDGLRYDSASDDVYMSAEQEALAKKSNNPQHGLTKDEIKQYIKEYVQAAKN 180

Query: 181 SIKCGADGIEIHAANGYLLNQFLDPVSNKRTDEYGGSIKNRACFTLEVVDALVDAIGEDK 240
            I  GADG+EIH+ANGYLLNQFLDP+SNKRTDEYGGSI+NRA F LEVVDA+V+A+G +K
Sbjct: 181 VIGVGADGVEIHSANGYLLNQFLDPISNKRTDEYGGSIENRARFVLEVVDAIVEAVGHEK 240

Query: 241 VGIRLAPYNTNGDMSGSWDPTVFAHYAYVLGKLEKRAQAGKRLAFVHIFEPRVSNPWDNE 300
           VGIR +PY   G MSG+ +PT+ A YAYV+G+LEKRA+ GKRLA++HI EPRV++P+  E
Sbjct: 241 VGIRFSPYGKFGTMSGAAEPTLLAQYAYVIGELEKRAREGKRLAYIHIVEPRVTDPFLTE 300

Query: 301 GDGAYNGGTTDYVYSIWKGVVIRTGNLAIHPEIAKEFLKQPNTLLGYGRYFISNPDLVDR 360
           G+G Y  GT D+VYSIWKG +IR GN A+HPE  +E +K   TL+ YGR+FI+NPD+VDR
Sbjct: 301 GEGVYLDGTNDFVYSIWKGPIIRAGNFALHPEDVEEMVKDDRTLIAYGRFFIANPDIVDR 360

Query: 361 LEKGLPLNLYDRPRFYAMPDKGYIDYPTYDEAIKMGWGE 399
           +EKGLPLN YDR  FYAM DKGY+DYPTYDEAIKMGWG+
Sbjct: 361 IEKGLPLNKYDRDTFYAMSDKGYLDYPTYDEAIKMGWGK 399

>CAGL0I02024g Chr9 complement(172231..173433) [1203 bp, 400 aa] {ON}
           highly similar to uniprot|Q03558 Saccharomyces
           cerevisiae YHR179w OYE2 NADPH dehydrogenase or
           uniprot|P41816 Saccharomyces cerevisiae YPL171c OYE3
          Length = 400

 Score =  596 bits (1536), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 274/400 (68%), Positives = 334/400 (83%)

Query: 1   MPFNTESKPVALKDTDLFKPLKVGNTTVLNRVVLPPLTRMRAHYPGNVPNRDWTLEYYDQ 60
           MPF+ + +PVA KDT++FKP+KVGNTT+L+R  LPPLTRMRAH+PG++PNR+W +EYY Q
Sbjct: 1   MPFSKDFEPVAFKDTNMFKPMKVGNTTILHRAALPPLTRMRAHHPGHIPNREWAVEYYKQ 60

Query: 61  RSKRPGTMLITEGVFPSAKAGGYDNAPGIWTEEQMVEWKKIFDKIHENESFVWPQLWVLG 120
           RS+RPGTML+TEGVFPSA++GGYDNAPGIW+EEQMVEW+KIF+ +H+N+SF W QLWVLG
Sbjct: 61  RSQRPGTMLVTEGVFPSAQSGGYDNAPGIWSEEQMVEWRKIFNAVHDNKSFAWVQLWVLG 120

Query: 121 READPLSLARDGLRYDSASDNVWRTXXXXXXXXXXGIEQHGITKDEIKQYIKDYVQGARN 180
           R+  P SLARDGLRYDSASD ++ +             QHGITKDEIKQYIKDYVQGA+N
Sbjct: 121 RQGFPDSLARDGLRYDSASDGIYMSAEQEELAKKSNNPQHGITKDEIKQYIKDYVQGAKN 180

Query: 181 SIKCGADGIEIHAANGYLLNQFLDPVSNKRTDEYGGSIKNRACFTLEVVDALVDAIGEDK 240
           +I  GADGIEIH+AN YLLNQF+DP SNKRTDEYGGSI+NRA FTLEVVDA+VDAIG ++
Sbjct: 181 AIAAGADGIEIHSANSYLLNQFIDPKSNKRTDEYGGSIENRARFTLEVVDAIVDAIGPER 240

Query: 241 VGIRLAPYNTNGDMSGSWDPTVFAHYAYVLGKLEKRAQAGKRLAFVHIFEPRVSNPWDNE 300
             IRL+PY T GDMSG  +P + A YAY++G+LE+RA+ GKRLA++H+ EPRV +P+  E
Sbjct: 241 TAIRLSPYGTYGDMSGGAEPLIVAQYAYIIGELERRAKEGKRLAYLHLVEPRVLDPFAPE 300

Query: 301 GDGAYNGGTTDYVYSIWKGVVIRTGNLAIHPEIAKEFLKQPNTLLGYGRYFISNPDLVDR 360
           G+  YN GTTD+ YSIWKG ++R GN AIHPE+A E LK   T++GYGRYFI+NPDLVDR
Sbjct: 301 GEDVYNEGTTDFAYSIWKGPIMRAGNYAIHPEVAMEVLKDDRTIVGYGRYFIANPDLVDR 360

Query: 361 LEKGLPLNLYDRPRFYAMPDKGYIDYPTYDEAIKMGWGEK 400
           LEKGLPLN YDR  FYAM  +GYIDYPTY+EAIKMGW ++
Sbjct: 361 LEKGLPLNKYDRSTFYAMSAEGYIDYPTYEEAIKMGWDKQ 400

>Kpol_1018.121 s1018 complement(320805..322007) [1203 bp, 400 aa]
           {ON} complement(320805..322007) [1203 nt, 401 aa]
          Length = 400

 Score =  595 bits (1535), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/397 (69%), Positives = 333/397 (83%)

Query: 1   MPFNTESKPVALKDTDLFKPLKVGNTTVLNRVVLPPLTRMRAHYPGNVPNRDWTLEYYDQ 60
           MPF  + KP+ALKDT+LFKP+K+GN  + +R VLPPLTRMRAH+PGNVPN++W +EYYDQ
Sbjct: 1   MPFVKDFKPIALKDTNLFKPIKIGNNELKHRAVLPPLTRMRAHHPGNVPNKEWAVEYYDQ 60

Query: 61  RSKRPGTMLITEGVFPSAKAGGYDNAPGIWTEEQMVEWKKIFDKIHENESFVWPQLWVLG 120
           RSKR GTMLITEGVFPS +AGGYDNAPG+W+EEQ+ EWKKIF K+HEN+SF+WPQLWVLG
Sbjct: 61  RSKREGTMLITEGVFPSPQAGGYDNAPGVWSEEQLAEWKKIFAKVHENKSFIWPQLWVLG 120

Query: 121 READPLSLARDGLRYDSASDNVWRTXXXXXXXXXXGIEQHGITKDEIKQYIKDYVQGARN 180
           R++   +LARDGLRYDSASD V+ +             QHG+TKDEIKQYIK+YVQ A+N
Sbjct: 121 RQSYADTLARDGLRYDSASDEVYMSAEQEALAKKSNNPQHGLTKDEIKQYIKEYVQAAKN 180

Query: 181 SIKCGADGIEIHAANGYLLNQFLDPVSNKRTDEYGGSIKNRACFTLEVVDALVDAIGEDK 240
            I  GADG+EIH+ANGYLLNQFLDP+SNKRTDEYGGSI+NRA FTLEVVDA+V+AIG ++
Sbjct: 181 VIGVGADGVEIHSANGYLLNQFLDPISNKRTDEYGGSIENRARFTLEVVDAVVEAIGHER 240

Query: 241 VGIRLAPYNTNGDMSGSWDPTVFAHYAYVLGKLEKRAQAGKRLAFVHIFEPRVSNPWDNE 300
           VGIR +PY T G MSG+ DP++ A YAYV+G+LEKRA+ GKRLA++H+ EPRV++P+  E
Sbjct: 241 VGIRFSPYGTFGTMSGASDPSLIAQYAYVVGELEKRAREGKRLAYIHLVEPRVTDPFLTE 300

Query: 301 GDGAYNGGTTDYVYSIWKGVVIRTGNLAIHPEIAKEFLKQPNTLLGYGRYFISNPDLVDR 360
           G+G Y  GT D+VYSIWKG +IR GNLA+HPE  KE ++   TL+GYGRYFISNPD+VDR
Sbjct: 301 GEGEYLDGTNDFVYSIWKGPIIRAGNLALHPEAVKEMVEDDRTLIGYGRYFISNPDIVDR 360

Query: 361 LEKGLPLNLYDRPRFYAMPDKGYIDYPTYDEAIKMGW 397
           +EKGLPLN YDR  FYAM  KGY+DYPTYDEAIKMGW
Sbjct: 361 VEKGLPLNKYDRDTFYAMTPKGYLDYPTYDEAIKMGW 397

>CAGL0I02574g Chr9 (232393..233598) [1206 bp, 401 aa] {ON} highly
           similar to uniprot|Q03558 Saccharomyces cerevisiae
           YHR179w OYE2 NADPH dehydrogenase or uniprot|P41816
           Saccharomyces cerevisiae YPL171c OYE3
          Length = 401

 Score =  592 bits (1526), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/401 (69%), Positives = 330/401 (82%), Gaps = 1/401 (0%)

Query: 1   MPFNTESKPVALKDTDLFKPLKVGNTTVLNRVVLPPLTRMRAHYPGNVPNRDWTLEYYDQ 60
           MPF  + KP+ALKDT++FKP+K+GNT V +RVV+PPLTRMRAH+PGNVPN++W +EYY Q
Sbjct: 1   MPFVKDFKPIALKDTNMFKPIKIGNTEVAHRVVMPPLTRMRAHHPGNVPNKEWAVEYYKQ 60

Query: 61  RSKRPGTMLITEGVFPSAKAGGYDNAPGIWTEEQMVEWKKIFDKIHENESFVWPQLWVLG 120
           RS+RPGTM+ITEG FP A+AGGYDNAPGIW+EEQ+ EW KIF  IH+N+SFVW QLWVLG
Sbjct: 61  RSQRPGTMIITEGAFPCAQAGGYDNAPGIWSEEQVAEWTKIFKAIHDNKSFVWVQLWVLG 120

Query: 121 READPLSLARDGLRYDSASDNVWRTXXXXXXXXXXGIEQHGITKDEIKQYIKDYVQGARN 180
           R+A P +LARDGLRYDSASD V+               QHGITKDEIKQYIKDYVQ A+N
Sbjct: 121 RQAFPDTLARDGLRYDSASDEVYMDKESEEKAKKSNNPQHGITKDEIKQYIKDYVQAAKN 180

Query: 181 SIKCGADGIEIHAANGYLLNQFLDPVSNKRTDEYGGSIKNRACFTLEVVDALVDAIGEDK 240
           SI  GADG+EIH+ANGYLLNQFLDP+SNKRTDEYGGSI+NRA FTLEVVDA+VDAIG +K
Sbjct: 181 SIAAGADGVEIHSANGYLLNQFLDPISNKRTDEYGGSIENRARFTLEVVDAIVDAIGPEK 240

Query: 241 VGIRLAPYNTNGDMSGSWDPTVFAHYAYVLGKLEKRAQAGKRLAFVHIFEPRVSNPWDNE 300
            GIR +PY T G MSG  +P + A YAYVLG+LEKRA+AGK+LAFVH+ EPRV+NP+  E
Sbjct: 241 TGIRFSPYGTFGTMSGGAEPLIVAQYAYVLGELEKRAKAGKKLAFVHLVEPRVTNPFFTE 300

Query: 301 GDGAYNGGTTDYVYSIWKGVVIRTGNLAIHPEIAKEFLKQPN-TLLGYGRYFISNPDLVD 359
           G G Y  GT D+ YSIW G +IR GN A+HPEIAKE +   + TL+GYGR+FI+NPD+VD
Sbjct: 301 GQGEYKDGTNDFAYSIWTGPIIRAGNYALHPEIAKEHVNNDDRTLIGYGRFFIANPDIVD 360

Query: 360 RLEKGLPLNLYDRPRFYAMPDKGYIDYPTYDEAIKMGWGEK 400
           R+EKGLPLN YDR  FYAM  +GY+DYPTYDEAIKMGW ++
Sbjct: 361 RIEKGLPLNKYDRDTFYAMTTEGYLDYPTYDEAIKMGWDKQ 401

>KAFR0F03530 Chr6 (702060..703262) [1203 bp, 400 aa] {ON} 
          Length = 400

 Score =  582 bits (1501), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 266/397 (67%), Positives = 328/397 (82%)

Query: 1   MPFNTESKPVALKDTDLFKPLKVGNTTVLNRVVLPPLTRMRAHYPGNVPNRDWTLEYYDQ 60
           MPF  +  P+AL DT+LFKP+K+GN  + +R V+PPLTRMRAH+PG++PN+DWT EYYDQ
Sbjct: 1   MPFVKDFTPIALNDTNLFKPIKIGNIELQHRAVMPPLTRMRAHHPGHIPNKDWTAEYYDQ 60

Query: 61  RSKRPGTMLITEGVFPSAKAGGYDNAPGIWTEEQMVEWKKIFDKIHENESFVWPQLWVLG 120
           RS+RPGT++ITEG F S +AGGYDNAPGIW++EQ+ EWKKIF +IH+N+SFV+ QLW LG
Sbjct: 61  RSQRPGTLIITEGAFISEQAGGYDNAPGIWSQEQVEEWKKIFARIHKNKSFVYVQLWNLG 120

Query: 121 READPLSLARDGLRYDSASDNVWRTXXXXXXXXXXGIEQHGITKDEIKQYIKDYVQGARN 180
           R+A+P ++ARDGLRYDSASD ++            GI+QHGITKDEIKQYIK+YVQ A+N
Sbjct: 121 RQAEPAAMARDGLRYDSASDEIYMDEEKESSAKKAGIKQHGITKDEIKQYIKEYVQAAKN 180

Query: 181 SIKCGADGIEIHAANGYLLNQFLDPVSNKRTDEYGGSIKNRACFTLEVVDALVDAIGEDK 240
           SI+ GADG+EIH+AN YLLNQFLDP+SNKRTDEYGGSI+NRA F LEVVDALV+AIG ++
Sbjct: 181 SIEAGADGVEIHSANSYLLNQFLDPISNKRTDEYGGSIENRARFALEVVDALVEAIGHER 240

Query: 241 VGIRLAPYNTNGDMSGSWDPTVFAHYAYVLGKLEKRAQAGKRLAFVHIFEPRVSNPWDNE 300
           VGIR +PY T G MSGS +P + A Y+Y+LG+LEKRA+ GKRL+FVH+ EPRV+NP+  E
Sbjct: 241 VGIRFSPYGTYGTMSGSAEPLIVAQYSYILGELEKRAKEGKRLSFVHLVEPRVTNPFLTE 300

Query: 301 GDGAYNGGTTDYVYSIWKGVVIRTGNLAIHPEIAKEFLKQPNTLLGYGRYFISNPDLVDR 360
           G+GA   GT D+ YSIWKG +IR GNLA+HPE  K  +    TL+GYGR+FI+NPD+VDR
Sbjct: 301 GEGADEDGTNDFAYSIWKGPIIRAGNLALHPESVKTLVADNRTLIGYGRFFIANPDVVDR 360

Query: 361 LEKGLPLNLYDRPRFYAMPDKGYIDYPTYDEAIKMGW 397
           LEKGLPLN YDR  FYAM DKGY+DYPTY EAIK+GW
Sbjct: 361 LEKGLPLNKYDRNTFYAMSDKGYLDYPTYAEAIKLGW 397

>Kpol_534.36 s534 (89925..90272,90276..91127) [1200 bp, 399 aa] {ON}
           (89925..90272,90276..91127) [1200 nt, 400 aa]
          Length = 399

 Score =  581 bits (1498), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 267/399 (66%), Positives = 332/399 (83%), Gaps = 1/399 (0%)

Query: 1   MPFNTESKPVALKDTDLFKPLKVGNTTVLNRVVLPPLTRMRAHYPGNVPNRDWTLEYYDQ 60
           MPF  + KP+ALKDT++FKP+K+GNT + +R VLPPLTRMRAH+PGNVPN+DW +EYY+Q
Sbjct: 1   MPFVQDFKPIALKDTNMFKPIKIGNTELKHRAVLPPLTRMRAHHPGNVPNKDWAVEYYNQ 60

Query: 61  RSKRPGTMLITEGVFPSAKAGGYDNAPGIWTEEQMVEWKKIFDKIHENESFVWPQLWVLG 120
           RSKR GTMLITEGVF SA++GGYDNAPG+W+EEQ+ EWKKIF K+HEN+SF+WPQL  LG
Sbjct: 61  RSKREGTMLITEGVFISAQSGGYDNAPGVWSEEQLAEWKKIFAKVHENKSFIWPQL-ALG 119

Query: 121 READPLSLARDGLRYDSASDNVWRTXXXXXXXXXXGIEQHGITKDEIKQYIKDYVQGARN 180
           R++   +LARDGLRYD+ASD+V+ +             QHG+TKDEIKQYIK+YVQ A+N
Sbjct: 120 RQSYADTLARDGLRYDAASDDVYMSAEQEALAKKSNNPQHGLTKDEIKQYIKEYVQAAKN 179

Query: 181 SIKCGADGIEIHAANGYLLNQFLDPVSNKRTDEYGGSIKNRACFTLEVVDALVDAIGEDK 240
            I  GADG+EIH+ANGYLLNQFLDP+SNKRTDEYGGSI+NRA F LEVVDA+V+A+G +K
Sbjct: 180 VIGVGADGVEIHSANGYLLNQFLDPISNKRTDEYGGSIENRARFVLEVVDAIVEAVGHEK 239

Query: 241 VGIRLAPYNTNGDMSGSWDPTVFAHYAYVLGKLEKRAQAGKRLAFVHIFEPRVSNPWDNE 300
           VGIR +PY   G MSG+ +PT+ A YAYV+G+LEKRA+ GKR+A++H+ EPRV++P+  E
Sbjct: 240 VGIRFSPYGKFGTMSGAAEPTLLAQYAYVIGELEKRAREGKRIAYIHLMEPRVTDPFLTE 299

Query: 301 GDGAYNGGTTDYVYSIWKGVVIRTGNLAIHPEIAKEFLKQPNTLLGYGRYFISNPDLVDR 360
           G+G Y  GT D+VYSIWKG +IR GN A+HPE  +E +K   TL+ YGR+FI+NPD+VDR
Sbjct: 300 GEGVYLDGTNDFVYSIWKGPIIRAGNFALHPEDVEEMVKDDRTLIAYGRFFIANPDIVDR 359

Query: 361 LEKGLPLNLYDRPRFYAMPDKGYIDYPTYDEAIKMGWGE 399
           +EKGLPLN YDR  FYAM DKGY+DYPTYDEAIKMGWG+
Sbjct: 360 IEKGLPLNKYDRDTFYAMTDKGYLDYPTYDEAIKMGWGK 398

>NCAS0D01280 Chr4 complement(232270..233472) [1203 bp, 400 aa] {ON}
           Anc_5.58
          Length = 400

 Score =  581 bits (1497), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 274/400 (68%), Positives = 324/400 (81%)

Query: 1   MPFNTESKPVALKDTDLFKPLKVGNTTVLNRVVLPPLTRMRAHYPGNVPNRDWTLEYYDQ 60
           MPF  +  PVAL DT+LFKP+K+GN  + +RVVLPPLTRMRA +PGNVPN+DW +EYY+Q
Sbjct: 1   MPFVKDFTPVALGDTNLFKPIKIGNNQLQHRVVLPPLTRMRATHPGNVPNKDWAVEYYNQ 60

Query: 61  RSKRPGTMLITEGVFPSAKAGGYDNAPGIWTEEQMVEWKKIFDKIHENESFVWPQLWVLG 120
           RS+RPGT+LITEG F  A+AGGYDNAPGIW++EQ+ +WKKIF KIHEN+SFVW QLW LG
Sbjct: 61  RSQRPGTLLITEGAFICAQAGGYDNAPGIWSDEQVEQWKKIFAKIHENKSFVWVQLWALG 120

Query: 121 READPLSLARDGLRYDSASDNVWRTXXXXXXXXXXGIEQHGITKDEIKQYIKDYVQGARN 180
           R++   +LARDGLRYDSASDNV+               QHG+TK+EIK+YIK YV  A+N
Sbjct: 121 RQSYADTLARDGLRYDSASDNVYMDAEQEERAKKANNPQHGLTKEEIKEYIKCYVHAAKN 180

Query: 181 SIKCGADGIEIHAANGYLLNQFLDPVSNKRTDEYGGSIKNRACFTLEVVDALVDAIGEDK 240
           SI  GADG+EIH+ANGYLLNQFLDP+SNKRTDEYGGSI+NRA FTLEVVDALVDAIGEDK
Sbjct: 181 SIAAGADGVEIHSANGYLLNQFLDPISNKRTDEYGGSIENRARFTLEVVDALVDAIGEDK 240

Query: 241 VGIRLAPYNTNGDMSGSWDPTVFAHYAYVLGKLEKRAQAGKRLAFVHIFEPRVSNPWDNE 300
           VG+RL+PY T G MSG  DPT+ A YAYVLG+LEKRA+AGKRLAFVH+ EPRV+NP+  E
Sbjct: 241 VGVRLSPYGTFGTMSGGADPTLLAQYAYVLGELEKRAKAGKRLAFVHLVEPRVTNPFLTE 300

Query: 301 GDGAYNGGTTDYVYSIWKGVVIRTGNLAIHPEIAKEFLKQPNTLLGYGRYFISNPDLVDR 360
           G G YN GT D+ YSIWKG +IR GNLA+HPE  K+ +    TL+GYGR+FI+NPD+VDR
Sbjct: 301 GQGEYNDGTNDFAYSIWKGAIIRAGNLALHPESVKQMVADDRTLIGYGRFFIANPDIVDR 360

Query: 361 LEKGLPLNLYDRPRFYAMPDKGYIDYPTYDEAIKMGWGEK 400
           LEKG   N YDR  FYAM   GY DYPTYDEAIK+GW ++
Sbjct: 361 LEKGQQFNKYDRDTFYAMTAHGYTDYPTYDEAIKLGWDKQ 400

>NDAI0A08130 Chr1 complement(1863451..1864656) [1206 bp, 401 aa]
           {ON} 
          Length = 401

 Score =  580 bits (1495), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 272/398 (68%), Positives = 326/398 (81%), Gaps = 1/398 (0%)

Query: 1   MPFNTESKPVALKDTDLFKPLKVGNTTVLNRVVLPPLTRMRAHYPGNVPNRDWTLEYYDQ 60
           MPF  +  P+AL DT++FKP+KVGN  + NRVV+PPLTRMRA +PGNVPN++W +EYY Q
Sbjct: 1   MPFVKDFTPIALADTNVFKPIKVGNNELKNRVVMPPLTRMRATHPGNVPNKEWAVEYYKQ 60

Query: 61  RSKRPGTMLITEGVFPSAKAGGYDNAPGIWTEEQMVEWKKIFDKIHENESFVWPQLWVLG 120
           R++  GTMLITEG F SA+AGGYDNAPGIW++EQM EW KI   +H+ +SFVW QLW LG
Sbjct: 61  RAQAEGTMLITEGTFISAQAGGYDNAPGIWSQEQMNEWTKIIKGVHDKKSFVWVQLWALG 120

Query: 121 READPLSLARDGLRYDSASDNVWRTXXXXXXXXXXGIEQHGITKDEIKQYIKDYVQGARN 180
           R++ P +LARDGLRYDSASD V+               QHG+TKDEIK+YIK+YVQ A+N
Sbjct: 121 RQSFPDTLARDGLRYDSASDAVYMDEESKTKAEKSNNPQHGLTKDEIKEYIKNYVQAAKN 180

Query: 181 SIKCGADGIEIHAANGYLLNQFLDPVSNKRTD-EYGGSIKNRACFTLEVVDALVDAIGED 239
           SI CGADGIEIH+ANGYLLNQFLDP+SNKRTD EYGGSI+NRA F LEVVDA+VDAIGED
Sbjct: 181 SIACGADGIEIHSANGYLLNQFLDPISNKRTDDEYGGSIENRARFALEVVDAIVDAIGED 240

Query: 240 KVGIRLAPYNTNGDMSGSWDPTVFAHYAYVLGKLEKRAQAGKRLAFVHIFEPRVSNPWDN 299
           KVGIRL+PY T G MSG  DPT+ A YAYVLG+LEKRA+AGKRLAFVH+ EPRV+NP+  
Sbjct: 241 KVGIRLSPYGTFGTMSGGADPTLLAQYAYVLGELEKRAKAGKRLAFVHLVEPRVTNPFMT 300

Query: 300 EGDGAYNGGTTDYVYSIWKGVVIRTGNLAIHPEIAKEFLKQPNTLLGYGRYFISNPDLVD 359
           EG+G YN GT D+ YSIWKGV+IR GNLA+HPE+A+E +    TLLGYGR+FI+NPDLV+
Sbjct: 301 EGEGEYNDGTNDFAYSIWKGVIIRAGNLALHPEVARELVANDRTLLGYGRFFIANPDLVE 360

Query: 360 RLEKGLPLNLYDRPRFYAMPDKGYIDYPTYDEAIKMGW 397
           RL KGLPLN Y+R  FYAM  +GY+DYPTY+EA+K+GW
Sbjct: 361 RLAKGLPLNKYNRDTFYAMTQEGYLDYPTYEEALKLGW 398

>KAFR0E02340 Chr5 (470967..472169) [1203 bp, 400 aa] {ON} Anc_5.58
           YHR179W
          Length = 400

 Score =  580 bits (1494), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 273/397 (68%), Positives = 327/397 (82%)

Query: 1   MPFNTESKPVALKDTDLFKPLKVGNTTVLNRVVLPPLTRMRAHYPGNVPNRDWTLEYYDQ 60
           M F  +  PVALKDT+LFKP+K+GNT +L+R VLPPLTRMRAH+PGNVPN+DW +EYYDQ
Sbjct: 1   MSFVKDFTPVALKDTNLFKPIKIGNTELLHRCVLPPLTRMRAHHPGNVPNKDWAVEYYDQ 60

Query: 61  RSKRPGTMLITEGVFPSAKAGGYDNAPGIWTEEQMVEWKKIFDKIHENESFVWPQLWVLG 120
           RSKR G+MLITEG F   +AGGYDNAPGIW+ EQ+ +WK IF KIHEN+SFVW QLWVLG
Sbjct: 61  RSKRAGSMLITEGAFTCPQAGGYDNAPGIWSPEQIEQWKNIFAKIHENKSFVWVQLWVLG 120

Query: 121 READPLSLARDGLRYDSASDNVWRTXXXXXXXXXXGIEQHGITKDEIKQYIKDYVQGARN 180
           R++    LARDGLRYDSASD+++               QHGITK+EIK+YIK+YVQ A+N
Sbjct: 121 RQSFADVLARDGLRYDSASDDIYMDEEQKEKALKSNNPQHGITKEEIKEYIKNYVQAAKN 180

Query: 181 SIKCGADGIEIHAANGYLLNQFLDPVSNKRTDEYGGSIKNRACFTLEVVDALVDAIGEDK 240
           SI  GADG+EIH+ANGYLLNQFLDP+SNKRTDEYGGSI+NRA FTLEVVDA+VDAIG DK
Sbjct: 181 SIAAGADGVEIHSANGYLLNQFLDPISNKRTDEYGGSIENRARFTLEVVDAIVDAIGNDK 240

Query: 241 VGIRLAPYNTNGDMSGSWDPTVFAHYAYVLGKLEKRAQAGKRLAFVHIFEPRVSNPWDNE 300
           VGIRL+PY T G MSG  DP++ A YAYVLG+LE+RA+ GKRLAFVH+ EPRV+NP+  E
Sbjct: 241 VGIRLSPYGTFGTMSGGADPSIVAQYAYVLGELERRAKEGKRLAFVHLVEPRVTNPFLTE 300

Query: 301 GDGAYNGGTTDYVYSIWKGVVIRTGNLAIHPEIAKEFLKQPNTLLGYGRYFISNPDLVDR 360
           G+GAY  GT D+ YSIWKG +IR GNLA+HPE  ++ +    TL+GYGR++ISNPD+VDR
Sbjct: 301 GEGAYVDGTNDFAYSIWKGPIIRAGNLALHPEAVQDMVADDRTLIGYGRFWISNPDIVDR 360

Query: 361 LEKGLPLNLYDRPRFYAMPDKGYIDYPTYDEAIKMGW 397
           LEKGLPLN YDR  FYAM +KGY+DYPTY+EAIK+G+
Sbjct: 361 LEKGLPLNKYDRSTFYAMTEKGYLDYPTYEEAIKLGY 397

>NCAS0J01750 Chr10 complement(324339..325541) [1203 bp, 400 aa] {ON}
           
          Length = 400

 Score =  573 bits (1478), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 268/400 (67%), Positives = 324/400 (81%)

Query: 1   MPFNTESKPVALKDTDLFKPLKVGNTTVLNRVVLPPLTRMRAHYPGNVPNRDWTLEYYDQ 60
           MPF  +  PVAL +T+LFKP+K+GN  + +RVVLPPLTRMRA +PGNVPN+DW +EYY+Q
Sbjct: 1   MPFVKDFTPVALGETNLFKPIKIGNNKLQHRVVLPPLTRMRATHPGNVPNKDWAVEYYNQ 60

Query: 61  RSKRPGTMLITEGVFPSAKAGGYDNAPGIWTEEQMVEWKKIFDKIHENESFVWPQLWVLG 120
           RS+RPGT+LITEG F  A+AGGYDNAPGIW++EQ+ EWKKIF +IHEN+SFVW QLW LG
Sbjct: 61  RSQRPGTLLITEGAFICAQAGGYDNAPGIWSDEQVEEWKKIFAQIHENKSFVWVQLWALG 120

Query: 121 READPLSLARDGLRYDSASDNVWRTXXXXXXXXXXGIEQHGITKDEIKQYIKDYVQGARN 180
           R++   +LARDGLRYDSASDNV+               QHG+TK+EIK+YIK YVQ A+N
Sbjct: 121 RQSYADTLARDGLRYDSASDNVYMDAEQEERAKKSSNPQHGLTKEEIKEYIKCYVQAAKN 180

Query: 181 SIKCGADGIEIHAANGYLLNQFLDPVSNKRTDEYGGSIKNRACFTLEVVDALVDAIGEDK 240
           S   GADG+EIH+ANGYLLNQFLDP+SNKRTDEYGGSI+NRA FTLEVVDA+VDAIGE+K
Sbjct: 181 SFAAGADGVEIHSANGYLLNQFLDPISNKRTDEYGGSIENRARFTLEVVDAVVDAIGEEK 240

Query: 241 VGIRLAPYNTNGDMSGSWDPTVFAHYAYVLGKLEKRAQAGKRLAFVHIFEPRVSNPWDNE 300
           VG+R +PY T G MSG  DPT+ A YAY+LG+LEKRA+AGKRLAFVH+ EPRV++P+  E
Sbjct: 241 VGVRFSPYGTFGTMSGGADPTLLAQYAYILGELEKRAKAGKRLAFVHLVEPRVTDPFLTE 300

Query: 301 GDGAYNGGTTDYVYSIWKGVVIRTGNLAIHPEIAKEFLKQPNTLLGYGRYFISNPDLVDR 360
           G G YN GT D+ YSIWKGV+IR GNLA+HPE  K+ +    TL+GYGR+FI+NPD+VDR
Sbjct: 301 GQGEYNDGTNDFAYSIWKGVIIRAGNLALHPESVKQMVADDRTLIGYGRFFIANPDIVDR 360

Query: 361 LEKGLPLNLYDRPRFYAMPDKGYIDYPTYDEAIKMGWGEK 400
           +EKG   N YDR  FYAM   GY DYPTYDEAIK+GW ++
Sbjct: 361 VEKGEQFNKYDRDTFYAMTAHGYTDYPTYDEAIKLGWDKQ 400

>TPHA0A02230 Chr1 (461324..462526) [1203 bp, 400 aa] {ON} 
          Length = 400

 Score =  573 bits (1477), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 261/400 (65%), Positives = 327/400 (81%)

Query: 1   MPFNTESKPVALKDTDLFKPLKVGNTTVLNRVVLPPLTRMRAHYPGNVPNRDWTLEYYDQ 60
           MPF  + KP+ALKDT+LFKP+KVGN  + +R +LPPLTRMRA +PGNVPN++W  +YYDQ
Sbjct: 1   MPFVADFKPIALKDTNLFKPIKVGNCELSHRAILPPLTRMRATHPGNVPNKEWAADYYDQ 60

Query: 61  RSKRPGTMLITEGVFPSAKAGGYDNAPGIWTEEQMVEWKKIFDKIHENESFVWPQLWVLG 120
           RSKR GT+LITEG F S +AGGYDNAPG+W+EEQ+ EWKKIF ++H N+SF+WPQLW LG
Sbjct: 61  RSKREGTLLITEGAFISPQAGGYDNAPGVWSEEQLAEWKKIFARVHANKSFIWPQLWALG 120

Query: 121 READPLSLARDGLRYDSASDNVWRTXXXXXXXXXXGIEQHGITKDEIKQYIKDYVQGARN 180
           R+++P +LARDGL+Y SASD+++R              QHG+TKDEIKQYI DYVQ A+N
Sbjct: 121 RQSEPDTLARDGLKYVSASDDLYRDETEKALAIKSNNPQHGLTKDEIKQYIADYVQAAKN 180

Query: 181 SIKCGADGIEIHAANGYLLNQFLDPVSNKRTDEYGGSIKNRACFTLEVVDALVDAIGEDK 240
            I+ GADG+EIH+ANGYLLNQFLDP+SN RTDEYGGSI+NR+ FTLEVVDAL++AIG +K
Sbjct: 181 VIEAGADGVEIHSANGYLLNQFLDPISNNRTDEYGGSIENRSRFTLEVVDALIEAIGAEK 240

Query: 241 VGIRLAPYNTNGDMSGSWDPTVFAHYAYVLGKLEKRAQAGKRLAFVHIFEPRVSNPWDNE 300
           VGIR +PY T G +SG  +P + A +A+V+G++EKRA+ GKRLAF+H+ EPRV+NP+  E
Sbjct: 241 VGIRFSPYGTFGSLSGGAEPLIVAQFAHVIGEIEKRAKEGKRLAFIHLVEPRVTNPFLTE 300

Query: 301 GDGAYNGGTTDYVYSIWKGVVIRTGNLAIHPEIAKEFLKQPNTLLGYGRYFISNPDLVDR 360
           G+G Y  GT D+VYSIWKG++ R GN A HPE+ KE +K   TL+GYGR +ISNPDLVDR
Sbjct: 301 GEGEYQDGTNDFVYSIWKGIIFRAGNYAYHPEVVKEVVKDERTLIGYGRLWISNPDLVDR 360

Query: 361 LEKGLPLNLYDRPRFYAMPDKGYIDYPTYDEAIKMGWGEK 400
           LEKGLPLN Y+R  FYAM  +GY+DYPTYDEAIKMGWG++
Sbjct: 361 LEKGLPLNAYNRDTFYAMTSEGYLDYPTYDEAIKMGWGKQ 400

>YHR179W Chr8 (462502..463704) [1203 bp, 400 aa] {ON}  OYE2Conserved
           NADPH oxidoreductase containing flavin mononucleotide
           (FMN), homologous to Oye3p with different ligand binding
           and catalytic properties; may be involved in sterol
           metabolism, oxidative stress response, and programmed
           cell death
          Length = 400

 Score =  572 bits (1474), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 267/397 (67%), Positives = 320/397 (80%)

Query: 1   MPFNTESKPVALKDTDLFKPLKVGNTTVLNRVVLPPLTRMRAHYPGNVPNRDWTLEYYDQ 60
           MPF  + KP AL DT+LFKP+K+GN  +L+R V+PPLTRMRA +PGN+PNRDW +EYY Q
Sbjct: 1   MPFVKDFKPQALGDTNLFKPIKIGNNELLHRAVIPPLTRMRAQHPGNIPNRDWAVEYYAQ 60

Query: 61  RSKRPGTMLITEGVFPSAKAGGYDNAPGIWTEEQMVEWKKIFDKIHENESFVWPQLWVLG 120
           R++RPGT++ITEG FPS ++GGYDNAPGIW+EEQ+ EW KIF  IHEN+SF W QLWVLG
Sbjct: 61  RAQRPGTLIITEGTFPSPQSGGYDNAPGIWSEEQIKEWTKIFKAIHENKSFAWVQLWVLG 120

Query: 121 READPLSLARDGLRYDSASDNVWRTXXXXXXXXXXGIEQHGITKDEIKQYIKDYVQGARN 180
             A P +LARDGLRYDSASDNV+               QH ITKDEIKQY+K+YVQ A+N
Sbjct: 121 WAAFPDTLARDGLRYDSASDNVYMNAEQEEKAKKANNPQHSITKDEIKQYVKEYVQAAKN 180

Query: 181 SIKCGADGIEIHAANGYLLNQFLDPVSNKRTDEYGGSIKNRACFTLEVVDALVDAIGEDK 240
           SI  GADG+EIH+ANGYLLNQFLDP SN RTDEYGGSI+NRA FTLEVVDA+VDAIG +K
Sbjct: 181 SIAAGADGVEIHSANGYLLNQFLDPHSNNRTDEYGGSIENRARFTLEVVDAVVDAIGPEK 240

Query: 241 VGIRLAPYNTNGDMSGSWDPTVFAHYAYVLGKLEKRAQAGKRLAFVHIFEPRVSNPWDNE 300
           VG+RL+PY     MSG  +  + A YAYVLG+LE+RA+AGKRLAFVH+ EPRV+NP+  E
Sbjct: 241 VGLRLSPYGVFNSMSGGAETGIVAQYAYVLGELERRAKAGKRLAFVHLVEPRVTNPFLTE 300

Query: 301 GDGAYNGGTTDYVYSIWKGVVIRTGNLAIHPEIAKEFLKQPNTLLGYGRYFISNPDLVDR 360
           G+G YNGG+  + YSIWKG +IR GN A+HPE+ +E +K P TL+GYGR+FISNPDLVDR
Sbjct: 301 GEGEYNGGSNKFAYSIWKGPIIRAGNFALHPEVVREEVKDPRTLIGYGRFFISNPDLVDR 360

Query: 361 LEKGLPLNLYDRPRFYAMPDKGYIDYPTYDEAIKMGW 397
           LEKGLPLN YDR  FY M  +GYIDYPTY+EA+K+GW
Sbjct: 361 LEKGLPLNKYDRDTFYKMSAEGYIDYPTYEEALKLGW 397

>Skud_8.243 Chr8 (433873..435075) [1203 bp, 400 aa] {ON} YHR179W
           (REAL)
          Length = 400

 Score =  571 bits (1472), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 266/397 (67%), Positives = 321/397 (80%)

Query: 1   MPFNTESKPVALKDTDLFKPLKVGNTTVLNRVVLPPLTRMRAHYPGNVPNRDWTLEYYDQ 60
           M F  + KP AL DT+LFKP+K+GN  +L+R V+PPLTRMRA +PGNVPN+DW +EYY Q
Sbjct: 1   MSFVKDFKPQALNDTNLFKPIKIGNNELLHRAVIPPLTRMRAQHPGNVPNKDWAVEYYTQ 60

Query: 61  RSKRPGTMLITEGVFPSAKAGGYDNAPGIWTEEQMVEWKKIFDKIHENESFVWPQLWVLG 120
           R++RPGT++ITEG F S ++GGYDNAPGIW+EEQM EW KIF  IHE +SF W QLWVLG
Sbjct: 61  RAQRPGTLIITEGTFISPQSGGYDNAPGIWSEEQMKEWTKIFKAIHEKKSFAWVQLWVLG 120

Query: 121 READPLSLARDGLRYDSASDNVWRTXXXXXXXXXXGIEQHGITKDEIKQYIKDYVQGARN 180
             A P +LARDGLRYDSASDNV+ +             QH +TKDEIKQYIK+YVQ A+N
Sbjct: 121 WAAFPDTLARDGLRYDSASDNVYMSAEQEEKAKKANNPQHSLTKDEIKQYIKEYVQAAKN 180

Query: 181 SIKCGADGIEIHAANGYLLNQFLDPVSNKRTDEYGGSIKNRACFTLEVVDALVDAIGEDK 240
           SI  GADG+EIH+ANGYLLNQFLDP SN RTDEYGGSI+NRA FTLEVVDA+V+AIG++K
Sbjct: 181 SIAAGADGVEIHSANGYLLNQFLDPHSNNRTDEYGGSIENRARFTLEVVDAIVEAIGQEK 240

Query: 241 VGIRLAPYNTNGDMSGSWDPTVFAHYAYVLGKLEKRAQAGKRLAFVHIFEPRVSNPWDNE 300
           VG+RL+PY     MSG  +  + A YAYVLG+LE+RA AGKRLAFVH+ EPRV+NP+  E
Sbjct: 241 VGLRLSPYGVFNSMSGGAETGIVAQYAYVLGELERRANAGKRLAFVHLVEPRVTNPFLAE 300

Query: 301 GDGAYNGGTTDYVYSIWKGVVIRTGNLAIHPEIAKEFLKQPNTLLGYGRYFISNPDLVDR 360
           G+GAY+GG+  +VYSIWKG +IR GN A+HPE+ +E +K P TL+GYGR+FISNPDLVDR
Sbjct: 301 GEGAYDGGSNQFVYSIWKGAIIRAGNYALHPEVVREEVKDPRTLIGYGRFFISNPDLVDR 360

Query: 361 LEKGLPLNLYDRPRFYAMPDKGYIDYPTYDEAIKMGW 397
           LEKGLPLN YDR  FY+M  KGYIDYPTY+EA+K+GW
Sbjct: 361 LEKGLPLNKYDRTTFYSMSAKGYIDYPTYEEALKLGW 397

>NCAS0C02260 Chr3 complement(425626..426984) [1359 bp, 452 aa] {ON} 
          Length = 452

 Score =  571 bits (1472), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 268/400 (67%), Positives = 321/400 (80%)

Query: 1   MPFNTESKPVALKDTDLFKPLKVGNTTVLNRVVLPPLTRMRAHYPGNVPNRDWTLEYYDQ 60
           MPF  +  PVAL DT+LFKP+K+GN  + +RVVLPPLTRMRA +PGNVPN+DW +EYY+Q
Sbjct: 53  MPFVKDFTPVALGDTNLFKPIKIGNNKLQHRVVLPPLTRMRATHPGNVPNKDWAVEYYNQ 112

Query: 61  RSKRPGTMLITEGVFPSAKAGGYDNAPGIWTEEQMVEWKKIFDKIHENESFVWPQLWVLG 120
           RS+RPGTMLITEG F  A+AGGYDNAPGIW++EQ+ +WKKIF KIHEN+SFVW QLW LG
Sbjct: 113 RSQRPGTMLITEGAFVCAQAGGYDNAPGIWSDEQVEQWKKIFAKIHENKSFVWVQLWALG 172

Query: 121 READPLSLARDGLRYDSASDNVWRTXXXXXXXXXXGIEQHGITKDEIKQYIKDYVQGARN 180
           R++   +LARDGLRY SASDNV+               QHG+TK EIK+YIK YVQ A+N
Sbjct: 173 RQSYADTLARDGLRYYSASDNVYMDAEQEERAKKSNNPQHGLTKKEIKEYIKCYVQAAKN 232

Query: 181 SIKCGADGIEIHAANGYLLNQFLDPVSNKRTDEYGGSIKNRACFTLEVVDALVDAIGEDK 240
           SI  GA+G+EIH+ANGYLLNQFLDP+SNKRTDEYGGSI+NRA FTLEVVDALVDAIGE+K
Sbjct: 233 SIAAGANGVEIHSANGYLLNQFLDPISNKRTDEYGGSIENRARFTLEVVDALVDAIGEEK 292

Query: 241 VGIRLAPYNTNGDMSGSWDPTVFAHYAYVLGKLEKRAQAGKRLAFVHIFEPRVSNPWDNE 300
           VG+R +PY   G MSG  DPT+ A YAY+LG+LEKRA+AGKRLAFVH+ EPRV++P+  E
Sbjct: 293 VGVRFSPYGIFGTMSGGADPTLLAQYAYILGELEKRAKAGKRLAFVHLVEPRVTDPFLTE 352

Query: 301 GDGAYNGGTTDYVYSIWKGVVIRTGNLAIHPEIAKEFLKQPNTLLGYGRYFISNPDLVDR 360
           G G Y  GT D+ YSIWKGV+IR GNLA+HPE  K+ +    TL+GYGR+FI+NPD+VDR
Sbjct: 353 GQGEYTDGTNDFAYSIWKGVIIRAGNLALHPESVKQMVADDRTLIGYGRFFIANPDIVDR 412

Query: 361 LEKGLPLNLYDRPRFYAMPDKGYIDYPTYDEAIKMGWGEK 400
           +EKG   N YDR  FYAM   GY DYPTYDEAIK+GW ++
Sbjct: 413 VEKGQQFNKYDRDTFYAMTAHGYTDYPTYDEAIKLGWDKQ 452

>Suva_15.379 Chr15 (668836..670038) [1203 bp, 400 aa] {ON} YHR179W
           (REAL)
          Length = 400

 Score =  568 bits (1463), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 266/400 (66%), Positives = 321/400 (80%)

Query: 1   MPFNTESKPVALKDTDLFKPLKVGNTTVLNRVVLPPLTRMRAHYPGNVPNRDWTLEYYDQ 60
           M F  + KP AL DT+LFKP+K+GN  +L+R V+PPLTRMRA +PGNVPN+DW +EYY Q
Sbjct: 1   MSFVKDFKPQALGDTNLFKPIKIGNNELLHRAVIPPLTRMRALHPGNVPNKDWAVEYYSQ 60

Query: 61  RSKRPGTMLITEGVFPSAKAGGYDNAPGIWTEEQMVEWKKIFDKIHENESFVWPQLWVLG 120
           R++RPGTM+ITEG F S +AGGYDNAPG+W+EEQM EW KIF+ IHE +SFVW QLWVLG
Sbjct: 61  RAQRPGTMIITEGAFISPQAGGYDNAPGVWSEEQMAEWTKIFNAIHEKKSFVWVQLWVLG 120

Query: 121 READPLSLARDGLRYDSASDNVWRTXXXXXXXXXXGIEQHGITKDEIKQYIKDYVQGARN 180
             A P +LARDGLRYDSASDNV+               QH +TKDEIKQYI++YVQ A+N
Sbjct: 121 WAAFPDTLARDGLRYDSASDNVYMDAEQEAKAKKANNPQHSLTKDEIKQYIREYVQAAKN 180

Query: 181 SIKCGADGIEIHAANGYLLNQFLDPVSNKRTDEYGGSIKNRACFTLEVVDALVDAIGEDK 240
           SI  GADG+EIH+ANGYLLNQFLDP SN RTDEYGGSI+NRA FTLEVVDALV+AIG++K
Sbjct: 181 SIAAGADGVEIHSANGYLLNQFLDPHSNTRTDEYGGSIENRARFTLEVVDALVEAIGQEK 240

Query: 241 VGIRLAPYNTNGDMSGSWDPTVFAHYAYVLGKLEKRAQAGKRLAFVHIFEPRVSNPWDNE 300
           VG+RL+PY     MSG  + ++ A YAYVLG+LE+RA+AGKRLAFVH+ EPRV+NP+  E
Sbjct: 241 VGVRLSPYGVFNSMSGGAETSIVAQYAYVLGELERRAKAGKRLAFVHLVEPRVTNPFLAE 300

Query: 301 GDGAYNGGTTDYVYSIWKGVVIRTGNLAIHPEIAKEFLKQPNTLLGYGRYFISNPDLVDR 360
           G+G YN G+ D+VYSIWKG +IR GN A+HPE+ +E +K   TL+GYGR+FISNPDLVDR
Sbjct: 301 GEGEYNEGSNDFVYSIWKGPIIRAGNFALHPEVVREEVKDKRTLIGYGRFFISNPDLVDR 360

Query: 361 LEKGLPLNLYDRPRFYAMPDKGYIDYPTYDEAIKMGWGEK 400
           LEKGLPLN YDR  FY M   GY DYPTY+EA+K+GW +K
Sbjct: 361 LEKGLPLNKYDRNTFYQMSAHGYTDYPTYEEALKLGWDKK 400

>Smik_8.263 Chr8 (439298..440500) [1203 bp, 400 aa] {ON} YHR179W
           (REAL)
          Length = 400

 Score =  567 bits (1461), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 264/397 (66%), Positives = 321/397 (80%)

Query: 1   MPFNTESKPVALKDTDLFKPLKVGNTTVLNRVVLPPLTRMRAHYPGNVPNRDWTLEYYDQ 60
           MPF  + KP AL DT+LFKP+K+G   +L+R V+PPLTRMRAH+PGNVPN+DW +EYY Q
Sbjct: 1   MPFVKDFKPQALGDTNLFKPIKIGKNELLHRAVIPPLTRMRAHHPGNVPNKDWAVEYYAQ 60

Query: 61  RSKRPGTMLITEGVFPSAKAGGYDNAPGIWTEEQMVEWKKIFDKIHENESFVWPQLWVLG 120
           R++RPGT+++TEG F S ++GGYDNAPGIW+EEQM EW KIF  IH+ +SF W QLWVLG
Sbjct: 61  RAQRPGTLIVTEGTFISPQSGGYDNAPGIWSEEQMKEWTKIFKAIHDRKSFAWVQLWVLG 120

Query: 121 READPLSLARDGLRYDSASDNVWRTXXXXXXXXXXGIEQHGITKDEIKQYIKDYVQGARN 180
             A P +LARDGLRYDSASDNV+ +             QH +TKDEIKQYIK+YVQ A+N
Sbjct: 121 WAAFPDTLARDGLRYDSASDNVYMSAEQEEKAKKANNPQHSLTKDEIKQYIKEYVQAAKN 180

Query: 181 SIKCGADGIEIHAANGYLLNQFLDPVSNKRTDEYGGSIKNRACFTLEVVDALVDAIGEDK 240
           SI  GADG+EIH+ANGYLLNQFLDP SN RTDEYGGSI+NRA FTLEVVDA+VDAIG +K
Sbjct: 181 SIAAGADGVEIHSANGYLLNQFLDPHSNNRTDEYGGSIENRARFTLEVVDAIVDAIGHEK 240

Query: 241 VGIRLAPYNTNGDMSGSWDPTVFAHYAYVLGKLEKRAQAGKRLAFVHIFEPRVSNPWDNE 300
           VG+RL+PY     MSG  +  + A +AYVLG+LE+RA+AGKRLAFVH+ EPRV+NP+  E
Sbjct: 241 VGLRLSPYGVFNSMSGGAETGIVAQFAYVLGELERRAKAGKRLAFVHLVEPRVTNPFLAE 300

Query: 301 GDGAYNGGTTDYVYSIWKGVVIRTGNLAIHPEIAKEFLKQPNTLLGYGRYFISNPDLVDR 360
           G+G Y+GG+ D+VYSIWKG +IR GN A+HPE+ +E +K P TL+GYGR+FISNPDLVDR
Sbjct: 301 GEGEYHGGSNDFVYSIWKGPIIRAGNFALHPEVVREEVKDPRTLIGYGRFFISNPDLVDR 360

Query: 361 LEKGLPLNLYDRPRFYAMPDKGYIDYPTYDEAIKMGW 397
           LEKGLPLN YDR  FY M  +GYIDYPTY+EA+K+GW
Sbjct: 361 LEKGLPLNKYDRDTFYKMSAEGYIDYPTYEEALKLGW 397

>KNAG0E00790 Chr5 (142962..144155) [1194 bp, 397 aa] {ON} Anc_5.58
           YHR179W
          Length = 397

 Score =  565 bits (1456), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 265/397 (66%), Positives = 323/397 (81%)

Query: 1   MPFNTESKPVALKDTDLFKPLKVGNTTVLNRVVLPPLTRMRAHYPGNVPNRDWTLEYYDQ 60
           MPF  +  PVAL DT+LFKP+K+GN+ + +R VLPPLTRMRAH+PGNVPN+DW +EYYDQ
Sbjct: 1   MPFVKDFTPVALGDTNLFKPIKIGNSQLQHRCVLPPLTRMRAHHPGNVPNKDWAVEYYDQ 60

Query: 61  RSKRPGTMLITEGVFPSAKAGGYDNAPGIWTEEQMVEWKKIFDKIHENESFVWPQLWVLG 120
           RS+RPGTMLITEG F   +AGGYDNAPGIW+EEQ+ +WKKIF KIHEN+SFV+ QLWVLG
Sbjct: 61  RSRRPGTMLITEGAFTCPQAGGYDNAPGIWSEEQVAQWKKIFAKIHENKSFVYVQLWVLG 120

Query: 121 READPLSLARDGLRYDSASDNVWRTXXXXXXXXXXGIEQHGITKDEIKQYIKDYVQGARN 180
           R++   +LARDGLRYDSASDNV+               QHGITKDEIK+YIK YV  A+N
Sbjct: 121 RQSYADTLARDGLRYDSASDNVYMDEEQKERALKSNNPQHGITKDEIKEYIKAYVHAAKN 180

Query: 181 SIKCGADGIEIHAANGYLLNQFLDPVSNKRTDEYGGSIKNRACFTLEVVDALVDAIGEDK 240
           SI  GADG+EIH+ANGYLLNQFLDP+SN R DEYGGSI+NRA FTLEVVDALVDAIG DK
Sbjct: 181 SIAAGADGVEIHSANGYLLNQFLDPISNHRIDEYGGSIENRARFTLEVVDALVDAIGADK 240

Query: 241 VGIRLAPYNTNGDMSGSWDPTVFAHYAYVLGKLEKRAQAGKRLAFVHIFEPRVSNPWDNE 300
           VGIR +PY T G MSG  + ++ A YAYV+G+L+KRA AGK LAF+H+ EPRV+NP+  E
Sbjct: 241 VGIRFSPYGTFGTMSGGAECSIVAQYAYVVGELQKRANAGKPLAFIHLVEPRVTNPFLTE 300

Query: 301 GDGAYNGGTTDYVYSIWKGVVIRTGNLAIHPEIAKEFLKQPNTLLGYGRYFISNPDLVDR 360
           G+G Y+ GT D+VYSIWKG VIR GNLA+HPE  K+ ++   TL+GYGR++I+NPD+VDR
Sbjct: 301 GEGEYHQGTNDFVYSIWKGPVIRAGNLALHPEEVKKLVEDDRTLIGYGRFWIANPDIVDR 360

Query: 361 LEKGLPLNLYDRPRFYAMPDKGYIDYPTYDEAIKMGW 397
           +EKG PLN Y+R  FY+M  +GY+DYPTYDEA+K+G+
Sbjct: 361 IEKGQPLNKYNRDAFYSMTSEGYLDYPTYDEAVKLGY 397

>TDEL0G00820 Chr7 complement(168417..169613) [1197 bp, 398 aa] {ON}
           Anc_5.58 YHR179W
          Length = 398

 Score =  561 bits (1447), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 260/397 (65%), Positives = 319/397 (80%)

Query: 1   MPFNTESKPVALKDTDLFKPLKVGNTTVLNRVVLPPLTRMRAHYPGNVPNRDWTLEYYDQ 60
           M F  + KP+AL DT LFKP+K+GN  + +RVV+PPLTRMRA +PGNVPN+DW +EYYDQ
Sbjct: 1   MSFVQDFKPIALADTKLFKPIKIGNNELAHRVVMPPLTRMRATHPGNVPNKDWAVEYYDQ 60

Query: 61  RSKRPGTMLITEGVFPSAKAGGYDNAPGIWTEEQMVEWKKIFDKIHENESFVWPQLWVLG 120
           RSKRPGT++ITEG FPSA++GGYDN PGIW+  Q+ +WKKIF KIHEN+SFVW QLWVLG
Sbjct: 61  RSKRPGTLIITEGAFPSAQSGGYDNVPGIWSPAQLEQWKKIFAKIHENKSFVWVQLWVLG 120

Query: 121 READPLSLARDGLRYDSASDNVWRTXXXXXXXXXXGIEQHGITKDEIKQYIKDYVQGARN 180
           R++   +LARDGLRYDSASD V+               QHG+TK EIKQYI +YV  A+ 
Sbjct: 121 RQSFADTLARDGLRYDSASDGVYMDEEQRERAVKSNNPQHGLTKAEIKQYISEYVDAAKK 180

Query: 181 SIKCGADGIEIHAANGYLLNQFLDPVSNKRTDEYGGSIKNRACFTLEVVDALVDAIGEDK 240
           SI+ GADG+EIH+ANGYLLNQFLDP+SNKRTDEYGGSI+NRA F LEVVDA+ +AIG DK
Sbjct: 181 SIEAGADGVEIHSANGYLLNQFLDPISNKRTDEYGGSIENRARFVLEVVDAVTEAIGCDK 240

Query: 241 VGIRLAPYNTNGDMSGSWDPTVFAHYAYVLGKLEKRAQAGKRLAFVHIFEPRVSNPWDNE 300
           VGIRL+PY T G MSG  +P + A +AYVLG+LEKR +AGKRL+FVH+ EPRV+NP+  E
Sbjct: 241 VGIRLSPYGTFGTMSGGSEPLIVAQFAYVLGELEKRGKAGKRLSFVHLVEPRVTNPFYTE 300

Query: 301 GDGAYNGGTTDYVYSIWKGVVIRTGNLAIHPEIAKEFLKQPNTLLGYGRYFISNPDLVDR 360
           G G Y  GT D+ YS+WKG +IR GNLA+HPE+ K+ ++   TL+GYGR+FISNPD+VDR
Sbjct: 301 GQGEYTEGTNDFAYSVWKGPIIRAGNLALHPEVVKKMVEDDRTLIGYGRFFISNPDIVDR 360

Query: 361 LEKGLPLNLYDRPRFYAMPDKGYIDYPTYDEAIKMGW 397
           +EKGLPLN Y+R  FYAM   GY+DYPTYDEA+K+G+
Sbjct: 361 VEKGLPLNKYNRDTFYAMTANGYLDYPTYDEAVKLGY 397

>NDAI0C03460 Chr3 (792929..794128) [1200 bp, 399 aa] {ON} Anc_5.58
          Length = 399

 Score =  561 bits (1445), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 264/400 (66%), Positives = 321/400 (80%), Gaps = 1/400 (0%)

Query: 1   MPFNTESKPVALKDTDLFKPLKVGNTTVLNRVVLPPLTRMRAHYPGNVPNRDWTLEYYDQ 60
           MPF     PVAL DT+LFKP+KVGNT + +RVV+PPLTRMRAH+PGN+PN DW +EYY Q
Sbjct: 1   MPFVKNFPPVALGDTNLFKPIKVGNTELQHRVVMPPLTRMRAHHPGNIPN-DWAVEYYSQ 59

Query: 61  RSKRPGTMLITEGVFPSAKAGGYDNAPGIWTEEQMVEWKKIFDKIHENESFVWPQLWVLG 120
           R++RPGTM+ITEG FPS ++G YDNAPGIW+EEQM +WKKIFDKIHEN+SFVW QLWVLG
Sbjct: 60  RTQRPGTMIITEGAFPSPQSGSYDNAPGIWSEEQMKQWKKIFDKIHENKSFVWVQLWVLG 119

Query: 121 READPLSLARDGLRYDSASDNVWRTXXXXXXXXXXGIEQHGITKDEIKQYIKDYVQGARN 180
           R+     LARDGLR+D  SD V+                HGITKDEIKQYIK+YVQ A+N
Sbjct: 120 RQGLADVLARDGLRFDGPSDGVYMDEETEARAKKSNNPLHGITKDEIKQYIKEYVQAAKN 179

Query: 181 SIKCGADGIEIHAANGYLLNQFLDPVSNKRTDEYGGSIKNRACFTLEVVDALVDAIGEDK 240
           SI  GADG+EIH+ANGYLLNQFLDP+SNKRTDEYGGSI+NRA FTLEVVDA+V AIGEDK
Sbjct: 180 SIASGADGVEIHSANGYLLNQFLDPISNKRTDEYGGSIENRARFTLEVVDAVVAAIGEDK 239

Query: 241 VGIRLAPYNTNGDMSGSWDPTVFAHYAYVLGKLEKRAQAGKRLAFVHIFEPRVSNPWDNE 300
           VG+R +PY T G MS  +DPT+ A YAYV+G+LEKRA+AGKR+A++H+ EP V+N +  E
Sbjct: 240 VGVRFSPYGTFGKMSSGYDPTLLAQYAYVIGELEKRAKAGKRIAYIHLVEPLVTNLFMTE 299

Query: 301 GDGAYNGGTTDYVYSIWKGVVIRTGNLAIHPEIAKEFLKQPNTLLGYGRYFISNPDLVDR 360
           G+G Y  GT D+VYSIWKG +IR GNLA++P++ +E +K   TL+GYGR+FI+NPD+VDR
Sbjct: 300 GEGEYKDGTNDFVYSIWKGPIIRAGNLALNPQLVREMVKDERTLIGYGRFFIANPDIVDR 359

Query: 361 LEKGLPLNLYDRPRFYAMPDKGYIDYPTYDEAIKMGWGEK 400
           +EKG   N YD+  FYAM +KGY DYPTY EAIK+GW +K
Sbjct: 360 VEKGQQFNQYDKDTFYAMSEKGYNDYPTYPEAIKLGWDKK 399

>KLTH0E07920g Chr5 (728285..729487) [1203 bp, 400 aa] {ON} highly
           similar to uniprot|Q03558 Saccharomyces cerevisiae
           YHR179W OYE2 Widely conserved NADPH oxidoreductase
           containing flavin mononucleotide (FMN) homologous to
           Oye3p with slight differences in ligand binding and
           catalytic properties may be involved in sterol
           metabolism
          Length = 400

 Score =  558 bits (1439), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 267/397 (67%), Positives = 318/397 (80%), Gaps = 1/397 (0%)

Query: 1   MPFNTESKPVALKDTDLFKPLKVGNTTVLNRVVLPPLTRMRAHYPGNVPNRDWTLEYYDQ 60
           M F  + KP+AL+DT LF+P+++G+TTV +R V+ PLTRMRAH+PGNVPN+DW LEYYDQ
Sbjct: 1   MTFVKDLKPIALQDTKLFEPIQIGDTTVEHRAVMCPLTRMRAHHPGNVPNKDWALEYYDQ 60

Query: 61  RSKRPGTMLITEGVFPSAKAGGYDNAPGIWTEEQMVEWKKIFDKIHENESFVWPQLWVLG 120
           RSK PGTM+ITEG FPS + GGYDNAPGIW++EQ+ +WKKIF KIHEN+SF W QLWVLG
Sbjct: 61  RSKAPGTMIITEGTFPSPQCGGYDNAPGIWSKEQIEQWKKIFAKIHENKSFAWVQLWVLG 120

Query: 121 READPLSLARDGLRYDSASDNVWRTXXXXXXXXXXGIEQHGITKDEIKQYIKDYVQGARN 180
           R+A P +L RDGLRYDSASD V+               QHGITK+EIKQY+KDYVQ A+N
Sbjct: 121 RQAFPDTLKRDGLRYDSASDEVYMDDASEKKAIECDNRQHGITKEEIKQYVKDYVQAAKN 180

Query: 181 SIKCGADGIEIHAANGYLLNQFLDPVSNKRTDEYGGSIKNRACFTLEVVDALVDAIGEDK 240
           SI  GADG+EIH+ANGYLLNQFLDP+SNKRTDEYGGSI+NRA F LEVVDA+VDAIGE K
Sbjct: 181 SIDAGADGVEIHSANGYLLNQFLDPISNKRTDEYGGSIENRARFVLEVVDAVVDAIGEKK 240

Query: 241 VGIRLAPYNTNGDMSGSWDPTVFAHYAYVLGKLEKRAQAGKRLAFVHIFEPRVSNPWDNE 300
           VGIR +PY T G MSG+ DP + A YAYV+G+LEKRA+AGKRLA++H+ EPRV+NP+  E
Sbjct: 241 VGIRFSPYGTFGTMSGASDPGLIAQYAYVVGELEKRAKAGKRLAYIHLVEPRVTNPFFTE 300

Query: 301 GDGAYNGGTTDYVYSIWKGVVIRTGNLAIHPEIAK-EFLKQPNTLLGYGRYFISNPDLVD 359
           G G Y  G+ D+VYSIWKG VIR GN A+ P  A+ +  K   TL+GYGR FISNPDLV 
Sbjct: 301 GQGWYKEGSNDFVYSIWKGPVIRAGNYALDPRAARDDVQKNDRTLIGYGRLFISNPDLVQ 360

Query: 360 RLEKGLPLNLYDRPRFYAMPDKGYIDYPTYDEAIKMG 396
           RL++GLPLN YDR  FYAM DKGY+DYPTY EA K+ 
Sbjct: 361 RLKEGLPLNKYDRDTFYAMTDKGYVDYPTYAEATKVA 397

>TBLA0G03670 Chr7 complement(974043..975245) [1203 bp, 400 aa] {ON} 
          Length = 400

 Score =  558 bits (1439), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 265/397 (66%), Positives = 317/397 (79%)

Query: 1   MPFNTESKPVALKDTDLFKPLKVGNTTVLNRVVLPPLTRMRAHYPGNVPNRDWTLEYYDQ 60
           MPF  + KP+AL DT+LFKP+KVGN  + +R +LPPLTRMRA  P +VP+++WT +YYDQ
Sbjct: 1   MPFIKDFKPIALSDTNLFKPIKVGNNELKHRAILPPLTRMRAQTPDHVPHKEWTEKYYDQ 60

Query: 61  RSKRPGTMLITEGVFPSAKAGGYDNAPGIWTEEQMVEWKKIFDKIHENESFVWPQLWVLG 120
           RSKR GT+LITEGVF S +AGGYDNAPG+W+EEQM EWKKIF  IH+N SFVWPQLW LG
Sbjct: 61  RSKREGTLLITEGVFISRQAGGYDNAPGVWSEEQMTEWKKIFAVIHKNNSFVWPQLWALG 120

Query: 121 READPLSLARDGLRYDSASDNVWRTXXXXXXXXXXGIEQHGITKDEIKQYIKDYVQGARN 180
             AD  S+ARDGLRYD A+D V+             I+ HG+TKD+IKQYIKDYV  A+N
Sbjct: 121 WAADAKSMARDGLRYDGATDGVYSNDQYGKIAKENDIKIHGLTKDDIKQYIKDYVTAAKN 180

Query: 181 SIKCGADGIEIHAANGYLLNQFLDPVSNKRTDEYGGSIKNRACFTLEVVDALVDAIGEDK 240
            I  GADG+EIH+ANGYLLNQFLD  SNKRTDEYGGSI+NRA F LEVVDAL++AIG +K
Sbjct: 181 CIAAGADGVEIHSANGYLLNQFLDINSNKRTDEYGGSIENRARFPLEVVDALIEAIGAEK 240

Query: 241 VGIRLAPYNTNGDMSGSWDPTVFAHYAYVLGKLEKRAQAGKRLAFVHIFEPRVSNPWDNE 300
           VGIR +PY T  DM+G  +P   A +AY+ G+LEKRA+AG RLAF+H+ EPRV+NP+  E
Sbjct: 241 VGIRFSPYGTFNDMAGGSNPLGVAQFAYITGELEKRAKAGNRLAFIHLVEPRVTNPFLTE 300

Query: 301 GDGAYNGGTTDYVYSIWKGVVIRTGNLAIHPEIAKEFLKQPNTLLGYGRYFISNPDLVDR 360
           G G Y  GT D+VYSIWKGV+IR GNLA+HPE+A+EF+K   TLLGYGR +ISNPDLVDR
Sbjct: 301 GQGEYTDGTNDFVYSIWKGVIIRAGNLALHPEVAREFMKDDRTLLGYGRLWISNPDLVDR 360

Query: 361 LEKGLPLNLYDRPRFYAMPDKGYIDYPTYDEAIKMGW 397
           LEKGLPLN Y+R  FYAM  +GY+DYPTYDEAIK+GW
Sbjct: 361 LEKGLPLNKYNRDLFYAMTSEGYLDYPTYDEAIKLGW 397

>TBLA0I03570 Chr9 complement(855914..857116) [1203 bp, 400 aa] {ON} 
          Length = 400

 Score =  558 bits (1437), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 264/400 (66%), Positives = 317/400 (79%)

Query: 1   MPFNTESKPVALKDTDLFKPLKVGNTTVLNRVVLPPLTRMRAHYPGNVPNRDWTLEYYDQ 60
           MPF  E  PVAL DT+LFKP+KVGN  + +R +LPPLTRMRA  P +VP+++WT +YYDQ
Sbjct: 1   MPFIKEFNPVALNDTNLFKPIKVGNNELKHRAILPPLTRMRAQTPDHVPHKEWTEKYYDQ 60

Query: 61  RSKRPGTMLITEGVFPSAKAGGYDNAPGIWTEEQMVEWKKIFDKIHENESFVWPQLWVLG 120
           RSKR GT+LITEGVF S +AGGYDNAPG+W+EEQM EWKKIF  IH+N+SF+WPQLW LG
Sbjct: 61  RSKREGTLLITEGVFISRQAGGYDNAPGVWSEEQMTEWKKIFAAIHKNKSFIWPQLWALG 120

Query: 121 READPLSLARDGLRYDSASDNVWRTXXXXXXXXXXGIEQHGITKDEIKQYIKDYVQGARN 180
             AD   +ARDGLRYD A+DNV+             I+ HG+TKD+IKQYIKDYV  A+N
Sbjct: 121 WAADAKCMARDGLRYDGATDNVYSNDQYGKIAKENDIKIHGLTKDDIKQYIKDYVAAAKN 180

Query: 181 SIKCGADGIEIHAANGYLLNQFLDPVSNKRTDEYGGSIKNRACFTLEVVDALVDAIGEDK 240
            I  GADG+EIH+ANGY+LNQFLD  SNKRTDEYGGSI+NRA F LEVVDALV+AIG +K
Sbjct: 181 VIAAGADGVEIHSANGYMLNQFLDTNSNKRTDEYGGSIENRARFPLEVVDALVEAIGAEK 240

Query: 241 VGIRLAPYNTNGDMSGSWDPTVFAHYAYVLGKLEKRAQAGKRLAFVHIFEPRVSNPWDNE 300
           VGIR +PY T  DM G  +P   A YAY+ G+LEKRAQAG RLA++HI EPRV+NP+  E
Sbjct: 241 VGIRFSPYGTFNDMIGGANPLTVAQYAYITGELEKRAQAGNRLAYIHIVEPRVTNPFLTE 300

Query: 301 GDGAYNGGTTDYVYSIWKGVVIRTGNLAIHPEIAKEFLKQPNTLLGYGRYFISNPDLVDR 360
           G G Y  GT D+ YSIWKG++IR+GNLA+HPE+A+EF+K   TLLGYGR +I+NPDLVDR
Sbjct: 301 GQGEYVDGTNDFFYSIWKGIIIRSGNLALHPEVAREFMKDDRTLLGYGRLWIANPDLVDR 360

Query: 361 LEKGLPLNLYDRPRFYAMPDKGYIDYPTYDEAIKMGWGEK 400
           LEKGLPLN Y+R  FYAM  +GY+DYPTYDEAI MGW ++
Sbjct: 361 LEKGLPLNKYNRDLFYAMTSEGYLDYPTYDEAINMGWDKQ 400

>CAGL0K10890g Chr11 (1063220..1064422) [1203 bp, 400 aa] {ON} highly
           similar to uniprot|Q03558 Saccharomyces cerevisiae
           YHR179w OYE2 NADPH dehydrogenase or uniprot|P41816
           Saccharomyces cerevisiae YPL171c OYE3
          Length = 400

 Score =  556 bits (1432), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 255/400 (63%), Positives = 316/400 (79%)

Query: 1   MPFNTESKPVALKDTDLFKPLKVGNTTVLNRVVLPPLTRMRAHYPGNVPNRDWTLEYYDQ 60
           M F T+ +PV+LK T+LFKPLKVGN TVL+R   PPLTRMRA  PGN+PNR+W++EYY Q
Sbjct: 1   MSFTTDFEPVSLKGTNLFKPLKVGNNTVLHRAAFPPLTRMRAESPGNIPNREWSVEYYRQ 60

Query: 61  RSKRPGTMLITEGVFPSAKAGGYDNAPGIWTEEQMVEWKKIFDKIHENESFVWPQLWVLG 120
           RS+RPGT++ITEG FPSA+AGGYDNAPGIW+EEQ+VEW+KI D IH N+SF W QLW LG
Sbjct: 61  RSQRPGTLVITEGTFPSAQAGGYDNAPGIWSEEQLVEWRKIIDAIHSNKSFAWVQLWALG 120

Query: 121 READPLSLARDGLRYDSASDNVWRTXXXXXXXXXXGIEQHGITKDEIKQYIKDYVQGARN 180
           R A P  LARDGLR+DSA+DN + +             QHG+++++IKQY+ DYVQ ++N
Sbjct: 121 RLAMPNLLARDGLRFDSATDNYYASPEQEELAKKSNNLQHGLSREDIKQYVNDYVQASKN 180

Query: 181 SIKCGADGIEIHAANGYLLNQFLDPVSNKRTDEYGGSIKNRACFTLEVVDALVDAIGEDK 240
           +I  GADG+EIH++ G+LLN+F+DP+SN R+DEYGGSI+NRA F LEVVDA+VDAIG +K
Sbjct: 181 AISAGADGVEIHSSTGFLLNEFIDPISNHRSDEYGGSIENRARFVLEVVDAVVDAIGAEK 240

Query: 241 VGIRLAPYNTNGDMSGSWDPTVFAHYAYVLGKLEKRAQAGKRLAFVHIFEPRVSNPWDNE 300
             IR +PY   G MSG  DPT+ A YAY++G+LEKRA+ GKRLA++H  EPRV +P+  E
Sbjct: 241 TAIRFSPYGNYGGMSGGTDPTIIAQYAYIIGELEKRAKGGKRLAYIHFMEPRVLDPFLPE 300

Query: 301 GDGAYNGGTTDYVYSIWKGVVIRTGNLAIHPEIAKEFLKQPNTLLGYGRYFISNPDLVDR 360
           G+  YN GT D+ YSIWKGV+IRTGN AIHPE+ K+ +    T++GYGRYFISNPDLVDR
Sbjct: 301 GESVYNEGTIDFAYSIWKGVIIRTGNYAIHPEVVKDVVNDDRTIIGYGRYFISNPDLVDR 360

Query: 361 LEKGLPLNLYDRPRFYAMPDKGYIDYPTYDEAIKMGWGEK 400
           LEKGLPLN YDR  FY M  +GYIDYPTY EAIK GW +K
Sbjct: 361 LEKGLPLNKYDRSYFYTMTAEGYIDYPTYAEAIKKGWDKK 400

>KLTH0E07898g Chr5 (725950..727152) [1203 bp, 400 aa] {ON} highly
           similar to uniprot|Q03558 Saccharomyces cerevisiae
           YHR179W OYE2 Widely conserved NADPH oxidoreductase
           containing flavin mononucleotide (FMN) homologous to
           Oye3p with slight differences in ligand binding and
           catalytic properties may be involved in sterol
           metabolism
          Length = 400

 Score =  553 bits (1425), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 266/397 (67%), Positives = 316/397 (79%), Gaps = 1/397 (0%)

Query: 1   MPFNTESKPVALKDTDLFKPLKVGNTTVLNRVVLPPLTRMRAHYPGNVPNRDWTLEYYDQ 60
           M F  + KP+AL+DT LF+P+++G+TTV +R V+ PLTRMRAH+PGNVPN+DW LEYYDQ
Sbjct: 1   MTFVKDLKPIALQDTKLFEPIQIGDTTVEHRAVMCPLTRMRAHHPGNVPNKDWALEYYDQ 60

Query: 61  RSKRPGTMLITEGVFPSAKAGGYDNAPGIWTEEQMVEWKKIFDKIHENESFVWPQLWVLG 120
           RSK PGTM+ITEG FPS + GGYDNAPGIW++EQ+ +WKKIF KIHEN+SF W QLWVLG
Sbjct: 61  RSKAPGTMIITEGTFPSPQCGGYDNAPGIWSKEQIEQWKKIFAKIHENKSFAWVQLWVLG 120

Query: 121 READPLSLARDGLRYDSASDNVWRTXXXXXXXXXXGIEQHGITKDEIKQYIKDYVQGARN 180
           R+A   +L RDGLRYDSASD V+               QHGITK+EIKQY+KDYVQ A+N
Sbjct: 121 RQAPCDTLKRDGLRYDSASDEVYMDDASEKKAIECDNRQHGITKEEIKQYVKDYVQAAKN 180

Query: 181 SIKCGADGIEIHAANGYLLNQFLDPVSNKRTDEYGGSIKNRACFTLEVVDALVDAIGEDK 240
           SI  GADG+EIH+ANGYLLNQFLDP+SNKRTDEYGGSI+NRA F LEVVDA+VDAIGE K
Sbjct: 181 SIDAGADGVEIHSANGYLLNQFLDPISNKRTDEYGGSIENRARFVLEVVDAVVDAIGEKK 240

Query: 241 VGIRLAPYNTNGDMSGSWDPTVFAHYAYVLGKLEKRAQAGKRLAFVHIFEPRVSNPWDNE 300
           VGIR +PY T G+MSG+ DP + A YAYV+G+LEKRA+AGKRLA++H+ EPRV+N    E
Sbjct: 241 VGIRFSPYGTFGNMSGASDPGLIAQYAYVVGELEKRAKAGKRLAYIHLVEPRVTNLSLTE 300

Query: 301 GDGAYNGGTTDYVYSIWKGVVIRTGNLAIHPEIAK-EFLKQPNTLLGYGRYFISNPDLVD 359
           G G Y  G+ D+VYSIWKG VIR GN A+ P  A+ +  K   TL+GYGR FISNPDLV 
Sbjct: 301 GQGWYKEGSNDFVYSIWKGPVIRAGNYALDPSAARDDVQKNDRTLIGYGRLFISNPDLVQ 360

Query: 360 RLEKGLPLNLYDRPRFYAMPDKGYIDYPTYDEAIKMG 396
           RL++GLPLN YDR  FYAM DKGYIDYPTY EA K+ 
Sbjct: 361 RLKEGLPLNKYDRDTFYAMTDKGYIDYPTYAEATKVA 397

>TBLA0A10550 Chr1 (2607210..2608412) [1203 bp, 400 aa] {ON} 
          Length = 400

 Score =  553 bits (1424), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 257/400 (64%), Positives = 320/400 (80%)

Query: 1   MPFNTESKPVALKDTDLFKPLKVGNTTVLNRVVLPPLTRMRAHYPGNVPNRDWTLEYYDQ 60
           MPF  +  PVALKDT+LFKP+KVG+  + +R VLPPLTRMRAH+PG+VPN+DW +EYYDQ
Sbjct: 1   MPFVKDFTPVALKDTNLFKPIKVGDNELKHRAVLPPLTRMRAHHPGHVPNKDWAVEYYDQ 60

Query: 61  RSKRPGTMLITEGVFPSAKAGGYDNAPGIWTEEQMVEWKKIFDKIHENESFVWPQLWVLG 120
           RSKRPG++L+TEGVF S +AGGYDNAPG +++EQ+ EWKKI D +H+N SF+WPQLW LG
Sbjct: 61  RSKRPGSLLVTEGVFISEQAGGYDNAPGCYSDEQIAEWKKICDVVHKNHSFIWPQLWALG 120

Query: 121 READPLSLARDGLRYDSASDNVWRTXXXXXXXXXXGIEQHGITKDEIKQYIKDYVQGARN 180
             AD  S++RDGLRYD A+DNV+             I+ HG+T D+IKQYIKDYV  A+ 
Sbjct: 121 WAADAKSMSRDGLRYDGATDNVYSNDKYGILAKENNIKIHGLTTDDIKQYIKDYVNAAKR 180

Query: 181 SIKCGADGIEIHAANGYLLNQFLDPVSNKRTDEYGGSIKNRACFTLEVVDALVDAIGEDK 240
            I  GADG+EIH+ANGYLLNQFLD  SNKRTD+YGGSI+NRA F LEVVDAL++A+G +K
Sbjct: 181 VIAAGADGVEIHSANGYLLNQFLDENSNKRTDQYGGSIENRARFPLEVVDALIEAVGAEK 240

Query: 241 VGIRLAPYNTNGDMSGSWDPTVFAHYAYVLGKLEKRAQAGKRLAFVHIFEPRVSNPWDNE 300
           VGIR +PY T  DM+G  +  + A +AY++G+LEKRA+AG RLA++H+ EPRV+NP+  E
Sbjct: 241 VGIRFSPYGTFNDMAGGKNSLIVAQFAYIIGELEKRAKAGNRLAYIHLVEPRVTNPFLTE 300

Query: 301 GDGAYNGGTTDYVYSIWKGVVIRTGNLAIHPEIAKEFLKQPNTLLGYGRYFISNPDLVDR 360
           G G Y  GT D+VYSIWKG++IR GNLA+HPEIAK+ LK   TLLGYGR +I+NPDLVDR
Sbjct: 301 GQGEYLDGTNDFVYSIWKGIIIRAGNLALHPEIAKDLLKDDRTLLGYGRLWIANPDLVDR 360

Query: 361 LEKGLPLNLYDRPRFYAMPDKGYIDYPTYDEAIKMGWGEK 400
           LEKGLPLN YDR  FY+M  +GY+DYPTY EAIK+GW +K
Sbjct: 361 LEKGLPLNKYDRDSFYSMTSEGYLDYPTYAEAIKLGWDKK 400

>Kwal_47.16561 s47 (4316..5515) [1200 bp, 399 aa] {ON} YHR179W
           (OYE2) - 1:1 [contig 376] FULL
          Length = 399

 Score =  552 bits (1422), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 262/399 (65%), Positives = 316/399 (79%)

Query: 1   MPFNTESKPVALKDTDLFKPLKVGNTTVLNRVVLPPLTRMRAHYPGNVPNRDWTLEYYDQ 60
           M F  + KP++LKDT LFKP+++G T V +R V+ PLTRMRAH PGNVPN++W LEYY+Q
Sbjct: 1   MTFVKDFKPISLKDTALFKPIQIGETIVQHRAVMCPLTRMRAHSPGNVPNKEWALEYYNQ 60

Query: 61  RSKRPGTMLITEGVFPSAKAGGYDNAPGIWTEEQMVEWKKIFDKIHENESFVWPQLWVLG 120
           RS+ PGTM+ITEG FPS + GGYDNAPGIW++EQ+ EWKKIF KIH+N+SFVW QLWVLG
Sbjct: 61  RSQAPGTMIITEGTFPSPQCGGYDNAPGIWSQEQLAEWKKIFAKIHDNKSFVWVQLWVLG 120

Query: 121 READPLSLARDGLRYDSASDNVWRTXXXXXXXXXXGIEQHGITKDEIKQYIKDYVQGARN 180
           R+A P +L RDGLRYDSASD V+               QHG+TKDEIKQYIKDYVQ ++N
Sbjct: 121 RQAFPDTLKRDGLRYDSASDEVYMDESSEKKAIECDNRQHGLTKDEIKQYIKDYVQASKN 180

Query: 181 SIKCGADGIEIHAANGYLLNQFLDPVSNKRTDEYGGSIKNRACFTLEVVDALVDAIGEDK 240
           +I  GADG+EIH+ANGYLLNQFLDP+SNKRTDEYGGSI+NRA F LEVVDA+VD IGE K
Sbjct: 181 AIAAGADGVEIHSANGYLLNQFLDPISNKRTDEYGGSIENRARFVLEVVDAVVDTIGEKK 240

Query: 241 VGIRLAPYNTNGDMSGSWDPTVFAHYAYVLGKLEKRAQAGKRLAFVHIFEPRVSNPWDNE 300
           VGIR +PY T G MSG+ +PT+ A YAYV+G+LEKRA+AGKRLAFV + EPRV+NP+  E
Sbjct: 241 VGIRFSPYGTFGTMSGAAEPTLIAQYAYVIGELEKRAKAGKRLAFVDLVEPRVTNPFFKE 300

Query: 301 GDGAYNGGTTDYVYSIWKGVVIRTGNLAIHPEIAKEFLKQPNTLLGYGRYFISNPDLVDR 360
           G+G Y  G+ D+VYS+WKG VIR GN A+ P  AK  +++  TL+GYGR FISNPDLV R
Sbjct: 301 GEGWYKEGSNDFVYSVWKGPVIRAGNYALDPTAAKSDVEKDRTLIGYGRLFISNPDLVHR 360

Query: 361 LEKGLPLNLYDRPRFYAMPDKGYIDYPTYDEAIKMGWGE 399
           L +GLPLN YDR  FYAM DKGY DYP+Y +A K+   E
Sbjct: 361 LYEGLPLNKYDRDTFYAMTDKGYTDYPSYADASKITAAE 399

>NDAI0B00920 Chr2 (212588..213868) [1281 bp, 426 aa] {ON} Anc_5.58
          Length = 426

 Score =  551 bits (1420), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 259/397 (65%), Positives = 315/397 (79%), Gaps = 3/397 (0%)

Query: 1   MPFNTESKPVALKDTDLFKPLKVGNTTVLNRVVLPPLTRMRAHYPGNVPNRDWTLEYYDQ 60
           MPF T  +PVALKDT+LFKP K+GNT + +R V+PPLTRMRA +PGN+PNR W  EYY Q
Sbjct: 1   MPFVTNFQPVALKDTNLFKPTKIGNTELKHRAVMPPLTRMRAEHPGNIPNRKWAYEYYKQ 60

Query: 61  RSKRPGTMLITEGVFPSAKAGGYDNAPGIWTEEQMVEWKKIFDKIHENESFVWPQLWVLG 120
           RS+RPGTMLITEG F S +AGGYDNAPGIW++EQM +WK IF  +H+N+SF+W QLW LG
Sbjct: 61  RSQRPGTMLITEGTFISPQAGGYDNAPGIWSQEQMDQWKHIFKGVHDNKSFIWVQLWSLG 120

Query: 121 READPLSLARDGLRYDSASD---NVWRTXXXXXXXXXXGIEQHGITKDEIKQYIKDYVQG 177
            +A P +LARDGLRYDSA+D   N++               QHG+TK+EIKQYI++YVQ 
Sbjct: 121 WQAFPDTLARDGLRYDSATDGSANIYMDEESELKAKKANNPQHGLTKNEIKQYIEEYVQA 180

Query: 178 ARNSIKCGADGIEIHAANGYLLNQFLDPVSNKRTDEYGGSIKNRACFTLEVVDALVDAIG 237
           A+NSI CGADGIEIH+ANGYLLNQFLDP+SN+RTDEYG SI+NRA F LEV DA+V A+G
Sbjct: 181 AKNSIACGADGIEIHSANGYLLNQFLDPMSNQRTDEYGNSIENRARFVLEVTDAVVKAVG 240

Query: 238 EDKVGIRLAPYNTNGDMSGSWDPTVFAHYAYVLGKLEKRAQAGKRLAFVHIFEPRVSNPW 297
            ++VGIR +PY   G+MSG  DP + A Y Y+LG+LEKRA+ GKRLA+VH+ EPRV+NP+
Sbjct: 241 PERVGIRFSPYGKFGNMSGGSDPDLLAEYCYILGELEKRAKNGKRLAYVHLVEPRVTNPF 300

Query: 298 DNEGDGAYNGGTTDYVYSIWKGVVIRTGNLAIHPEIAKEFLKQPNTLLGYGRYFISNPDL 357
             EG+G Y  GT D+ YSIWKG +IR+GNLA+HPEIAK+ L+   TLLGYGR+FI+NPDL
Sbjct: 301 LKEGEGEYTDGTNDFAYSIWKGPIIRSGNLALHPEIAKDLLQDDRTLLGYGRFFIANPDL 360

Query: 358 VDRLEKGLPLNLYDRPRFYAMPDKGYIDYPTYDEAIK 394
           VDRLE G PLN YDR  FYAM DKGY+DYPTYDE  +
Sbjct: 361 VDRLEYGEPLNKYDRSTFYAMTDKGYLDYPTYDETFE 397

>NCAS0B00730 Chr2 (110836..112023) [1188 bp, 395 aa] {ON} 
          Length = 395

 Score =  544 bits (1401), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 256/395 (64%), Positives = 315/395 (79%), Gaps = 2/395 (0%)

Query: 1   MPFNTESKPVALKDTDLFKPLKVGNTTVLNRVVLPPLTRMRAHYPGNVPNRDWTLEYYDQ 60
           MP   + KPVALK+T+LFKP+KVGNT V +RVV+ PLTRMRAH+PGN+PNRDW  EYYDQ
Sbjct: 1   MPLVKDFKPVALKNTNLFKPIKVGNTQVEHRVVMAPLTRMRAHHPGNIPNRDWAAEYYDQ 60

Query: 61  RSKRPGTMLITEGVFPSAKAGGYDNAPGIWTEEQMVEWKKIFDKIHENESFVWPQLWVLG 120
           RSKR GTM++TEGVFPSA++GGYDNAPGIW++EQ+ +W KIFD+IH N SFVWPQLWVLG
Sbjct: 61  RSKRKGTMIVTEGVFPSAQSGGYDNAPGIWSKEQIEQWSKIFDRIHANGSFVWPQLWVLG 120

Query: 121 READPLSLARDGLRYDSASDNVWRTXXXXXXXXXXGIEQHGITKDEIKQYIKDYVQGARN 180
           R+A P SLARDGLRYDSASD+V+               QHGITKDEIKQY+KDY+QGA+N
Sbjct: 121 RQAFPDSLARDGLRYDSASDDVYIDAETEQRAKEAKNPQHGITKDEIKQYVKDYIQGAKN 180

Query: 181 SIKCGADGIEIHAANGYLLNQFLDPVSNKRTDEYGGSIKNRACFTLEVVDALVDAIGEDK 240
           S+  GADG+EIH+AN YLLNQFLDP+SNKRTDEYGGSI+NRA F LEVVDAL+DAIG ++
Sbjct: 181 SVNAGADGVEIHSANSYLLNQFLDPISNKRTDEYGGSIENRARFALEVVDALIDAIGAER 240

Query: 241 VGIRLAPYNTNGDMSGSWDPTVFAHYAYVLGKLEKRAQAGKRLAFVHIFEPRVSNPWDNE 300
           VGIRL+P+   G MSG  DPT+ A +AY++G+LEKRA+ GKR+A++H+ EPR++  WD +
Sbjct: 241 VGIRLSPWGRIGGMSGGSDPTLLAQFAYLVGELEKRAKEGKRIAYIHLVEPRITE-WDVD 299

Query: 301 GDGAYN-GGTTDYVYSIWKGVVIRTGNLAIHPEIAKEFLKQPNTLLGYGRYFISNPDLVD 359
            D   N  GT D++YSIWKG +IR GN  ++PE   + +    TL+GYGR+FISNPDL D
Sbjct: 300 YDAGSNENGTNDFIYSIWKGPIIRAGNFTLNPEETTKAVSMDRTLIGYGRFFISNPDLPD 359

Query: 360 RLEKGLPLNLYDRPRFYAMPDKGYIDYPTYDEAIK 394
           RLE G PLN YDR  FY+   +GY DYPT +EA+K
Sbjct: 360 RLENGSPLNAYDRSSFYSFTKEGYTDYPTLEEALK 394

>TBLA0J00530 Chr10 complement(103254..104456) [1203 bp, 400 aa] {ON}
           
          Length = 400

 Score =  543 bits (1400), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 245/397 (61%), Positives = 306/397 (77%)

Query: 1   MPFNTESKPVALKDTDLFKPLKVGNTTVLNRVVLPPLTRMRAHYPGNVPNRDWTLEYYDQ 60
           M F  +  P+ L+DT+LFKP++VG+  + NR+V+PPLTRMRAHYPGN+PNR W  +YYDQ
Sbjct: 1   MAFVEDFTPIPLEDTNLFKPIRVGDCMLRNRIVMPPLTRMRAHYPGNIPNRFWARKYYDQ 60

Query: 61  RSKRPGTMLITEGVFPSAKAGGYDNAPGIWTEEQMVEWKKIFDKIHENESFVWPQLWVLG 120
           RSK PGTM+ITEG F S +AGGYDNAPG+W+ EQM EWK IF K+HEN S++WPQLW LG
Sbjct: 61  RSKSPGTMIITEGAFISPQAGGYDNAPGVWSSEQMTEWKSIFKKVHENGSYIWPQLWALG 120

Query: 121 READPLSLARDGLRYDSASDNVWRTXXXXXXXXXXGIEQHGITKDEIKQYIKDYVQGARN 180
           R A P  L RDGLR+DSASD ++               QHG+TK EIKQYIKDY+  A+N
Sbjct: 121 RAAYPEVLKRDGLRFDSASDGIYMDTEMESKAKNCKNLQHGLTKVEIKQYIKDYIHAAKN 180

Query: 181 SIKCGADGIEIHAANGYLLNQFLDPVSNKRTDEYGGSIKNRACFTLEVVDALVDAIGEDK 240
            +  GADGIE+HAANGYL+NQF+DP+SNKR DEYGGSI+NRA F LE+VD LV  +G + 
Sbjct: 181 CMSSGADGIELHAANGYLINQFIDPISNKRKDEYGGSIENRARFILEIVDDLVQEVGSEH 240

Query: 241 VGIRLAPYNTNGDMSGSWDPTVFAHYAYVLGKLEKRAQAGKRLAFVHIFEPRVSNPWDNE 300
           VGIR +PY T G MSG  +PT+ A Y Y++GKLE+RAQ GKRLA++H+ EPRV+NP+  E
Sbjct: 241 VGIRFSPYGTFGTMSGGENPTIMAQYCYIIGKLEERAQKGKRLAYIHLVEPRVTNPFLTE 300

Query: 301 GDGAYNGGTTDYVYSIWKGVVIRTGNLAIHPEIAKEFLKQPNTLLGYGRYFISNPDLVDR 360
           G GAY+ G+ D++YSIWKG +IR GN A+HPEI +E +K   TL+ YGRYFISNPDLV R
Sbjct: 301 GQGAYSEGSNDFIYSIWKGNIIRAGNFALHPEIVEELVKDERTLIAYGRYFISNPDLVTR 360

Query: 361 LEKGLPLNLYDRPRFYAMPDKGYIDYPTYDEAIKMGW 397
           + KGLPLN Y+R +FY M ++GY DYPTY EA+ +GW
Sbjct: 361 VAKGLPLNRYERDKFYVMSEEGYTDYPTYTEALSLGW 397

>KAFR0B07070 Chr2 complement(1474959..1476161) [1203 bp, 400 aa]
           {ON} 
          Length = 400

 Score =  541 bits (1394), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 249/396 (62%), Positives = 316/396 (79%)

Query: 1   MPFNTESKPVALKDTDLFKPLKVGNTTVLNRVVLPPLTRMRAHYPGNVPNRDWTLEYYDQ 60
           MPF  + KPVAL+DT+LFKP+K+G+  V +RVV+ PLTRMRAH+PGNVPN+DW+LEYYDQ
Sbjct: 1   MPFVKDFKPVALRDTNLFKPIKIGSIEVSHRVVMAPLTRMRAHHPGNVPNKDWSLEYYDQ 60

Query: 61  RSKRPGTMLITEGVFPSAKAGGYDNAPGIWTEEQMVEWKKIFDKIHENESFVWPQLWVLG 120
           RS+RPGT++ITE  F S +AGGYDNAPGIW  EQ+ +WKKIF KIH+N++FV+ QLW LG
Sbjct: 61  RSRRPGTLIITEATFISPQAGGYDNAPGIWAPEQIEQWKKIFTKIHDNKAFVFVQLWNLG 120

Query: 121 READPLSLARDGLRYDSASDNVWRTXXXXXXXXXXGIEQHGITKDEIKQYIKDYVQGARN 180
            +ADP  +ARDGLRYD+ASD V+            GI+ HGITK+EIKQYI+DYVQ A+N
Sbjct: 121 WQADPAVMARDGLRYDTASDGVYMDETKRAEAEKAGIKPHGITKEEIKQYIQDYVQAAKN 180

Query: 181 SIKCGADGIEIHAANGYLLNQFLDPVSNKRTDEYGGSIKNRACFTLEVVDALVDAIGEDK 240
           +I  GADG+EIH A GYLLNQFLD VSNKRTDEYGGS++NRA F L+VVDAL++A+G +K
Sbjct: 181 AIDAGADGVEIHNAGGYLLNQFLDSVSNKRTDEYGGSVENRARFALQVVDALIEAVGPEK 240

Query: 241 VGIRLAPYNTNGDMSGSWDPTVFAHYAYVLGKLEKRAQAGKRLAFVHIFEPRVSNPWDNE 300
           V IR  P+ T G M G+ DP   +++AY+L +LEKRA  GKRLA+VH+ EPRV NP+ NE
Sbjct: 241 VSIRFTPFGTYGGMGGAADPFNLSNHAYILAELEKRAMNGKRLAYVHLVEPRVLNPFLNE 300

Query: 301 GDGAYNGGTTDYVYSIWKGVVIRTGNLAIHPEIAKEFLKQPNTLLGYGRYFISNPDLVDR 360
           G+GA N  + ++ YSIWKG +IR GNLA+HPE+A++ +    TL+ YGR+FI+NPDLVDR
Sbjct: 301 GEGADNDSSNEFAYSIWKGPIIRAGNLALHPEVAEKMISDARTLIAYGRFFIANPDLVDR 360

Query: 361 LEKGLPLNLYDRPRFYAMPDKGYIDYPTYDEAIKMG 396
           LEKGLP N YDR  FY+M  +GY+DYPT+ EA+K+G
Sbjct: 361 LEKGLPFNKYDRSTFYSMKSEGYLDYPTHSEALKLG 396

>NDAI0E00850 Chr5 complement(170233..171432) [1200 bp, 399 aa] {ON} 
          Length = 399

 Score =  540 bits (1390), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 253/395 (64%), Positives = 312/395 (78%)

Query: 1   MPFNTESKPVALKDTDLFKPLKVGNTTVLNRVVLPPLTRMRAHYPGNVPNRDWTLEYYDQ 60
           MP   +  PV L +TDLFKPLKVGNTTV +RVV+ PLTRMRAH PG++PNRDW +EYYDQ
Sbjct: 1   MPLVKDYTPVPLANTDLFKPLKVGNTTVEHRVVMAPLTRMRAHAPGHIPNRDWAVEYYDQ 60

Query: 61  RSKRPGTMLITEGVFPSAKAGGYDNAPGIWTEEQMVEWKKIFDKIHENESFVWPQLWVLG 120
           RSKR G+M+ITEGVFPSA++ GYDNAPGIWT EQ+ +W KIF KIHEN SFVWPQLWVLG
Sbjct: 61  RSKRKGSMIITEGVFPSAQSSGYDNAPGIWTPEQIEQWTKIFKKIHENGSFVWPQLWVLG 120

Query: 121 READPLSLARDGLRYDSASDNVWRTXXXXXXXXXXGIEQHGITKDEIKQYIKDYVQGARN 180
           R+A P ++ARDGLRYDSASD+++               QHGITKDEIKQY+KDYVQGA+N
Sbjct: 121 RQAFPDAMARDGLRYDSASDDLYMDDEMKEKAIKSNNPQHGITKDEIKQYVKDYVQGAKN 180

Query: 181 SIKCGADGIEIHAANGYLLNQFLDPVSNKRTDEYGGSIKNRACFTLEVVDALVDAIGEDK 240
           +++ GADG+EIH+AN YLLNQFLDP+SN RTDEYGGSI+NRA FTLEVVDAL++A+G ++
Sbjct: 181 AVEAGADGVEIHSANSYLLNQFLDPISNHRTDEYGGSIENRARFTLEVVDALIEAVGPER 240

Query: 241 VGIRLAPYNTNGDMSGSWDPTVFAHYAYVLGKLEKRAQAGKRLAFVHIFEPRVSNPWDNE 300
           VGIRL+P+   G MSGS DPT+ + + YV+G+LEKRA+AGKR+AF+H+ EPRV++ + + 
Sbjct: 241 VGIRLSPWGRYGGMSGSADPTLLSQFCYVVGELEKRAKAGKRIAFIHLVEPRVTDLFSDS 300

Query: 301 GDGAYNGGTTDYVYSIWKGVVIRTGNLAIHPEIAKEFLKQPNTLLGYGRYFISNPDLVDR 360
                + GT D++YSIWKGVVIR G     PE  K  +    T++G GRYFIS PDLVDR
Sbjct: 301 TAVPEDDGTNDFIYSIWKGVVIRAGMFPARPESIKAAVANDQTMIGAGRYFISTPDLVDR 360

Query: 361 LEKGLPLNLYDRPRFYAMPDKGYIDYPTYDEAIKM 395
           LEKG PLN YDR  FY+   +GY DYPTY+EA+K+
Sbjct: 361 LEKGQPLNKYDRSTFYSFTKEGYTDYPTYEEAVKL 395

>YPL171C Chr16 complement(226169..227371) [1203 bp, 400 aa] {ON}
           OYE3Conserved NADPH oxidoreductase containing flavin
           mononucleotide (FMN), homologous to Oye2p with different
           ligand binding and catalytic properties; has potential
           roles in oxidative stress response and programmed cell
           death
          Length = 400

 Score =  531 bits (1367), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 246/397 (61%), Positives = 310/397 (78%)

Query: 1   MPFNTESKPVALKDTDLFKPLKVGNTTVLNRVVLPPLTRMRAHYPGNVPNRDWTLEYYDQ 60
           MPF    +P++L+DT+LF+P+K+GNT + +R V+PPLTRMRA +PGN+PN++W   YY Q
Sbjct: 1   MPFVKGFEPISLRDTNLFEPIKIGNTQLAHRAVMPPLTRMRATHPGNIPNKEWAAVYYGQ 60

Query: 61  RSKRPGTMLITEGVFPSAKAGGYDNAPGIWTEEQMVEWKKIFDKIHENESFVWPQLWVLG 120
           R++RPGTM+ITEG F S +AGGYDNAPGIW++EQ+ EWK IF  IH+ +SF W QLW LG
Sbjct: 61  RAQRPGTMIITEGTFISPQAGGYDNAPGIWSDEQVAEWKNIFLAIHDCQSFAWVQLWSLG 120

Query: 121 READPLSLARDGLRYDSASDNVWRTXXXXXXXXXXGIEQHGITKDEIKQYIKDYVQGARN 180
             + P  LARDGLRYD ASD V+               +H +TKD+IKQYIKDY+  A+N
Sbjct: 121 WASFPDVLARDGLRYDCASDRVYMNATLQEKAKDANNLEHSLTKDDIKQYIKDYIHAAKN 180

Query: 181 SIKCGADGIEIHAANGYLLNQFLDPVSNKRTDEYGGSIKNRACFTLEVVDALVDAIGEDK 240
           SI  GADG+EIH+ANGYLLNQFLDP SNKRTDEYGG+I+NRA FTLEVVDAL++ IG ++
Sbjct: 181 SIAAGADGVEIHSANGYLLNQFLDPHSNKRTDEYGGTIENRARFTLEVVDALIETIGPER 240

Query: 241 VGIRLAPYNTNGDMSGSWDPTVFAHYAYVLGKLEKRAQAGKRLAFVHIFEPRVSNPWDNE 300
           VG+RL+PY T   MSG  +P + A Y+YVLG+LEKRA+AGKRLAFVH+ EPRV++P   E
Sbjct: 241 VGLRLSPYGTFNSMSGGAEPGIIAQYSYVLGELEKRAKAGKRLAFVHLVEPRVTDPSLVE 300

Query: 301 GDGAYNGGTTDYVYSIWKGVVIRTGNLAIHPEIAKEFLKQPNTLLGYGRYFISNPDLVDR 360
           G+G Y+ GT D+ YSIWKG +IR GN A+HPE+ +E +K P TL+GYGR+FISNPDLV R
Sbjct: 301 GEGEYSEGTNDFAYSIWKGPIIRAGNYALHPEVVREQVKDPRTLIGYGRFFISNPDLVYR 360

Query: 361 LEKGLPLNLYDRPRFYAMPDKGYIDYPTYDEAIKMGW 397
           LE+GLPLN YDR  FY M  +GY DYPTY+EA+ +GW
Sbjct: 361 LEEGLPLNKYDRSTFYTMSAEGYTDYPTYEEAVDLGW 397

>CAGL0L09537g Chr12 (1029031..1030233) [1203 bp, 400 aa] {ON} highly
           similar to uniprot|Q03558 Saccharomyces cerevisiae
           YHR179w OYE2 NADPH dehydrogenase or uniprot|P41816
           Saccharomyces cerevisiae YPL171c OYE3
          Length = 400

 Score =  530 bits (1366), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 246/400 (61%), Positives = 312/400 (78%)

Query: 1   MPFNTESKPVALKDTDLFKPLKVGNTTVLNRVVLPPLTRMRAHYPGNVPNRDWTLEYYDQ 60
           MPF  +  PVALKDT+LFKPLKVGNT VL RV + PL+R RA   GNVPN++WT EYY Q
Sbjct: 1   MPFKHDFTPVALKDTNLFKPLKVGNTEVLQRVAMAPLSRFRADPQGNVPNKNWTEEYYRQ 60

Query: 61  RSKRPGTMLITEGVFPSAKAGGYDNAPGIWTEEQMVEWKKIFDKIHENESFVWPQLWVLG 120
           RS+RPGTM+ITE  F SA+AGGYD APGIWTEEQM +WKKIF  IH+N+SFVW Q+W LG
Sbjct: 61  RSQRPGTMIITEATFISAQAGGYDAAPGIWTEEQMEQWKKIFKAIHDNKSFVWVQMWALG 120

Query: 121 READPLSLARDGLRYDSASDNVWRTXXXXXXXXXXGIEQHGITKDEIKQYIKDYVQGARN 180
           R+A P ++ARDGLR D+ S +++ +           I QH +TK++IKQYIKDYV+ A+N
Sbjct: 121 RQAFPNNMARDGLRLDAPSADLYMSDKQKEVAKENNIAQHELTKEDIKQYIKDYVKAAKN 180

Query: 181 SIKCGADGIEIHAANGYLLNQFLDPVSNKRTDEYGGSIKNRACFTLEVVDALVDAIGEDK 240
           S++ GADG+EIH+ANGYLLNQF+DP SN+RTDEYGGSI+NR  F LEVVDA+VDAIG ++
Sbjct: 181 SVESGADGVEIHSANGYLLNQFIDPKSNRRTDEYGGSIENRCRFALEVVDAVVDAIGAER 240

Query: 241 VGIRLAPYNTNGDMSGSWDPTVFAHYAYVLGKLEKRAQAGKRLAFVHIFEPRVSNPWDNE 300
            GIRL+PY   G+MSG ++P++ AHYAY++G+LEKR  AGKRLA++H+ EP V++    E
Sbjct: 241 TGIRLSPYGLFGNMSGGFEPSIVAHYAYLIGELEKRGIAGKRLAYIHLVEPSVTDLMLVE 300

Query: 301 GDGAYNGGTTDYVYSIWKGVVIRTGNLAIHPEIAKEFLKQPNTLLGYGRYFISNPDLVDR 360
             G Y  GT D+ YSIWKG +IR GN A+HPE+ KE +K P TL+ YGRYFISNPD++DR
Sbjct: 301 DQGEYKEGTNDFAYSIWKGPIIRAGNYALHPELVKEQVKDPRTLIAYGRYFISNPDIIDR 360

Query: 361 LEKGLPLNLYDRPRFYAMPDKGYIDYPTYDEAIKMGWGEK 400
           LE GLPLN  DRP FY    +GYIDYP Y++A+++GW ++
Sbjct: 361 LENGLPLNEQDRPTFYTPTAEGYIDYPNYNDALQLGWDKQ 400

>NCAS0B01090 Chr2 (180367..181554) [1188 bp, 395 aa] {ON} 
          Length = 395

 Score =  528 bits (1361), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 249/395 (63%), Positives = 307/395 (77%), Gaps = 2/395 (0%)

Query: 1   MPFNTESKPVALKDTDLFKPLKVGNTTVLNRVVLPPLTRMRAHYPGNVPNRDWTLEYYDQ 60
           M    + KPVALK+T+LFKP+K+GNT V +RVV+  LTRMRAH+PGN+PNRDW  EYYDQ
Sbjct: 1   MTLVKDFKPVALKNTNLFKPIKIGNTQVEHRVVMARLTRMRAHHPGNIPNRDWAAEYYDQ 60

Query: 61  RSKRPGTMLITEGVFPSAKAGGYDNAPGIWTEEQMVEWKKIFDKIHENESFVWPQLWVLG 120
           RSKR GTM++TEGVFPSA++GGYDNAPGIW++EQ+ +W KIFD+IH N SFVWPQLWVLG
Sbjct: 61  RSKRKGTMIVTEGVFPSAQSGGYDNAPGIWSKEQIEQWSKIFDRIHANGSFVWPQLWVLG 120

Query: 121 READPLSLARDGLRYDSASDNVWRTXXXXXXXXXXGIEQHGITKDEIKQYIKDYVQGARN 180
           R+A P       LRYDSASD+++               QHGITKDEIKQY+KDY+QGA+N
Sbjct: 121 RQAFPDHWQETCLRYDSASDDLYIDAETEQRAKEAKNPQHGITKDEIKQYVKDYIQGAKN 180

Query: 181 SIKCGADGIEIHAANGYLLNQFLDPVSNKRTDEYGGSIKNRACFTLEVVDALVDAIGEDK 240
           S+  GADG+EIH+AN YLLNQFLDP+SNKRTDEYGGSI+NRA F LEVVDAL+DAIG ++
Sbjct: 181 SVNAGADGVEIHSANSYLLNQFLDPISNKRTDEYGGSIENRARFALEVVDALIDAIGAER 240

Query: 241 VGIRLAPYNTNGDMSGSWDPTVFAHYAYVLGKLEKRAQAGKRLAFVHIFEPRVSNPWDNE 300
           VGIRL+P+   G MSG  DPT+ A +AY++G+LEKRA+ GKR+A++H+ EPRV+ PW+ +
Sbjct: 241 VGIRLSPWGRYGGMSGGSDPTLLAQFAYLVGELEKRAKEGKRIAYIHLVEPRVT-PWNVD 299

Query: 301 GDGAYN-GGTTDYVYSIWKGVVIRTGNLAIHPEIAKEFLKQPNTLLGYGRYFISNPDLVD 359
            D   N  GT D++YSIWKG +IR GN  ++PE   + +    TL+GYGRYFISNPDL D
Sbjct: 300 ADAGSNENGTNDFIYSIWKGPIIRAGNFTLNPEETTKAVSMDRTLIGYGRYFISNPDLAD 359

Query: 360 RLEKGLPLNLYDRPRFYAMPDKGYIDYPTYDEAIK 394
           RLEKG PLN YDR  FY    +GY DYPT +EA K
Sbjct: 360 RLEKGAPLNAYDRDTFYTFSKEGYTDYPTLEEATK 394

>NDAI0A00330 Chr1 (47534..48727) [1194 bp, 397 aa] {ON} 
          Length = 397

 Score =  528 bits (1360), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 253/395 (64%), Positives = 309/395 (78%), Gaps = 2/395 (0%)

Query: 1   MPFNTESKPVALKDTDLFKPLKVGNTTVLNRVVLPPLTRMRAHYPGNVPNRDWTLEYYDQ 60
           M  NT+  P+ L DT LFKPLKVGNTTV +RVV+ PLTRMRAH+PG+VPN+DW  EYYDQ
Sbjct: 1   MVLNTDYTPIPLHDTKLFKPLKVGNTTVEHRVVMAPLTRMRAHFPGHVPNKDWAAEYYDQ 60

Query: 61  RSKRPGTMLITEGVFPSAKAGGYDNAPGIWTEEQMVEWKKIFDKIHENESFVWPQLWVLG 120
           RSKR GTM+ITEGV PS ++GGYDNAPGIW+ EQ+ +W KIFD+IH+N SFVWPQLWVLG
Sbjct: 61  RSKRKGTMIITEGVNPSEQSGGYDNAPGIWSPEQIEQWSKIFDRIHKNGSFVWPQLWVLG 120

Query: 121 READPLSLARDGLRYDSASDNVWRTXXXXXXXXXXGIEQHGITKDEIKQYIKDYVQGARN 180
           R+A P SLARDGLRYDSASDN++               QHGITK EIKQY+KDYVQGA+N
Sbjct: 121 RQAFPDSLARDGLRYDSASDNLYMDDEMKERAIKSNNPQHGITKSEIKQYVKDYVQGAKN 180

Query: 181 SIKCGADGIEIHAANGYLLNQFLDPVSNKRTDEYGGSIKNRACFTLEVVDALVDAIGEDK 240
           +++ GADG+EIH+AN YLLNQFLDP+SN RTDEYGGSI+NRA F LEVVDAL++A+G ++
Sbjct: 181 AVEAGADGVEIHSANSYLLNQFLDPISNHRTDEYGGSIENRARFALEVVDALIEAVGHER 240

Query: 241 VGIRLAPYNTNGDMSGSWDPTVFAHYAYVLGKLEKRAQAGKRLAFVHIFEPRVSNPWDNE 300
           VGIRL+P+   G MSG  DPT+ A Y YV+G+LEKRA+ GKR+A++H+ EPRV++ W +E
Sbjct: 241 VGIRLSPWGRYGGMSGGSDPTLLAQYCYVVGELEKRAKLGKRIAYIHLVEPRVTD-WSDE 299

Query: 301 GDGA-YNGGTTDYVYSIWKGVVIRTGNLAIHPEIAKEFLKQPNTLLGYGRYFISNPDLVD 359
           G     + GT D++YSIWKG VIR G    + +   + +    TL+G GRYFIS PDLVD
Sbjct: 300 GKKVPEDDGTNDFIYSIWKGPVIRAGMFPANADAITKVVANDQTLIGAGRYFISTPDLVD 359

Query: 360 RLEKGLPLNLYDRPRFYAMPDKGYIDYPTYDEAIK 394
           RL+KGLPLN YDR  FY+   +GYID PTYDEAIK
Sbjct: 360 RLDKGLPLNRYDRSSFYSFTAEGYIDLPTYDEAIK 394

>Kpol_370.3 s370 (3999..5201) [1203 bp, 400 aa] {ON} (3999..5201)
           [1203 nt, 401 aa]
          Length = 400

 Score =  525 bits (1352), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 250/398 (62%), Positives = 313/398 (78%), Gaps = 2/398 (0%)

Query: 1   MPFNTESKPVALKDTDLFKPLKVGNTTVLNRVVLPPLTRMRAHYPGNVPNRDWTLEYYDQ 60
           MPF  + KPVAL DT+LFKP+KVGN  + +R+V+PPLTRMRA YPGNVP  D  +EYYDQ
Sbjct: 1   MPFVKDFKPVALGDTNLFKPIKVGNMELKHRIVMPPLTRMRASYPGNVPT-DLMVEYYDQ 59

Query: 61  RSKRPGTMLITEGVFPSAKAGGYDNAPGIWTEEQMVEWKKIFDKIHENESFVWPQLWVLG 120
           RS+R GT ++ EGVFPSA++GGYDNAPG W++EQ+ +WKKIFD +H+N+SF++PQ+WVLG
Sbjct: 60  RSRREGTFIVAEGVFPSAQSGGYDNAPGAWSKEQLDQWKKIFDVVHKNKSFMFPQVWVLG 119

Query: 121 READPLSLARDGLRYDSASDNVWRTXXXXXXXXXXGIEQHGITKDEIKQYIKDYVQGARN 180
           R   P SLARDGLRYDSASD+V+            G  QHGITK EI+QYIKDYVQG++N
Sbjct: 120 RLGFPDSLARDGLRYDSASDDVYLDEEYETKAKSSGNRQHGITKSEIQQYIKDYVQGSKN 179

Query: 181 SIKCGADGIEIHAANGYLLNQFLDPVSNKRTDEYGGSIKNRACFTLEVVDALVDAIGEDK 240
            ++ GADG+EIH+ANGYLLNQFLDPVSNKRTDEYGGSI+NRA FTLEVVDAL++A+G ++
Sbjct: 180 LVEAGADGVEIHSANGYLLNQFLDPVSNKRTDEYGGSIENRARFTLEVVDALIEAVGPER 239

Query: 241 VGIRLAPYNTNGDMSGSWDPTVFAHYAYVLGKLEKRAQAGKRLAFVHIFEPRVSNPWDNE 300
           VGIRL+PY   G MSG  DPT+ A YAYV G++EKRA+ GKR+A++H+ EPRV+N   +E
Sbjct: 240 VGIRLSPYGKYGTMSGDRDPTLLATYAYVAGEIEKRAKNGKRIAYIHLMEPRVANGSFDE 299

Query: 301 GDGAYNGGTTDYVYSIWKGVVIRTGNLAIHPEIAKEFLKQPN-TLLGYGRYFISNPDLVD 359
               +   T +++YSIWKG VIR+G L + P  AK      N TLL +GRYFI+NPDLV 
Sbjct: 300 SLEEFTDNTNEFIYSIWKGPVIRSGTLVMSPLHAKAIANSNNRTLLAHGRYFIANPDLVT 359

Query: 360 RLEKGLPLNLYDRPRFYAMPDKGYIDYPTYDEAIKMGW 397
           R+EKGLP+N YDR  FYA   +GY DYPTY+EA+K+GW
Sbjct: 360 RIEKGLPINKYDRSTFYAPSSEGYTDYPTYEEALKLGW 397

>NCAS0E03890 Chr5 complement(763948..765129) [1182 bp, 393 aa] {ON}
           Anc_5.58
          Length = 393

 Score =  523 bits (1347), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 247/391 (63%), Positives = 306/391 (78%), Gaps = 2/391 (0%)

Query: 1   MPFNTESKPVALKDTDLFKPLKVGNTTVLNRVVLPPLTRMRAHYPGNVPNRDWTLEYYDQ 60
           MP+  + +PVALK+T+LFKP+KVG+T +  R+V+PPLTRMRA +PGNVPN+ W   YY Q
Sbjct: 1   MPYAKDFEPVALKNTNLFKPIKVGDTEMKQRIVMPPLTRMRAEHPGNVPNKKWAYTYYHQ 60

Query: 61  RSKRPGTMLITEGVFPSAKAGGYDNAPGIWTEEQMVEWKKIFDKIHENESFVWPQLWVLG 120
           RS+RPGTM+ITEG F S +AGGYDNAPGIW++EQ+ +W KIF  IH+N+SFVW QLW LG
Sbjct: 61  RSQRPGTMIITEGTFISPQAGGYDNAPGIWSKEQIEQWTKIFQGIHDNKSFVWVQLWALG 120

Query: 121 READPLSLARDGLRYDSASDNVWRTXXXXXXXXXXGIEQHGITKDEIKQYIKDYVQGARN 180
           R + P +LAR+GLRYD+ SD V+            G  QHG+T+ EIKQYIK+YVQ A+N
Sbjct: 121 RASFPDTLARNGLRYDAPSDGVYMDKESEEKAIKSGNLQHGLTQAEIKQYIKEYVQAAKN 180

Query: 181 SIKCGADGIEIHAANGYLLNQFLDPVSNKRTDEYGGSIKNRACFTLEVVDALVDAIGEDK 240
           SI  GA+G+EIHAANGYLLNQFLDP++NKRTDEYGGSI+ RA F LEVVDALV A+G  K
Sbjct: 181 SIAAGANGVEIHAANGYLLNQFLDPIANKRTDEYGGSIEKRARFVLEVVDALVAAVGASK 240

Query: 241 VGIRLAPYNTNGDMSGSWDPTVFAHYAYVLGKLEKRA-QAGKRLAFVHIFEPRVSNPWDN 299
           VGIR +PY     MSG  DPT+ A YAYVLG+LEKRA +  +RLA+VH+ EPRV+NP+  
Sbjct: 241 VGIRFSPYGLFNTMSGGADPTLLAQYAYVLGELEKRAIEKKQRLAYVHLVEPRVTNPFLT 300

Query: 300 EGDGAYNGGTTDYVYSIWKGVVIRTGNLAIHPEIAKEFLKQPN-TLLGYGRYFISNPDLV 358
           EG+G Y  GT D+ YSIWKG +IR GNLA+HP++A + +   + TLL YGRYFI+NPDLV
Sbjct: 301 EGEGEYGDGTNDFAYSIWKGPIIRAGNLALHPDVASQLVNANDRTLLAYGRYFIANPDLV 360

Query: 359 DRLEKGLPLNLYDRPRFYAMPDKGYIDYPTY 389
           DRLE+GLPLN YDR +FY+M  +GYIDYP Y
Sbjct: 361 DRLEQGLPLNKYDRSQFYSMTSEGYIDYPEY 391

>KNAG0G03460 Chr7 (741939..743141) [1203 bp, 400 aa] {ON} 
          Length = 400

 Score =  522 bits (1344), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 240/400 (60%), Positives = 316/400 (79%)

Query: 1   MPFNTESKPVALKDTDLFKPLKVGNTTVLNRVVLPPLTRMRAHYPGNVPNRDWTLEYYDQ 60
           MPF  + KPVAL DT+L +P++VG+  + +R V+PPLTRMRA +PGNVPN+DW  EYY+Q
Sbjct: 1   MPFVKDFKPVALGDTNLLQPIEVGDMQLQHRAVMPPLTRMRAAHPGNVPNKDWAEEYYNQ 60

Query: 61  RSKRPGTMLITEGVFPSAKAGGYDNAPGIWTEEQMVEWKKIFDKIHENESFVWPQLWVLG 120
           RS+ PG+++ITEG F S +AGGYDNAPGIW++EQ+ +W KIF +IH+N+SFV+ QLW LG
Sbjct: 61  RSQYPGSLIITEGTFISPQAGGYDNAPGIWSDEQVAQWTKIFKRIHDNDSFVYVQLWALG 120

Query: 121 READPLSLARDGLRYDSASDNVWRTXXXXXXXXXXGIEQHGITKDEIKQYIKDYVQGARN 180
           R++   +L RDGLRYD+ SD  + +             QHG+TK EIKQYIK+YV+ A N
Sbjct: 121 RQSYADTLGRDGLRYDAPSDGNYMSEEQKERALKANNPQHGLTKGEIKQYIKEYVEAAVN 180

Query: 181 SIKCGADGIEIHAANGYLLNQFLDPVSNKRTDEYGGSIKNRACFTLEVVDALVDAIGEDK 240
           SIK GADG+EIH+ANGYLLNQFLDP +N RTDEYGGS++NRA F LEVVDALV+A+G  K
Sbjct: 181 SIKAGADGVEIHSANGYLLNQFLDPEANMRTDEYGGSVENRARFALEVVDALVEAVGAKK 240

Query: 241 VGIRLAPYNTNGDMSGSWDPTVFAHYAYVLGKLEKRAQAGKRLAFVHIFEPRVSNPWDNE 300
           VGIR +PY T G M+G  +P + A YAY++G+L++RA  G++LA++H+ EPRV++P+  E
Sbjct: 241 VGIRFSPYGTFGTMAGGKNPLIVAQYAYIVGELQRRANEGQQLAYIHLVEPRVTDPFLTE 300

Query: 301 GDGAYNGGTTDYVYSIWKGVVIRTGNLAIHPEIAKEFLKQPNTLLGYGRYFISNPDLVDR 360
           G+GAYN GT D+VYSIW G +IR GNLA+HP++A E LK   TL+GYGR++I+NPDLV R
Sbjct: 301 GEGAYNLGTNDFVYSIWTGPIIRAGNLALHPDVAIEMLKDNRTLIGYGRFWIANPDLVRR 360

Query: 361 LEKGLPLNLYDRPRFYAMPDKGYIDYPTYDEAIKMGWGEK 400
           L+ GLPLN YDR  FY M D+GY+DYPTY+EA+K+GW ++
Sbjct: 361 LKDGLPLNKYDRDTFYRMSDEGYLDYPTYEEALKLGWDKQ 400

>ZYRO0C11902g Chr3 (931466..932668) [1203 bp, 400 aa] {ON} highly
           similar to uniprot|Q03558 Saccharomyces cerevisiae
           YHR179W OYE2 Widely conserved NADPH oxidoreductase
           containing flavin mononucleotide (FMN) homologous to
           Oye3p with slight differences in ligand binding and
           catalytic properties may be involved in sterol
           metabolism
          Length = 400

 Score =  520 bits (1338), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 239/395 (60%), Positives = 313/395 (79%), Gaps = 2/395 (0%)

Query: 3   FNTESKPVALKDTDLFKPLKVGNTTVLNRVVLPPLTRMRAHYPGNVPNRDWTLEYYDQRS 62
           F++  KP AL DT+LFKP+KVG+  + +RVV+PPLTRMRA    NVP++ W  +YY QR+
Sbjct: 6   FDSRVKPQALGDTNLFKPIKVGDVELAHRVVMPPLTRMRAT--KNVPSKQWAPDYYAQRA 63

Query: 63  KRPGTMLITEGVFPSAKAGGYDNAPGIWTEEQMVEWKKIFDKIHENESFVWPQLWVLGRE 122
           +RPGT++ITE  FP+ + GGYD+APG+W++EQ+  WK+IF++IHE +SFV+ QLW LGR+
Sbjct: 64  QRPGTLIITEASFPAPRFGGYDDAPGLWSKEQLDIWKEIFNRIHEKKSFVYVQLWNLGRQ 123

Query: 123 ADPLSLARDGLRYDSASDNVWRTXXXXXXXXXXGIEQHGITKDEIKQYIKDYVQGARNSI 182
           ADP  LARDGL Y SASD V+ +             QHG+TKDEIK+Y+K++VQ A+NS+
Sbjct: 124 ADPAPLARDGLPYVSASDGVYMSKEQEENAIKANNPQHGLTKDEIKEYVKEFVQAAKNSL 183

Query: 183 KCGADGIEIHAANGYLLNQFLDPVSNKRTDEYGGSIKNRACFTLEVVDALVDAIGEDKVG 242
           + GADG+EIH+ANGYLLNQFLDP+SNKRTDEYGGSI+NRA FTLEVVDA+V+A+G  KVG
Sbjct: 184 EAGADGVEIHSANGYLLNQFLDPMSNKRTDEYGGSIENRARFTLEVVDAIVEAVGASKVG 243

Query: 243 IRLAPYNTNGDMSGSWDPTVFAHYAYVLGKLEKRAQAGKRLAFVHIFEPRVSNPWDNEGD 302
           IRL+PY   G MSG  +P + A YAYV+G+LE+RA+ GKRL+F+H+ EPRV+NP++ EG+
Sbjct: 244 IRLSPYGVFGTMSGGQEPEIVAQYAYVVGELERRAKEGKRLSFIHLVEPRVTNPFNPEGE 303

Query: 303 GAYNGGTTDYVYSIWKGVVIRTGNLAIHPEIAKEFLKQPNTLLGYGRYFISNPDLVDRLE 362
           G Y  G+ D+VYSIWKG V+R G+LA+HPEI K+ +K   TL+ YGR+FISNPD+VDR+E
Sbjct: 304 GVYTEGSNDFVYSIWKGAVVRAGDLALHPEIVKDMVKDNRTLIAYGRFFISNPDIVDRVE 363

Query: 363 KGLPLNLYDRPRFYAMPDKGYIDYPTYDEAIKMGW 397
           KGLPL  YDR  FYA   +GY+DYP YDE +K G+
Sbjct: 364 KGLPLTAYDRNTFYAPTSEGYLDYPNYDECVKQGY 398

>KAFR0F03540 Chr6 (703965..705167) [1203 bp, 400 aa] {ON} 
          Length = 400

 Score =  517 bits (1332), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 245/400 (61%), Positives = 313/400 (78%)

Query: 1   MPFNTESKPVALKDTDLFKPLKVGNTTVLNRVVLPPLTRMRAHYPGNVPNRDWTLEYYDQ 60
           MPF  + KPVALKDTDLFKPLKVGN  + +R  LPPLTR RA +PGNVPN D   EYYDQ
Sbjct: 1   MPFKKDFKPVALKDTDLFKPLKVGNMQLQHRAALPPLTRYRALHPGNVPNTDLVPEYYDQ 60

Query: 61  RSKRPGTMLITEGVFPSAKAGGYDNAPGIWTEEQMVEWKKIFDKIHENESFVWPQLWVLG 120
           RSKRPG++LITE  F S +AGGYD APG+W++EQ+  WK +F +IH+N S+V+ QLW LG
Sbjct: 61  RSKRPGSLLITEAAFISPQAGGYDFAPGMWSDEQVAAWKHVFKRIHDNNSYVFVQLWNLG 120

Query: 121 READPLSLARDGLRYDSASDNVWRTXXXXXXXXXXGIEQHGITKDEIKQYIKDYVQGARN 180
           R+  P ++ RDGLRYDSA+D+++ +          GI+QHGITKDEIKQYIKDYV  A+N
Sbjct: 121 RQTSPANMVRDGLRYDSATDDLYMSEEAKQQAEKAGIKQHGITKDEIKQYIKDYVHAAKN 180

Query: 181 SIKCGADGIEIHAANGYLLNQFLDPVSNKRTDEYGGSIKNRACFTLEVVDALVDAIGEDK 240
           +I  GADG+EIH+ANGYLLNQF+DP+SN RTDEYGGSI+NRA F+LEVVDAL++AIG ++
Sbjct: 181 AIAAGADGVEIHSANGYLLNQFIDPISNNRTDEYGGSIENRARFSLEVVDALIEAIGAER 240

Query: 241 VGIRLAPYNTNGDMSGSWDPTVFAHYAYVLGKLEKRAQAGKRLAFVHIFEPRVSNPWDNE 300
           V IRL+PY   G MSGS +P + A Y+Y+LG+LEKRA+AG+R+A+VH  EPRV++    E
Sbjct: 241 VAIRLSPYGRFGGMSGSTNPIIIAQYSYILGELEKRAKAGRRIAYVHTIEPRVTDSSLPE 300

Query: 301 GDGAYNGGTTDYVYSIWKGVVIRTGNLAIHPEIAKEFLKQPNTLLGYGRYFISNPDLVDR 360
            +G  N G+  + YSIWKG ++R GN A+HP++AKE +    T++ YGRY+I+NPD+VDR
Sbjct: 301 EEGVDNEGSNAFFYSIWKGPLVRAGNFALHPDLAKEAVSSDKTIIAYGRYWIANPDIVDR 360

Query: 361 LEKGLPLNLYDRPRFYAMPDKGYIDYPTYDEAIKMGWGEK 400
           LEKGLPLN YDR  FY    +GY+DYPTYDEAIK+GW ++
Sbjct: 361 LEKGLPLNAYDRNTFYTTKSEGYLDYPTYDEAIKLGWDKQ 400

>KLLA0A09075g Chr1 complement(792171..793367) [1197 bp, 398 aa] {ON}
           uniprot|P40952 Kluyveromyces lactis KLLA0A09075g KYE1
           NADPH dehydrogenase 1
          Length = 398

 Score =  514 bits (1323), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 253/395 (64%), Positives = 310/395 (78%), Gaps = 2/395 (0%)

Query: 3   FNTESKPVALKDTDLFKPLKVGNTTVLNRVVLPPLTRMRAHYPGNVPNRDWTLEYYDQRS 62
            N E KP+A  DTD+FKP+K+GNT + +RVV+P LTRMRA +PGNVPN DW +EYY QRS
Sbjct: 4   MNFEPKPLA--DTDIFKPIKIGNTELKHRVVMPALTRMRALHPGNVPNPDWAVEYYRQRS 61

Query: 63  KRPGTMLITEGVFPSAKAGGYDNAPGIWTEEQMVEWKKIFDKIHENESFVWPQLWVLGRE 122
           + PGTM+ITEG FPSA++GGYDNAPG+W+EEQ+ +W+KIF  IH+N+SFVW QLWVLGR+
Sbjct: 62  QYPGTMIITEGAFPSAQSGGYDNAPGVWSEEQLAQWRKIFKAIHDNKSFVWVQLWVLGRQ 121

Query: 123 ADPLSLARDGLRYDSASDNVWRTXXXXXXXXXXGIEQHGITKDEIKQYIKDYVQGARNSI 182
           A   +LARDGLRYDSASD V+               QHGITKDEIKQYI+DYV  A+  I
Sbjct: 122 AFADNLARDGLRYDSASDEVYMGEDEKERAIRSNNPQHGITKDEIKQYIRDYVDAAKKCI 181

Query: 183 KCGADGIEIHAANGYLLNQFLDPVSNKRTDEYGGSIKNRACFTLEVVDALVDAIGEDKVG 242
             GADG+EIH+ANGYLLNQFLDP+SNKRTDEYGGSI+NRA F LEVVDA+VDA+G ++  
Sbjct: 182 DAGADGVEIHSANGYLLNQFLDPISNKRTDEYGGSIENRARFVLEVVDAVVDAVGAERTS 241

Query: 243 IRLAPYNTNGDMSGSWDPTVFAHYAYVLGKLEKRAQAGKRLAFVHIFEPRVSNPWDNEGD 302
           IR +PY   G MSG  DP + A +AYVL +LEKRA+AGKRLA+V + EPRV++P+  E +
Sbjct: 242 IRFSPYGVFGTMSGGSDPVLVAQFAYVLAELEKRAKAGKRLAYVDLVEPRVTSPFQPEFE 301

Query: 303 GAYNGGTTDYVYSIWKGVVIRTGNLAIHPEIAKEFLKQPNTLLGYGRYFISNPDLVDRLE 362
           G Y GGT ++VYS+WKG V+R GN A+ P+ A    K PNTL+GYGR FI+NPDLV+RLE
Sbjct: 302 GWYKGGTNEFVYSVWKGNVLRVGNYALDPDAAITDSKNPNTLIGYGRAFIANPDLVERLE 361

Query: 363 KGLPLNLYDRPRFYAMPDKGYIDYPTYDEAIKMGW 397
           KGLPLN YDRP FY M  +GYIDYPTY+EA+  G+
Sbjct: 362 KGLPLNQYDRPSFYKMSAEGYIDYPTYEEAVAKGY 396

>Suva_16.139 Chr16 complement(235387..236562) [1176 bp, 391 aa] {ON}
           YPL171C (REAL)
          Length = 391

 Score =  512 bits (1318), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 240/397 (60%), Positives = 306/397 (77%), Gaps = 9/397 (2%)

Query: 1   MPFNTESKPVALKDTDLFKPLKVGNTTVLNRVVLPPLTRMRAHYPGNVPNRDWTLEYYDQ 60
           MPF  + +PV+L++T+LFKP+K+GNT + +RVV     RMRA +PGNVPN++W  EYY Q
Sbjct: 1   MPFVKDFEPVSLENTNLFKPIKLGNTELPHRVV-----RMRASHPGNVPNKEWAAEYYAQ 55

Query: 61  RSKRPGTMLITEGVFPSAKAGGYDNAPGIWTEEQMVEWKKIFDKIHENESFVWPQLWVLG 120
           R++RPGTM+ITEG F S +AGGYDNAPGIW++EQ+ +W+KI   IHE +SF W QLW LG
Sbjct: 56  RAQRPGTMIITEGAFISPQAGGYDNAPGIWSDEQVAQWRKILQAIHEKKSFAWVQLWALG 115

Query: 121 READPLSLARDGLRYDSASDNVWRTXXXXXXXXXXGIEQHGITKDEIKQYIKDYVQGARN 180
             + P ++ARDGLRYDSASD V+             +  H +TKD+I+QY+K+YV   +N
Sbjct: 116 WASFPDAMARDGLRYDSASDAVYMEGTAKAAK----VPGHSLTKDDIEQYVKEYVHAGKN 171

Query: 181 SIKCGADGIEIHAANGYLLNQFLDPVSNKRTDEYGGSIKNRACFTLEVVDALVDAIGEDK 240
           ++  GADG+EIH+ANGYLLNQFLDP SN R DEYGGSI+NRA FTL+VVDA+ DAIG D+
Sbjct: 172 AVLAGADGVEIHSANGYLLNQFLDPRSNTRNDEYGGSIENRARFTLQVVDAVADAIGHDR 231

Query: 241 VGIRLAPYNTNGDMSGSWDPTVFAHYAYVLGKLEKRAQAGKRLAFVHIFEPRVSNPWDNE 300
           VG+RL+PY T  DMSG  +P + A YAYVLG+LEKRA+AGKRLA+VH+ EPRV+NP  +E
Sbjct: 232 VGLRLSPYGTFNDMSGGAEPDIVAQYAYVLGELEKRAKAGKRLAYVHLVEPRVTNPLLDE 291

Query: 301 GDGAYNGGTTDYVYSIWKGVVIRTGNLAIHPEIAKEFLKQPNTLLGYGRYFISNPDLVDR 360
           G+G Y+ G+ D+ YSIWKG +I+ GN A+HP   KE +K   TL+ YGR+FISNPDLVDR
Sbjct: 292 GEGEYDKGSNDFAYSIWKGPIIKAGNFALHPNSVKEEVKCDRTLIAYGRFFISNPDLVDR 351

Query: 361 LEKGLPLNLYDRPRFYAMPDKGYIDYPTYDEAIKMGW 397
           LEKGLPLN YDR  FY M  +GY DYPTYDE++ +GW
Sbjct: 352 LEKGLPLNKYDRATFYTMSAQGYTDYPTYDESVDLGW 388

>TBLA0D00160 Chr4 complement(36313..37569) [1257 bp, 418 aa] {ON} 
          Length = 418

 Score =  508 bits (1307), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 241/394 (61%), Positives = 300/394 (76%)

Query: 1   MPFNTESKPVALKDTDLFKPLKVGNTTVLNRVVLPPLTRMRAHYPGNVPNRDWTLEYYDQ 60
           MPF  E KPVAL D +LFKP+KVGN  + +R V PPLTR RA +P  V +++WT +YYDQ
Sbjct: 1   MPFVEEFKPVALGDANLFKPIKVGNNELKHRAVFPPLTRRRAQHPDYVSHKEWTAKYYDQ 60

Query: 61  RSKRPGTMLITEGVFPSAKAGGYDNAPGIWTEEQMVEWKKIFDKIHENESFVWPQLWVLG 120
           RS+R G +LITE  F S +AGG DN P IW++EQ+ EW+K+F  +H+N+SF+WPQLW LG
Sbjct: 61  RSRREGILLITEAAFISRQAGGDDNVPVIWSKEQIAEWEKVFAAVHKNKSFIWPQLWALG 120

Query: 121 READPLSLARDGLRYDSASDNVWRTXXXXXXXXXXGIEQHGITKDEIKQYIKDYVQGARN 180
             AD   +ARDGLRYD A+D+V+             ++ HG+TKD++KQYIKDYV  A+N
Sbjct: 121 WAADAKLMARDGLRYDGATDDVYGNDIHGEIAKENKVKIHGLTKDDMKQYIKDYVAAAKN 180

Query: 181 SIKCGADGIEIHAANGYLLNQFLDPVSNKRTDEYGGSIKNRACFTLEVVDALVDAIGEDK 240
            I  GADG+EIH+ANGYLLNQFLD  SNKRTDEYGGSI+NRA FTLEVVDAL++A G DK
Sbjct: 181 CIAAGADGVEIHSANGYLLNQFLDINSNKRTDEYGGSIENRARFTLEVVDALIEAFGADK 240

Query: 241 VGIRLAPYNTNGDMSGSWDPTVFAHYAYVLGKLEKRAQAGKRLAFVHIFEPRVSNPWDNE 300
           + IRL+PY    D+SG  +P   A YAYV+G+LEKRAQAG RLAF+ + EPRV++P   E
Sbjct: 241 LSIRLSPYGVFNDISGGSNPLTVAQYAYVVGELEKRAQAGNRLAFIDLVEPRVTSPVLPE 300

Query: 301 GDGAYNGGTTDYVYSIWKGVVIRTGNLAIHPEIAKEFLKQPNTLLGYGRYFISNPDLVDR 360
           G+G Y  GT +++YSIWKGV+IR GNLA HPE+AKEFLK   TLL YGR +ISNPD+VDR
Sbjct: 301 GEGEYTEGTNEFIYSIWKGVIIRAGNLAYHPEVAKEFLKDDRTLLAYGRIWISNPDIVDR 360

Query: 361 LEKGLPLNLYDRPRFYAMPDKGYIDYPTYDEAIK 394
           LEKGLP N Y+R  FY M ++GY+DYPT DEA+K
Sbjct: 361 LEKGLPSNKYNRDTFYTMSEEGYLDYPTCDEAVK 394

>NDAI0E01890 Chr5 complement(384211..385410) [1200 bp, 399 aa] {ON} 
          Length = 399

 Score =  505 bits (1301), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 239/395 (60%), Positives = 300/395 (75%)

Query: 1   MPFNTESKPVALKDTDLFKPLKVGNTTVLNRVVLPPLTRMRAHYPGNVPNRDWTLEYYDQ 60
           MP   +  PV L +TDLFK LKVGNTTV +RVV+ PLTRMRAH PG++PN+DW + YYDQ
Sbjct: 1   MPLVKDYTPVPLANTDLFKALKVGNTTVEHRVVMAPLTRMRAHAPGHIPNKDWEVVYYDQ 60

Query: 61  RSKRPGTMLITEGVFPSAKAGGYDNAPGIWTEEQMVEWKKIFDKIHENESFVWPQLWVLG 120
           RSKR GTM+ITE V PSA++ G DNAPGIWT EQ+ +W KIF+KIHEN SFVW QL   G
Sbjct: 61  RSKRKGTMIITEAVSPSAQSSGIDNAPGIWTPEQIEQWTKIFNKIHENGSFVWVQLCATG 120

Query: 121 READPLSLARDGLRYDSASDNVWRTXXXXXXXXXXGIEQHGITKDEIKQYIKDYVQGARN 180
           R+A P ++ARDGLRYDSASDN++               QHGITKDEIKQYIKD+VQG +N
Sbjct: 121 RQAFPDAMARDGLRYDSASDNLYMDDELKERAIKSNNPQHGITKDEIKQYIKDFVQGTKN 180

Query: 181 SIKCGADGIEIHAANGYLLNQFLDPVSNKRTDEYGGSIKNRACFTLEVVDALVDAIGEDK 240
           +++ GADG+EIH+ NG LLNQFLDP SN RTDEYGGSI+NR+ FTLEV+DAL++A+G ++
Sbjct: 181 AVEAGADGVEIHSCNGCLLNQFLDPTSNHRTDEYGGSIENRSRFTLEVIDALIEAVGPER 240

Query: 241 VGIRLAPYNTNGDMSGSWDPTVFAHYAYVLGKLEKRAQAGKRLAFVHIFEPRVSNPWDNE 300
           VGIRL+P+N    MSGS DPT+ + Y YV+G+LEKRA+AGKR+AF+H+ EPRV++ + + 
Sbjct: 241 VGIRLSPWNRYAGMSGSADPTLLSQYCYVVGELEKRAKAGKRIAFIHLIEPRVTDIFFDC 300

Query: 301 GDGAYNGGTTDYVYSIWKGVVIRTGNLAIHPEIAKEFLKQPNTLLGYGRYFISNPDLVDR 360
                + GT D++YSIWKGVVIR G     P+  K  +    T++  GRYFIS PDLVDR
Sbjct: 301 TAVPEDDGTNDFIYSIWKGVVIRAGMFPSRPDSIKAAVANDQTMIAAGRYFISTPDLVDR 360

Query: 361 LEKGLPLNLYDRPRFYAMPDKGYIDYPTYDEAIKM 395
           LEKG PLN YDR  FY+   +G+ DYPTY+EA+K+
Sbjct: 361 LEKGQPLNKYDRSTFYSFTKEGFTDYPTYEEAVKL 395

>TDEL0E00270 Chr5 (60549..61757) [1209 bp, 402 aa] {ON} 
          Length = 402

 Score =  503 bits (1295), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 239/382 (62%), Positives = 294/382 (76%)

Query: 11  ALKDTDLFKPLKVGNTTVLNRVVLPPLTRMRAHYPGNVPNRDWTLEYYDQRSKRPGTMLI 70
           AL +T+LFK LKVG + + +R VL PLTRMRA YPGNVPN     EYY+QRS+RPGT++I
Sbjct: 17  ALNETNLFKSLKVGKSELQHRAVLAPLTRMRALYPGNVPNGKLAGEYYEQRSRRPGTLII 76

Query: 71  TEGVFPSAKAGGYDNAPGIWTEEQMVEWKKIFDKIHENESFVWPQLWVLGREADPLSLAR 130
           TEG F SA++GGYDNAPGIW++EQ+ EWK IF KIH+N+SFV+ QLWVLGR+A   SLAR
Sbjct: 77  TEGTFTSAQSGGYDNAPGIWSQEQITEWKGIFSKIHKNKSFVYLQLWVLGRQAYADSLAR 136

Query: 131 DGLRYDSASDNVWRTXXXXXXXXXXGIEQHGITKDEIKQYIKDYVQGARNSIKCGADGIE 190
           DGLRYDSASD V+               QHG+T DEIKQY++DYVQ ARN+I+ GADG+E
Sbjct: 137 DGLRYDSASDGVYMDEELKEKALKSNNPQHGLTNDEIKQYVEDYVQAARNAIEAGADGVE 196

Query: 191 IHAANGYLLNQFLDPVSNKRTDEYGGSIKNRACFTLEVVDALVDAIGEDKVGIRLAPYNT 250
           IH+ANGYLLNQFLDP+SNKR DEYGGSI+NRA FTLEVVDAL++A+G DKV IR +PY T
Sbjct: 197 IHSANGYLLNQFLDPISNKRADEYGGSIENRARFTLEVVDALIEAVGHDKVAIRFSPYGT 256

Query: 251 NGDMSGSWDPTVFAHYAYVLGKLEKRAQAGKRLAFVHIFEPRVSNPWDNEGDGAYNGGTT 310
            G MSG  D  + A YAYV+G+LE+RA  G+RLA++H+ EPRV++P   EG  AY  GT 
Sbjct: 257 FGGMSGGRDLGLVAQYAYVIGELERRANQGRRLAYIHLVEPRVTSPEFTEGQNAYLDGTN 316

Query: 311 DYVYSIWKGVVIRTGNLAIHPEIAKEFLKQPNTLLGYGRYFISNPDLVDRLEKGLPLNLY 370
           D+  SIWKG +IR GNLA+HPE+ +E ++   TL+ YGR FI+NPDL DR+ KGLPLN Y
Sbjct: 317 DFALSIWKGPIIRAGNLALHPEVVREMIEDDRTLIAYGRLFIANPDLPDRIAKGLPLNPY 376

Query: 371 DRPRFYAMPDKGYIDYPTYDEA 392
           DR  FY    +GYIDYP Y ++
Sbjct: 377 DRNTFYFPGSEGYIDYPFYKDS 398

>KNAG0B05410 Chr2 complement(1046164..1047360) [1197 bp, 398 aa]
           {ON} 
          Length = 398

 Score =  499 bits (1286), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 241/397 (60%), Positives = 298/397 (75%), Gaps = 1/397 (0%)

Query: 1   MPFNTESKPVALKDTDLFKPLKVGNTTVLNRVVLPPLTRMRAHYPGNVPNRDWTLEYYDQ 60
           M F T   PVALKD +LFKP+KVG   + +RVV+ PLTRMRA +P ++PN + T  YYDQ
Sbjct: 1   MSFQTNFTPVALKDANLFKPIKVGAMELDHRVVMAPLTRMRALHPNHIPNEELTPLYYDQ 60

Query: 61  RSKRPGTMLITEGVFPSAKAGGYDNAPGIWTEEQMVEWKKIFDKIHENESFVWPQLWVLG 120
           RSK PGT++ITE  F SA+AGGYDNAPGIW+EEQ+  WKKIF KIH N SFV+ QLW LG
Sbjct: 61  RSKAPGTLIITEATFISAQAGGYDNAPGIWSEEQVAVWKKIFAKIHGNNSFVFVQLWNLG 120

Query: 121 READPLSLARDGLRYDSASDNVWRTXXXXXXXXXXGIEQHGITKDEIKQYIKDYVQGARN 180
           R+A P ++ARDGLRYDSASD+++            GI+QHGITK EIKQYI +YV  A+N
Sbjct: 121 RQAIPSAMARDGLRYDSASDDLYIDEETKKAAFDAGIKQHGITKSEIKQYIAEYVHAAKN 180

Query: 181 SIKCGADGIEIHAANGYLLNQFLDPVSNKRTDEYGGSIKNRACFTLEVVDALVDAIGEDK 240
           SI+ GADG+EIH+AN Y+LNQFLDP+SN RTDEYGGSI+NRA F+LEVVDAL++AIG ++
Sbjct: 181 SIEAGADGVEIHSANSYILNQFLDPISNHRTDEYGGSIENRARFSLEVVDALINAIGAER 240

Query: 241 VGIRLAPYNTNGDMSGSWDPTVFAHYAYVLGKLEKRAQAGKRLAFVHIFEPRVSNPWDNE 300
           VGIR +P+   G MSGS DP V+  Y+Y+L +LE RAQ G RLA+VH+ EPRV+N    E
Sbjct: 241 VGIRFSPFGKYGGMSGSDDPQVYELYSYLLDQLESRAQFGNRLAYVHLMEPRVTNASLEE 300

Query: 301 GDGAYNGGTTDYVYSIWKGVVIRTGNLAIHPEIAKEFLKQPNTLLGYGRYFISNPDLVDR 360
           G G     + D+ Y  WKG++IR+GN AI+P+I K  +    TL+ YGRYFIS PDL  R
Sbjct: 301 GQGEDLEHSNDFAYEHWKGLIIRSGNFAINPDITKRVVDD-RTLIAYGRYFISTPDLPHR 359

Query: 361 LEKGLPLNLYDRPRFYAMPDKGYIDYPTYDEAIKMGW 397
           L +GLPLN YDRP FYA    GY DYPTY+EA+K+GW
Sbjct: 360 LAEGLPLNKYDRPTFYAPSAVGYTDYPTYEEALKLGW 396

>KNAG0L00690 Chr12 complement(110526..111722) [1197 bp, 398 aa] {ON}
           
          Length = 398

 Score =  495 bits (1275), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 240/397 (60%), Positives = 296/397 (74%), Gaps = 1/397 (0%)

Query: 1   MPFNTESKPVALKDTDLFKPLKVGNTTVLNRVVLPPLTRMRAHYPGNVPNRDWTLEYYDQ 60
           M F T   PVALKD +LFKP+KVG   + +RVV+ PLTRMRA +P ++PN + T  YYDQ
Sbjct: 1   MSFQTNFTPVALKDANLFKPIKVGAMELDHRVVMAPLTRMRALHPNHIPNEELTPLYYDQ 60

Query: 61  RSKRPGTMLITEGVFPSAKAGGYDNAPGIWTEEQMVEWKKIFDKIHENESFVWPQLWVLG 120
           RSK PGT++ITE  F SA+AGGYDNAPGIW+EEQ+  WKKIF KIH N SFV+ QLW LG
Sbjct: 61  RSKAPGTLIITEATFISAQAGGYDNAPGIWSEEQVAVWKKIFAKIHGNNSFVFVQLWNLG 120

Query: 121 READPLSLARDGLRYDSASDNVWRTXXXXXXXXXXGIEQHGITKDEIKQYIKDYVQGARN 180
           R+A P ++ARDGLRYDSASD+++            GI+QHGITK EIKQYI +YV  A+N
Sbjct: 121 RQAIPSAMARDGLRYDSASDDLYIDEETKKAAFDAGIKQHGITKSEIKQYIAEYVHAAKN 180

Query: 181 SIKCGADGIEIHAANGYLLNQFLDPVSNKRTDEYGGSIKNRACFTLEVVDALVDAIGEDK 240
           SI+ GADG+EIH+AN Y+LNQFLDP+SN RTDEYGGSI+NRA F+LEVVDAL++AIG ++
Sbjct: 181 SIEAGADGVEIHSANSYILNQFLDPISNHRTDEYGGSIENRARFSLEVVDALINAIGAER 240

Query: 241 VGIRLAPYNTNGDMSGSWDPTVFAHYAYVLGKLEKRAQAGKRLAFVHIFEPRVSNPWDNE 300
           VGIR +P+   G MSGS DP V+  Y+Y+L +LE RAQ G RLA+VH+ EPRV+N    E
Sbjct: 241 VGIRFSPFGKYGGMSGSDDPQVYELYSYLLDQLESRAQFGNRLAYVHLMEPRVTNASLEE 300

Query: 301 GDGAYNGGTTDYVYSIWKGVVIRTGNLAIHPEIAKEFLKQPNTLLGYGRYFISNPDLVDR 360
           G G     + D+ Y  WKG +IR+G  AI+P+I K  +    TL+ YGRYFIS PDL  R
Sbjct: 301 GQGEDLEHSNDFAYEHWKGPIIRSGTFAINPDITKRVVDD-RTLIAYGRYFISTPDLPHR 359

Query: 361 LEKGLPLNLYDRPRFYAMPDKGYIDYPTYDEAIKMGW 397
           L +GLPLN YDRP FYA    GY DYPTY+EA+K+GW
Sbjct: 360 LAEGLPLNKYDRPTFYAPSAVGYTDYPTYEEALKLGW 396

>KAFR0F03550 Chr6 (706557..707759) [1203 bp, 400 aa] {ON} 
          Length = 400

 Score =  494 bits (1272), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 237/400 (59%), Positives = 306/400 (76%)

Query: 1   MPFNTESKPVALKDTDLFKPLKVGNTTVLNRVVLPPLTRMRAHYPGNVPNRDWTLEYYDQ 60
           MPF  +  PV LKD+ LFKP+KVGN  V +R V+PPLTR RA  PG VPN +    YYDQ
Sbjct: 1   MPFIKDYTPVDLKDSLLFKPMKVGNVEVQHRAVMPPLTRFRAQEPGAVPNAELMSVYYDQ 60

Query: 61  RSKRPGTMLITEGVFPSAKAGGYDNAPGIWTEEQMVEWKKIFDKIHENESFVWPQLWVLG 120
           RS+RPGT++ITEGVF S +AGGYD APG+W++EQ+ EWKKIF KIH N+SFV+ QLW LG
Sbjct: 61  RSQRPGTLIITEGVFISRQAGGYDYAPGLWSQEQVNEWKKIFAKIHNNKSFVFAQLWNLG 120

Query: 121 READPLSLARDGLRYDSASDNVWRTXXXXXXXXXXGIEQHGITKDEIKQYIKDYVQGARN 180
           R+A P  +ARDGLR+DSA+D+++            GI+QHGIT +EIKQYIK+YV  A+N
Sbjct: 121 RQAAPEWMARDGLRFDSATDDLYINDEIKEKAEKAGIKQHGITAEEIKQYIKEYVIAAKN 180

Query: 181 SIKCGADGIEIHAANGYLLNQFLDPVSNKRTDEYGGSIKNRACFTLEVVDALVDAIGEDK 240
           +I  GADG+E+H ANGYLLNQF+DP+SN RTD YGGSI+NRA F LEV+DA+++A+G +K
Sbjct: 181 AIAAGADGVEVHCANGYLLNQFIDPLSNNRTDAYGGSIENRARFPLEVIDAVIEAVGAEK 240

Query: 241 VGIRLAPYNTNGDMSGSWDPTVFAHYAYVLGKLEKRAQAGKRLAFVHIFEPRVSNPWDNE 300
           VG+R +P+ T G MSGS +P + A YAY++G+LEKRA+AGKR+A++H+ EP VS+   +E
Sbjct: 241 VGVRFSPFGTYGTMSGSENPVILAQYAYLIGELEKRAKAGKRMAYIHLVEPAVSDFLLDE 300

Query: 301 GDGAYNGGTTDYVYSIWKGVVIRTGNLAIHPEIAKEFLKQPNTLLGYGRYFISNPDLVDR 360
           G G  NG + D+ YSIWKG +IR G+ A+ P  AKE +    TL+GYGR+FI+NPDLVDR
Sbjct: 301 GQGQDNGSSNDFAYSIWKGPIIRAGDFALRPAAAKEAVSADRTLVGYGRFFIANPDLVDR 360

Query: 361 LEKGLPLNLYDRPRFYAMPDKGYIDYPTYDEAIKMGWGEK 400
           LEKGL LN YD+  FY    +GY DYPTY EA+K+GW ++
Sbjct: 361 LEKGLQLNQYDKSTFYIQTAEGYTDYPTYAEAVKLGWDKQ 400

>TPHA0H02440 Chr8 complement(575387..576580) [1194 bp, 397 aa] {ON} 
          Length = 397

 Score =  493 bits (1269), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 237/397 (59%), Positives = 305/397 (76%), Gaps = 1/397 (0%)

Query: 1   MPFNTESKPVALKDTDLFKPLKVGNTTVLNRVVLPPLTRMRAHYPGNVPNRDWTLEYYDQ 60
           M F +  KP AL +T+LFKP+K+GNTTV +RVV+PPL+RMRA+   +V ++DWT++YYDQ
Sbjct: 1   MNFVSGFKPEALGNTNLFKPMKIGNTTVKHRVVMPPLSRMRAN-EDHVLDKDWTIKYYDQ 59

Query: 61  RSKRPGTMLITEGVFPSAKAGGYDNAPGIWTEEQMVEWKKIFDKIHENESFVWPQLWVLG 120
           RSKR GTM+I EG FPSA+ GGY  APGIW+ EQ  +WKKI  K+H+N+SF+W QLWVLG
Sbjct: 60  RSKREGTMIIAEGAFPSAQCGGYAGAPGIWSAEQTAQWKKIIQKVHDNKSFMWVQLWVLG 119

Query: 121 READPLSLARDGLRYDSASDNVWRTXXXXXXXXXXGIEQHGITKDEIKQYIKDYVQGARN 180
           R+A P ++A  GLR+DS SD  ++           G  QHGITKDEIKQY+ DYV  A N
Sbjct: 120 RQAPPANMASAGLRFDSPSDLPYQNEKQEAAAKEAGTVQHGITKDEIKQYVADYVNAANN 179

Query: 181 SIKCGADGIEIHAANGYLLNQFLDPVSNKRTDEYGGSIKNRACFTLEVVDALVDAIGEDK 240
           +I  GA+G+EIH ANGYLLNQFLDP SNKRTDEYGGSI+NRA F LEVVDA++ AIG +K
Sbjct: 180 AIAAGAEGVEIHCANGYLLNQFLDPKSNKRTDEYGGSIENRARFPLEVVDAVIAAIGAEK 239

Query: 241 VGIRLAPYNTNGDMSGSWDPTVFAHYAYVLGKLEKRAQAGKRLAFVHIFEPRVSNPWDNE 300
           VGIR +PY   GDMSG  +P + + ++Y++G+LE+R + GKR+A+VH+ EP  ++    E
Sbjct: 240 VGIRFSPYGIFGDMSGGDNPMLISQFSYIIGELERRGKEGKRIAYVHVVEPLATDFMLTE 299

Query: 301 GDGAYNGGTTDYVYSIWKGVVIRTGNLAIHPEIAKEFLKQPNTLLGYGRYFISNPDLVDR 360
           GDG   G T D+V+SIWKG +IR GNL+++P I +E++K   TL+ YGRYF+SNPD+VDR
Sbjct: 300 GDGILEGVTNDFVFSIWKGPIIRAGNLSLNPAIVREYVKDDRTLIAYGRYFVSNPDIVDR 359

Query: 361 LEKGLPLNLYDRPRFYAMPDKGYIDYPTYDEAIKMGW 397
           +EKGLPLN YD+P FY M  +GYIDYPTYDEAIK G+
Sbjct: 360 VEKGLPLNNYDQPHFYTMTAEGYIDYPTYDEAIKAGY 396

>TBLA0B02130 Chr2 (488878..490074) [1197 bp, 398 aa] {ON} 
          Length = 398

 Score =  493 bits (1268), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 231/397 (58%), Positives = 301/397 (75%), Gaps = 1/397 (0%)

Query: 1   MPFNTESKPVALKDTDLFKPLKVGNTTVLNRVVLPPLTRMRAHYPGNVPNRDWTLEYYDQ 60
           MPF    KPV LK+T+ FKP+++G T + +R+V+PPLTRMR+  PGNVP  +  +EYYDQ
Sbjct: 1   MPFVQHFKPVPLKNTNCFKPIQIGTTQLKHRIVMPPLTRMRSTSPGNVPT-EMMIEYYDQ 59

Query: 61  RSKRPGTMLITEGVFPSAKAGGYDNAPGIWTEEQMVEWKKIFDKIHENESFVWPQLWVLG 120
           RSK PGTM+ITEGVF SA+AGGYDNAPGIW+ +Q+  W KIF +IH+N SFVWPQLWVLG
Sbjct: 60  RSKYPGTMIITEGVFISAQAGGYDNAPGIWSSDQLKIWGKIFAQIHKNGSFVWPQLWVLG 119

Query: 121 READPLSLARDGLRYDSASDNVWRTXXXXXXXXXXGIEQHGITKDEIKQYIKDYVQGARN 180
           R+A P ++ RDGLRYDS+SD +              I+ H IT++EI+QYIK+YV  A+ 
Sbjct: 120 RQAIPTNMKRDGLRYDSSSDLLNDNDQFGQLAKAHDIKLHSITEEEIQQYIKEYVDAAKK 179

Query: 181 SIKCGADGIEIHAANGYLLNQFLDPVSNKRTDEYGGSIKNRACFTLEVVDALVDAIGEDK 240
           SI  GADG+EIH+ANGYLLNQFLDP+ NKR D+YGG+I+NR  F LEVVDAL +AIG ++
Sbjct: 180 SISVGADGVEIHSANGYLLNQFLDPICNKRNDKYGGNIENRCRFALEVVDALTEAIGHER 239

Query: 241 VGIRLAPYNTNGDMSGSWDPTVFAHYAYVLGKLEKRAQAGKRLAFVHIFEPRVSNPWDNE 300
           VGIRL+P+   G MSG+ D T+ A +AY++G+LEKRA+ GKR+A++H+ EPRV++    E
Sbjct: 240 VGIRLSPFGVYGGMSGANDSTLLATFAYLIGELEKRAKDGKRIAYIHLMEPRVTDASLEE 299

Query: 301 GDGAYNGGTTDYVYSIWKGVVIRTGNLAIHPEIAKEFLKQPNTLLGYGRYFISNPDLVDR 360
           G GA    + ++VYSIWKG VIR+GN+A+ PE+A E +    TL+ +GR+FI+NPDLV+R
Sbjct: 300 GKGANEDVSNEFVYSIWKGKVIRSGNIALFPEVATEMVNDDRTLVAHGRFFIANPDLVER 359

Query: 361 LEKGLPLNLYDRPRFYAMPDKGYIDYPTYDEAIKMGW 397
           LE GLPL  YDR  FY    +GY DYPTY EA+ +GW
Sbjct: 360 LENGLPLTKYDRSTFYTQGKEGYTDYPTYKEAMGLGW 396

>TBLA0G00610 Chr7 complement(133711..134910) [1200 bp, 399 aa] {ON} 
          Length = 399

 Score =  485 bits (1248), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 226/400 (56%), Positives = 302/400 (75%), Gaps = 1/400 (0%)

Query: 1   MPFNTESKPVALKDTDLFKPLKVGNTTVLNRVVLPPLTRMRAHYPGNVPNRDWTLEYYDQ 60
           M F  E KP+AL+DT LFKP+KV +T + +RVVLPPLTRMRA +PGNVPN +W  EYYDQ
Sbjct: 1   MSFIKEFKPIALEDTKLFKPIKVSDTNLSHRVVLPPLTRMRASFPGNVPNEEWAPEYYDQ 60

Query: 61  RSKRPGTMLITEGVFPSAKAGGYDNAPGIWTEEQMVEWKKIFDKIHENESFVWPQLWVLG 120
           RSKRPG+M+ITEG F S +A  YDNA G+W+++Q+  WKKIF ++  N+S++WPQLW LG
Sbjct: 61  RSKRPGSMIITEGTFISPQAAVYDNAQGVWSDKQIAVWKKIFKRVRNNKSYIWPQLWALG 120

Query: 121 READPLSLARDGLRYDSASDNVWRTXXXXXXXXXXGIEQHGITKDEIKQYIKDYVQGARN 180
           R+AD ++L RDGLR+DS S  +             G+ QH +TK+EIKQY++++   A+ 
Sbjct: 121 RQADAVALKRDGLRFDSPS-GIDFGGKYGELYKKYGLSQHILTKEEIKQYVEEFSTAAKK 179

Query: 181 SIKCGADGIEIHAANGYLLNQFLDPVSNKRTDEYGGSIKNRACFTLEVVDALVDAIGEDK 240
            I  GADGIEIHAANG+LLN FLDP+SNKRT+EYGGSI+NR+ FTLEVVDA++ A+G  K
Sbjct: 180 IIDAGADGIEIHAANGFLLNPFLDPISNKRTNEYGGSIENRSRFTLEVVDAVIAAVGHTK 239

Query: 241 VGIRLAPYNTNGDMSGSWDPTVFAHYAYVLGKLEKRAQAGKRLAFVHIFEPRVSNPWDNE 300
           VGIR + + T+G MSG  +P + A Y++V+G+LEKRA+ G  + ++H+ EPRV+NP+  E
Sbjct: 240 VGIRFSAFGTHGTMSGGSEPLIIAQYSHVIGELEKRAKEGNGVVYIHLMEPRVTNPFLLE 299

Query: 301 GDGAYNGGTTDYVYSIWKGVVIRTGNLAIHPEIAKEFLKQPNTLLGYGRYFISNPDLVDR 360
           G+G Y   T D+ YSIW G++IR GNLA+HPEI++E  K   TLL + R +ISNPDL DR
Sbjct: 300 GEGEYLDDTNDFAYSIWTGIIIRAGNLALHPEISRELSKDERTLLAFVRLYISNPDLPDR 359

Query: 361 LEKGLPLNLYDRPRFYAMPDKGYIDYPTYDEAIKMGWGEK 400
           LEKGLPLN Y+R  FY M  +GYI+Y  Y++AIK+G+ ++
Sbjct: 360 LEKGLPLNKYNRETFYHMGAEGYIEYLRYNQAIKIGYNKE 399

>KLTH0G01584g Chr7 complement(114328..115530) [1203 bp, 400 aa] {ON}
           similar to uniprot|Q03558 Saccharomyces cerevisiae
           YHR179W OYE2 Widely conserved NADPH oxidoreductase
           containing flavin mononucleotide (FMN) homologous to
           Oye3p with slight differences in ligand binding and
           catalytic properties may be involved in sterol
           metabolism
          Length = 400

 Score =  484 bits (1246), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 240/396 (60%), Positives = 303/396 (76%), Gaps = 1/396 (0%)

Query: 1   MPFNTESKPVALKDTDLFKPLKVGNTTVLNRVVLPPLTRMRAHYPGNVPNRDWTLEYYDQ 60
           M F    KP+ALKDT+LFKP+KVG T + NR VL PLTR+RA  P +VPN +   +YY Q
Sbjct: 1   MTFVEGFKPIALKDTNLFKPIKVGKTVLRNRAVLCPLTRLRASQPRHVPNSELATKYYGQ 60

Query: 61  RSKRPGTMLITEGVFPSAKAGGYDNAPGIWTEEQMVEWKKIFDKIHENESFVWPQLWVLG 120
           RS  PGTM+ITEG FPSA++ G DNAPGIW++EQ+ EWKKIF KIHEN+SFVW QLWVLG
Sbjct: 61  RSSVPGTMIITEGTFPSAQSSGTDNAPGIWSQEQVTEWKKIFSKIHENKSFVWVQLWVLG 120

Query: 121 READPLSLARDGLRYDSASDNVWRTXXXXXXXXXXGIEQHGITKDEIKQYIKDYVQGARN 180
           R+A P SL RDGLRYD+ SD  + +          G  QHG+T +EIKQYI+DYVQ A+N
Sbjct: 121 RQASPKSLKRDGLRYDAPSDEPYMSEETKKEAIESGNPQHGLTHEEIKQYIQDYVQAAKN 180

Query: 181 SIKCGADGIEIHAANGYLLNQFLDPVSNKRTDEYGGSIKNRACFTLEVVDALVDAIGEDK 240
           S++ GADG+EIH+ANGYLLNQFLDP SNKRTDEYGGSI+ RA F LEVVDA+VDA+G + 
Sbjct: 181 SLEAGADGVEIHSANGYLLNQFLDPKSNKRTDEYGGSIEKRARFLLEVVDAVVDAVGHEH 240

Query: 241 VGIRLAPYNTNGDMSGSWDPTVFAHYAYVLGKLEKRAQAGKRLAFVHIFEPRVSNPWDNE 300
           VG+RL+PY T G+MSG+ DP   A YAYV+G+LE RA++GK +A++H+ EPRV++P   E
Sbjct: 241 VGVRLSPYGTFGNMSGASDPLFLAQYAYVVGQLEARAKSGKGIAYIHLVEPRVTSPRLVE 300

Query: 301 GDGAYNGGTTDYVYSIWKGVVIRTGNLAIHPEIAKEFLK-QPNTLLGYGRYFISNPDLVD 359
           G+G +  G+ ++V SIWKG +I+ GN A+ P+ AKE ++    TL+GYGR FI+NPDLV 
Sbjct: 301 GEGWFKDGSNEFVGSIWKGPIIKAGNYALDPKAAKEDVQFDDRTLIGYGRLFIANPDLVL 360

Query: 360 RLEKGLPLNLYDRPRFYAMPDKGYIDYPTYDEAIKM 395
           RL+ GLPLN YDR  FY    KGY+DYPT++EA K+
Sbjct: 361 RLKDGLPLNQYDRDTFYTQTAKGYVDYPTFEEAQKL 396

>KAFR0E00120 Chr5 (19340..20542) [1203 bp, 400 aa] {ON} 
          Length = 400

 Score =  479 bits (1234), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 218/400 (54%), Positives = 294/400 (73%)

Query: 1   MPFNTESKPVALKDTDLFKPLKVGNTTVLNRVVLPPLTRMRAHYPGNVPNRDWTLEYYDQ 60
           MPF  +   V L+ T+LFKP+K+GNTT+ +R V+ PLTR+RA +PG VPN     EYYDQ
Sbjct: 1   MPFAEQKNAVPLEGTNLFKPIKIGNTTLSHRAVMAPLTRLRASWPGQVPNTKLATEYYDQ 60

Query: 61  RSKRPGTMLITEGVFPSAKAGGYDNAPGIWTEEQMVEWKKIFDKIHENESFVWPQLWVLG 120
           RSKR GTM+++E    S + GG ++APGIW +EQ+ EWKKI  K+H+N S+ W Q W LG
Sbjct: 61  RSKRKGTMILSEAAVISPQTGGINHAPGIWNDEQVAEWKKIIKKVHDNGSYFWVQFWALG 120

Query: 121 READPLSLARDGLRYDSASDNVWRTXXXXXXXXXXGIEQHGITKDEIKQYIKDYVQGARN 180
           R A P +LA DGLRY SASD+V+              +QHG+TK+EIK ++ D+   A+N
Sbjct: 121 RHAHPGNLAGDGLRYVSASDDVYIDPVREEIAMYANNQQHGLTKEEIKSFVADFANAAKN 180

Query: 181 SIKCGADGIEIHAANGYLLNQFLDPVSNKRTDEYGGSIKNRACFTLEVVDALVDAIGEDK 240
           SIK GADG+E+H+A G++LNQFLDP SNKRTD YGGSI+NR+ FTLEV+DA +DA+G ++
Sbjct: 181 SIKAGADGVEVHSAFGFILNQFLDPKSNKRTDGYGGSIENRSRFTLEVIDACIDAVGAER 240

Query: 241 VGIRLAPYNTNGDMSGSWDPTVFAHYAYVLGKLEKRAQAGKRLAFVHIFEPRVSNPWDNE 300
           VG+RL+P+   G MSG  DPT+ A YAY+LG+LEKR +AG R+AF+ + EPR+++P+  E
Sbjct: 241 VGVRLSPWAVYGSMSGGEDPTLLATYAYILGELEKRGKAGNRIAFIDLIEPRITDPFSPE 300

Query: 301 GDGAYNGGTTDYVYSIWKGVVIRTGNLAIHPEIAKEFLKQPNTLLGYGRYFISNPDLVDR 360
           G   Y  G  D+ YS+WKG +IR+GNL +HP+  KE ++   TL+ YGR++ISNPDL+DR
Sbjct: 301 GQNEYKKGNNDFAYSVWKGPIIRSGNLTLHPKAVKEMVEDERTLVAYGRFWISNPDLIDR 360

Query: 361 LEKGLPLNLYDRPRFYAMPDKGYIDYPTYDEAIKMGWGEK 400
           +EKGLPLN YDR  F+   + G  DYPTY+EA+K+GW +K
Sbjct: 361 VEKGLPLNKYDRKTFFGRTEVGLTDYPTYEEALKLGWDKK 400

>KNAG0D03170 Chr4 complement(567087..568328) [1242 bp, 413 aa] {ON} 
          Length = 413

 Score =  473 bits (1216), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 230/395 (58%), Positives = 286/395 (72%), Gaps = 1/395 (0%)

Query: 3   FNTESKPVALKDTDLFKPLKVGNTTVLNRVVLPPLTRMRAHYPGNVPNRDWTLEYYDQRS 62
           F T   PVA +DT+LFKP+KVG+  + +RVV+ PLTR RA +P +VPN      YYDQRS
Sbjct: 18  FQTSFAPVAFRDTNLFKPIKVGSMELAHRVVMAPLTRWRALHPSHVPNEKLVPLYYDQRS 77

Query: 63  KRPGTMLITEGVFPSAKAGGYDNAPGIWTEEQMVEWKKIFDKIHENESFVWPQLWVLGRE 122
           K PGT++ITE  F S +AGGYD APGIW+EEQ+  W KIF KIH N+SFV+ QL  LGR+
Sbjct: 78  KAPGTLIITESAFTSLQAGGYDYAPGIWSEEQVAVWTKIFAKIHGNKSFVFVQLRNLGRQ 137

Query: 123 ADPLSLARDGLRYDSASDNVWRTXXXXXXXXXXGIEQHGITKDEIKQYIKDYVQGARNSI 182
           A P S+ARDGLRYDSASD+++            G++QHGITK EIKQYI +YV  A+NSI
Sbjct: 138 AVPTSMARDGLRYDSASDDLYIDEATKEAVLKAGLKQHGITKSEIKQYIAEYVHTAKNSI 197

Query: 183 KCGADGIEIHAANGYLLNQFLDPVSNKRTDEYGGSIKNRACFTLEVVDALVDAIGEDKVG 242
           K GADG+EIH+AN Y+LNQFLDP SN RTDEYGGSI+NR+ FTLEVVDAL+DA+G ++VG
Sbjct: 198 KAGADGVEIHSANSYMLNQFLDPRSNHRTDEYGGSIENRSRFTLEVVDALIDAVGAERVG 257

Query: 243 IRLAPYNTNGDMSGSWDPTVFAHYAYVLGKLEKRAQAGKRLAFVHIFEPRVSNPWDNEGD 302
           IR +P+   G MSGS DP V+  Y+Y+L +LE RAQ G RLA+VH+ EPRV+N    EG 
Sbjct: 258 IRFSPFGKYGGMSGSDDPQVYELYSYLLDQLESRAQFGNRLAYVHLMEPRVANISLEEGQ 317

Query: 303 GAYNGGTTDYVYSIWKGVVIRTGNLAIHPEIAKEFLKQPNTLLGYGRYFISNPDLVDRLE 362
           G     + D+ Y  WKG +IR+GN A  P+I +  L    TL+ YGRYFIS PDL  RL 
Sbjct: 318 GEDLEHSNDFAYDHWKGPIIRSGNFAASPDITESVLDD-RTLIAYGRYFISTPDLPHRLA 376

Query: 363 KGLPLNLYDRPRFYAMPDKGYIDYPTYDEAIKMGW 397
           +GLPLN Y+R  FY +   GY DYPTY+E +K+GW
Sbjct: 377 EGLPLNKYNRTTFYKLGAVGYTDYPTYEETLKLGW 411

>ZYRO0F13618g Chr6 (1122697..1123905) [1209 bp, 402 aa] {ON} similar
           to uniprot|Q03558 Saccharomyces cerevisiae YHR179W OYE2
           Widely conserved NADPH oxidoreductase containing flavin
           mononucleotide (FMN) homologous to Oye3p with slight
           differences in ligand binding and catalytic properties
           may be involved in sterol metabolism
          Length = 402

 Score =  469 bits (1206), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 220/395 (55%), Positives = 290/395 (73%), Gaps = 2/395 (0%)

Query: 3   FNTESKPVALKDTDLFKPLKVGNTTVLNRVVLPPLTRMRAHYPGNVPNRDWTLEYYDQRS 62
           F     P+ L  T+LF+P++VG+  + +RVV+ PLTR+RA      PN +   EYY QR+
Sbjct: 6   FTNRVHPIPLGHTNLFEPIEVGDMKLAHRVVMAPLTRLRA--TKYAPNGELAPEYYAQRA 63

Query: 63  KRPGTMLITEGVFPSAKAGGYDNAPGIWTEEQMVEWKKIFDKIHENESFVWPQLWVLGRE 122
           +RPGT++ITE  +P+ + GGY NAPG+W +E    W+++F ++HE +SF++ QLW +GR+
Sbjct: 64  QRPGTLIITEASYPAPQFGGYVNAPGLWAKEHWDVWREVFKRVHEKKSFIYVQLWNMGRQ 123

Query: 123 ADPLSLARDGLRYDSASDNVWRTXXXXXXXXXXGIEQHGITKDEIKQYIKDYVQGARNSI 182
           A P  L  DGLRYDSASD V+               QHG+TKDEIKQY+KD+V+ ++ S+
Sbjct: 124 APPAVLKADGLRYDSASDGVYMDKNSEEEAIKSNNPQHGLTKDEIKQYVKDFVRASKESV 183

Query: 183 KCGADGIEIHAANGYLLNQFLDPVSNKRTDEYGGSIKNRACFTLEVVDALVDAIGEDKVG 242
           + GADG+EIH+ANGYLLNQFLDP SNKRTDEYGGSI+NRA FTLEVVDA+VDAIG +K  
Sbjct: 184 ENGADGVEIHSANGYLLNQFLDPGSNKRTDEYGGSIENRARFTLEVVDAVVDAIGPEKTA 243

Query: 243 IRLAPYNTNGDMSGSWDPTVFAHYAYVLGKLEKRAQAGKRLAFVHIFEPRVSNPWDNEGD 302
           +R +PY   G MSG   P + A YAYV G+LE+RA+ GKRL+++H+ EPRV++P   EG 
Sbjct: 244 VRFSPYGKFGSMSGGSAPEIVAQYAYVFGELERRAKQGKRLSYIHLVEPRVTHPGLLEGQ 303

Query: 303 GAYNGGTTDYVYSIWKGVVIRTGNLAIHPEIAKEFLKQPNTLLGYGRYFISNPDLVDRLE 362
           G Y+ G+ D++YSIWKGVV+R GNLA+HPE+ KE++K P TL+ YGR+FISNPDLVDRLE
Sbjct: 304 GEYDEGSNDFIYSIWKGVVLRAGNLALHPEVVKEWVKFPRTLICYGRFFISNPDLVDRLE 363

Query: 363 KGLPLNLYDRPRFYAMPDKGYIDYPTYDEAIKMGW 397
           KGLPL  YDR  FY    +GY DYP Y E +K G+
Sbjct: 364 KGLPLTEYDRDNFYTHGAEGYTDYPNYSECVKEGY 398

>AGR329C Chr7 complement(1346011..1347210) [1200 bp, 399 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YHR179W
           (OYE2) and YPL171C (OYE3)
          Length = 399

 Score =  466 bits (1198), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 220/389 (56%), Positives = 285/389 (73%), Gaps = 1/389 (0%)

Query: 12  LKDTDLFKPLKVGNTTVLNRVVLPPLTRMRAHYPGNVPNRDWTLEYYDQRSKRPGTMLIT 71
           L++T LFKPLKVGNTT+ +R+ L PLTR+R   P ++P  D   EYYDQRSKRPGT++IT
Sbjct: 11  LRNTALFKPLKVGNTTIQHRIALAPLTRLRTTNPEHIPT-DIVREYYDQRSKRPGTLVIT 69

Query: 72  EGVFPSAKAGGYDNAPGIWTEEQMVEWKKIFDKIHENESFVWPQLWVLGREADPLSLARD 131
           EG FPSA   G ++ PGIW+ EQ  EW KIF  IH+N+SF W QLWVLG + DP  +A++
Sbjct: 70  EGTFPSASTAGMNDVPGIWSAEQASEWAKIFKVIHDNKSFAWVQLWVLGSQNDPSVIAKN 129

Query: 132 GLRYDSASDNVWRTXXXXXXXXXXGIEQHGITKDEIKQYIKDYVQGARNSIKCGADGIEI 191
           GLR DSASD+ + +           +    ITKD+IK+YI+ YV  A+ +I+ GADG+E+
Sbjct: 130 GLRNDSASDDWYPSDGVRDLAKQLNVPSRAITKDQIKEYIQIYVSAAKRAIEAGADGVEV 189

Query: 192 HAANGYLLNQFLDPVSNKRTDEYGGSIKNRACFTLEVVDALVDAIGEDKVGIRLAPYNTN 251
           H+ANGYLLNQFLD VSNKRTDEYGGSI+NRA FTLEV+DAL +A+G +KVG+R +PY T 
Sbjct: 190 HSANGYLLNQFLDSVSNKRTDEYGGSIENRARFTLEVLDALAEAVGPEKVGVRFSPYGTF 249

Query: 252 GDMSGSWDPTVFAHYAYVLGKLEKRAQAGKRLAFVHIFEPRVSNPWDNEGDGAYNGGTTD 311
           G+M+G+ DP   A YAY+ G+LEKRA  GKRLA++H+ EPRV++P   EG   YNGGT D
Sbjct: 250 GNMAGTVDPNTVAQYAYIAGQLEKRAAEGKRLAYIHVVEPRVTDPSVEEGQSVYNGGTND 309

Query: 312 YVYSIWKGVVIRTGNLAIHPEIAKEFLKQPNTLLGYGRYFISNPDLVDRLEKGLPLNLYD 371
           + YS+WKG+++R G+ A H + A    +   T++ YGRYFISNPDL DRLEKGLPLN Y 
Sbjct: 310 FFYSVWKGIILRAGSYAHHLDAAVRDAELGRTVIVYGRYFISNPDLPDRLEKGLPLNNYR 369

Query: 372 RPRFYAMPDKGYIDYPTYDEAIKMGWGEK 400
           R  FY    +GYIDYP Y+EA+  G+ ++
Sbjct: 370 RELFYTNEAEGYIDYPVYEEAVAKGYKQQ 398

>ZYRO0F12144g Chr6 complement(986860..988053) [1194 bp, 397 aa] {ON}
           similar to uniprot|Q03558 Saccharomyces cerevisiae
           YHR179W OYE2 Widely conserved NADPH oxidoreductase
           containing flavin mononucleotide (FMN) homologous to
           Oye3p with slight differences in ligand binding and
           catalytic properties may be involved in sterol
           metabolism
          Length = 397

 Score =  465 bits (1196), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 215/397 (54%), Positives = 286/397 (72%)

Query: 1   MPFNTESKPVALKDTDLFKPLKVGNTTVLNRVVLPPLTRMRAHYPGNVPNRDWTLEYYDQ 60
           M F    +PV+L DT+LFKP+KVG+  + +RVVL PLTR R      V N++   EYY Q
Sbjct: 1   MSFTKRFQPVSLGDTNLFKPIKVGDVQLNHRVVLAPLTRCRCLNDDGVLNQELAPEYYSQ 60

Query: 61  RSKRPGTMLITEGVFPSAKAGGYDNAPGIWTEEQMVEWKKIFDKIHENESFVWPQLWVLG 120
           RS+ PGT++ITE  FPS ++ G+  +PG+ T +Q   W K+F+ IH+N+S V+ Q+W  G
Sbjct: 61  RSQEPGTLIITEAAFPSLQSAGFVGSPGLITGDQFSAWSKVFNTIHKNKSSVFVQIWSAG 120

Query: 121 READPLSLARDGLRYDSASDNVWRTXXXXXXXXXXGIEQHGITKDEIKQYIKDYVQGARN 180
           R AD   LA++ LRYDSA+DN++             + QHGIT+ EI +YI+D+V  A+N
Sbjct: 121 RSADLEVLAKNDLRYDSATDNLYMNREMEEKAAKLQLAQHGITQQEINEYIRDWVHAAKN 180

Query: 181 SIKCGADGIEIHAANGYLLNQFLDPVSNKRTDEYGGSIKNRACFTLEVVDALVDAIGEDK 240
           SIK GADG+EIHAANGYLLNQFLDP+SN RTD+YGGSI+NR+ F LE+VDA++DAIG  K
Sbjct: 181 SIKAGADGVEIHAANGYLLNQFLDPISNHRTDKYGGSIENRSRFPLEIVDAIIDAIGASK 240

Query: 241 VGIRLAPYNTNGDMSGSWDPTVFAHYAYVLGKLEKRAQAGKRLAFVHIFEPRVSNPWDNE 300
           +GIR +PY   GDMS   +P + A YA+++G+LE+RAQ G R+A++H+ EPRV+ P   E
Sbjct: 241 IGIRFSPYGFYGDMSSGDNPLILAQYAHIIGELERRAQQGNRIAYIHLVEPRVTIPQLPE 300

Query: 301 GDGAYNGGTTDYVYSIWKGVVIRTGNLAIHPEIAKEFLKQPNTLLGYGRYFISNPDLVDR 360
           G+GAY GGT D+VYSIWKG+VIR G+LA+HPE+ ++F +   TLL YGR+FISNPDL  R
Sbjct: 301 GEGAYTGGTNDFVYSIWKGIVIRCGDLALHPELEEKFTEDNRTLLAYGRFFISNPDLAHR 360

Query: 361 LEKGLPLNLYDRPRFYAMPDKGYIDYPTYDEAIKMGW 397
           L +GLPLN YDR  FY     GY DYP Y   +K+G+
Sbjct: 361 LREGLPLNEYDRSTFYTSNSVGYTDYPNYQNCLKLGY 397

>KNAG0J00330 Chr10 complement(52717..53913) [1197 bp, 398 aa] {ON} 
          Length = 398

 Score =  461 bits (1187), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 221/397 (55%), Positives = 283/397 (71%)

Query: 1   MPFNTESKPVALKDTDLFKPLKVGNTTVLNRVVLPPLTRMRAHYPGNVPNRDWTLEYYDQ 60
           M F    +P+A KDT LF+P+KVGN  + +R V+ PL+RMRA YPG VPNR   LEYYDQ
Sbjct: 1   MAFLKGVEPLAWKDTKLFEPIKVGNVQLEHRAVMAPLSRMRAEYPGLVPNRQLALEYYDQ 60

Query: 61  RSKRPGTMLITEGVFPSAKAGGYDNAPGIWTEEQMVEWKKIFDKIHENESFVWPQLWVLG 120
           RSK PGT++ TE V P A+AGG+D+APGIWT+EQ+ EW KIF +IH+N+ FVW QL   G
Sbjct: 61  RSKTPGTLIFTESVIPCAQAGGHDHAPGIWTKEQIDEWTKIFKRIHDNKCFVWLQLISQG 120

Query: 121 READPLSLARDGLRYDSASDNVWRTXXXXXXXXXXGIEQHGITKDEIKQYIKDYVQGARN 180
           R   P +L RD LR+D+ S  V+            G   HG+TKDE+KQYI DYVQ ARN
Sbjct: 121 RRGSPANLKRDNLRFDAPSPGVYFDENSERAAKECGNPLHGLTKDEMKQYIADYVQAARN 180

Query: 181 SIKCGADGIEIHAANGYLLNQFLDPVSNKRTDEYGGSIKNRACFTLEVVDALVDAIGEDK 240
           +I  GADG+E+H A G+LLNQFLDPV+NKRTDEYGG+I+NR  F LEV+D + +AIG +K
Sbjct: 181 AIGAGADGVEVHCATGFLLNQFLDPVTNKRTDEYGGTIENRIRFPLEVIDGIAEAIGWEK 240

Query: 241 VGIRLAPYNTNGDMSGSWDPTVFAHYAYVLGKLEKRAQAGKRLAFVHIFEPRVSNPWDNE 300
           +G+R++PY+    MSGS DPT+ A Y  +LG+L+KRA  GK  A+VH+ EPRVS P  + 
Sbjct: 241 MGVRISPYSKFNGMSGSSDPTLLATYVLLLGELQKRANNGKPAAYVHVVEPRVSAPLADY 300

Query: 301 GDGAYNGGTTDYVYSIWKGVVIRTGNLAIHPEIAKEFLKQPNTLLGYGRYFISNPDLVDR 360
            D A   GT DY+YS+WKGVVIR GN  +     K+ L+   +L+ YGR++I+NPDLV+R
Sbjct: 301 DDIADVTGTNDYIYSVWKGVVIRAGNFTLQEAETKKALENNRSLIAYGRFYIANPDLVER 360

Query: 361 LEKGLPLNLYDRPRFYAMPDKGYIDYPTYDEAIKMGW 397
           L +GLPLN YDR  FY    +GY DYPT++EAI  GW
Sbjct: 361 LREGLPLNKYDRSTFYTHTKEGYTDYPTFEEAINWGW 397

>NCAS0C04110 Chr3 (838638..839804) [1167 bp, 388 aa] {ON} 
          Length = 388

 Score =  457 bits (1175), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 235/389 (60%), Positives = 292/389 (75%), Gaps = 2/389 (0%)

Query: 1   MPFNTESKPVALKDTDLFKPLKVGNTTVLNRVVLPPLTRMRAHYPGNVPNRDWTLEYYDQ 60
           M F    KP AL DTDLFKP+KVGNT + NR+V+ PLTRMRA  P +VPN +   EYYDQ
Sbjct: 1   MTFVQGFKPEALADTDLFKPIKVGNTELQNRIVMAPLTRMRA--PNHVPNTELVSEYYDQ 58

Query: 61  RSKRPGTMLITEGVFPSAKAGGYDNAPGIWTEEQMVEWKKIFDKIHENESFVWPQLWVLG 120
           RSKR GTM+ITEG+F S +AGGY +APGI+T+EQ+ EWKKIF KIHEN+SFVW Q+WVLG
Sbjct: 59  RSKRAGTMIITEGIFTSPQAGGYPDAPGIYTKEQIAEWKKIFAKIHENKSFVWAQMWVLG 118

Query: 121 READPLSLARDGLRYDSASDNVWRTXXXXXXXXXXGIEQHGITKDEIKQYIKDYVQGARN 180
           R++   +LA++GLRYDSA+D+++               QHGITKDEIKQYIKDYV+ ++N
Sbjct: 119 RQSLADTLAKEGLRYDSATDDLYLDDERKERAIKSNNPQHGITKDEIKQYIKDYVEASKN 178

Query: 181 SIKCGADGIEIHAANGYLLNQFLDPVSNKRTDEYGGSIKNRACFTLEVVDALVDAIGEDK 240
           +I  GADG+EIH+AN YLLNQFLD  SN RTDEYGGSI+NRA FTLEVVDA+V A+G DK
Sbjct: 179 AIAAGADGVEIHSANSYLLNQFLDSKSNNRTDEYGGSIENRARFTLEVVDAVVAAVGADK 238

Query: 241 VGIRLAPYNTNGDMSGSWDPTVFAHYAYVLGKLEKRAQAGKRLAFVHIFEPRVSNPWDNE 300
           VG+R +P+   G MSG  +P   A Y+YV+G+LEKRA  GKR+A++H+ EP   N WD++
Sbjct: 239 VGVRFSPWGMYGGMSGGANPLTLAEYSYVIGELEKRATEGKRIAYIHLVEPCPPNVWDDK 298

Query: 301 GDGAYNGGTTDYVYSIWKGVVIRTGNLAIHPEIAKEFLKQPNTLLGYGRYFISNPDLVDR 360
            +     G+ D++YSIW+G+VIRTG L   PE A++    PNTL GYGR +ISNPDL DR
Sbjct: 299 PELRNTKGSNDFIYSIWEGIVIRTGELGDKPENARKIAANPNTLAGYGRMYISNPDLPDR 358

Query: 361 LEKGLPLNLYDRPRFYAMPDKGYIDYPTY 389
           LE G PLN ++R  FYA   KGYIDYPTY
Sbjct: 359 LENGWPLNDFERDLFYASGAKGYIDYPTY 387

>NCAS0D04260 Chr4 complement(805403..806662) [1260 bp, 419 aa] {ON} 
          Length = 419

 Score =  453 bits (1165), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 217/397 (54%), Positives = 285/397 (71%), Gaps = 1/397 (0%)

Query: 1   MPFNTESKPVALKDTDLFKPLKVGNTTVLNRVVLPPLTRMRAHYPGNVPNRDWTLEYYDQ 60
           M F T ++   LK T+LFKP+K+GN  + +R V+ PLTR+RA YPG +PN + + EYYDQ
Sbjct: 20  MSFATGNQQ-PLKGTNLFKPMKLGNMELDHRAVMAPLTRLRAIYPGQIPNVELSSEYYDQ 78

Query: 61  RSKRPGTMLITEGVFPSAKAGGYDNAPGIWTEEQMVEWKKIFDKIHENESFVWPQLWVLG 120
           RSKRPGT LI+E    S +AGG D+ PGIW + Q+  W K+  K+H+N S+++ Q W LG
Sbjct: 79  RSKRPGTFLISEAAVISPQAGGIDDVPGIWNDTQVEAWSKVIKKVHDNGSYIFIQFWALG 138

Query: 121 READPLSLARDGLRYDSASDNVWRTXXXXXXXXXXGIEQHGITKDEIKQYIKDYVQGARN 180
           R   P +L RDGLRY SASD+V+               QHG+TKDEIK  I+D+   ++N
Sbjct: 139 RHGLPGNLKRDGLRYISASDDVYIDNAHKEAAFYSNNRQHGLTKDEIKGIIQDFANASKN 198

Query: 181 SIKCGADGIEIHAANGYLLNQFLDPVSNKRTDEYGGSIKNRACFTLEVVDALVDAIGEDK 240
           SIK GADG+EIH+A G+ LNQFLDP+SNKRTDEYGGSI+NRA   LEVV+A +DA+G  K
Sbjct: 199 SIKAGADGVEIHSAFGFFLNQFLDPISNKRTDEYGGSIENRARIVLEVVNACIDAVGAKK 258

Query: 241 VGIRLAPYNTNGDMSGSWDPTVFAHYAYVLGKLEKRAQAGKRLAFVHIFEPRVSNPWDNE 300
           +GIRL P+     MSG  DPT+ A +AY+LG+LEKR +AGKRLA+VH+ EPRV++P+  E
Sbjct: 259 IGIRLTPWGRYLGMSGGSDPTLLATFAYLLGELEKRGRAGKRLAYVHLGEPRVTDPFLPE 318

Query: 301 GDGAYNGGTTDYVYSIWKGVVIRTGNLAIHPEIAKEFLKQPNTLLGYGRYFISNPDLVDR 360
           G G    GT D+V+SIWKG +IR+GNL +HPEI K+ ++   TL+ YGR++ISNPDL DR
Sbjct: 319 GTGMDMNGTNDFVFSIWKGAIIRSGNLTLHPEIVKKMVENDRTLIAYGRFWISNPDLPDR 378

Query: 361 LEKGLPLNLYDRPRFYAMPDKGYIDYPTYDEAIKMGW 397
           LE GLPLN Y+R  F+    +G  DYPTY EA+ +G+
Sbjct: 379 LEGGLPLNKYNRHTFFGRTAEGLTDYPTYSEAVALGY 415

>TBLA0E00660 Chr5 complement(130778..131965) [1188 bp, 395 aa] {ON} 
          Length = 395

 Score =  443 bits (1139), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 211/386 (54%), Positives = 278/386 (72%), Gaps = 2/386 (0%)

Query: 8   KPVALKDTDLFKPLKVGNTTVLNRVVLPPLTRMRAHYPGNVPNRDWTLEYYDQRSKRPGT 67
           + V LKDT +FKP KVG T + +R+V+P LTRMRA  P NV + +W  EYYDQRSK PG+
Sbjct: 9   EAVPLKDTAIFKPTKVGVTNLQHRIVMPALTRMRASAPFNVLDSEWAAEYYDQRSKTPGS 68

Query: 68  MLITEGVFPSAKAGGYDNAPGIWTEEQMVEWKKIFDKIHENESFVWPQLWVLGREADPLS 127
           M+ITEG F   +AGGYDNAPGI+ +E +  W KIF KIH N+SFVW QLW LGR+A P  
Sbjct: 69  MIITEGAFIFPQAGGYDNAPGIYCDEHVHAWSKIFKKIHNNKSFVWLQLWALGRQAPPSC 128

Query: 128 LARDGLRYDSASDNVWRTXXXXXXXXXXGIEQHGITKDEIKQYIKDYVQGARNSIKCGAD 187
           +ARDGLR D+ S +++            GI+QH +T+ +I+QY++DY+  A+ SI+ GAD
Sbjct: 129 MARDGLRLDAPSGDLYLNEEFKKSAQEVGIKQHEMTEADIEQYVEDYITAAKLSIEAGAD 188

Query: 188 GIEIHAANGYLLNQFLDPVSNKRTDEYGGSIKNRACFTLEVVDALVDAIGEDKVGIRLAP 247
           G+EIH ANGYLLNQFLDP SN+RTD YGGSI+NRA F LEVVD +++AIG  +VGIR +P
Sbjct: 189 GVEIHCANGYLLNQFLDPSSNQRTDRYGGSIENRARFPLEVVDRVIEAIGAHRVGIRFSP 248

Query: 248 YNTNGDMSGSWDPTVFAHYAYVLGKLEKRAQ-AGKRLAFVHIFEPRVSNPWDNEGDGAYN 306
           Y T G MSG  +P + A YAY++G+LEKRA+    R+A++H+ EP  ++    EG G + 
Sbjct: 249 YGTYGSMSGGENPNILAQYAYIIGQLEKRAELQNNRIAYIHLVEPSTTDFTLEEGLGEFK 308

Query: 307 GGTTDYVYSIWKGVVIRTGNLAIHPEIAKEFL-KQPNTLLGYGRYFISNPDLVDRLEKGL 365
            G+ D+ YSIWKG +IRTG+LA++P++ KE   K   TL+ +GRYFISNPD+V R+ KGL
Sbjct: 309 DGSNDFAYSIWKGPIIRTGSLALNPKLVKELCEKDDRTLVAFGRYFISNPDIVQRMAKGL 368

Query: 366 PLNLYDRPRFYAMPDKGYIDYPTYDE 391
           PL  YD   FY    +GYIDYP Y++
Sbjct: 369 PLTQYDISTFYTPGKEGYIDYPNYED 394

>TBLA0C07300 Chr3 complement(1778734..1779654) [921 bp, 306 aa] {ON}
           
          Length = 306

 Score =  420 bits (1079), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 201/306 (65%), Positives = 238/306 (77%)

Query: 95  MVEWKKIFDKIHENESFVWPQLWVLGREADPLSLARDGLRYDSASDNVWRTXXXXXXXXX 154
           M EWKKIF  IH+N SFVWPQLW LG  AD  S+ARDGLRYD A+D V+           
Sbjct: 1   MTEWKKIFAAIHKNNSFVWPQLWALGWAADAKSMARDGLRYDGATDGVYSNDQYGKIAKE 60

Query: 155 XGIEQHGITKDEIKQYIKDYVQGARNSIKCGADGIEIHAANGYLLNQFLDPVSNKRTDEY 214
             I+ HG+TKD+IKQYIKDYV  A+  I  GADG+EIH+ANGYLLNQFLD  SNKRTDEY
Sbjct: 61  NDIKIHGLTKDDIKQYIKDYVTAAKKCIAAGADGVEIHSANGYLLNQFLDINSNKRTDEY 120

Query: 215 GGSIKNRACFTLEVVDALVDAIGEDKVGIRLAPYNTNGDMSGSWDPTVFAHYAYVLGKLE 274
           GGSI+NRA F LEVVDAL++AIG +KVGIR +PY T  DM+G  +P   A +AY+ G+LE
Sbjct: 121 GGSIENRARFPLEVVDALIEAIGAEKVGIRFSPYGTFNDMAGGSNPLGVAQFAYITGELE 180

Query: 275 KRAQAGKRLAFVHIFEPRVSNPWDNEGDGAYNGGTTDYVYSIWKGVVIRTGNLAIHPEIA 334
           KRA+AG RLAF+H+ EPRV+NP+  EG G Y  GT D+VYSIWKGV+IR GNLA+HPE+A
Sbjct: 181 KRAKAGNRLAFIHLVEPRVTNPFLTEGQGEYTDGTNDFVYSIWKGVIIRAGNLALHPEVA 240

Query: 335 KEFLKQPNTLLGYGRYFISNPDLVDRLEKGLPLNLYDRPRFYAMPDKGYIDYPTYDEAIK 394
           +EF+K   TLLGYGR +I+NPDLVDRLEKGLPLN Y+R  FYAM  +GY DYPTYDEAIK
Sbjct: 241 REFMKDDGTLLGYGRLWIANPDLVDRLEKGLPLNKYNRDLFYAMTSEGYFDYPTYDEAIK 300

Query: 395 MGWGEK 400
           MGW ++
Sbjct: 301 MGWDKQ 306

>TBLA0D03340 Chr4 (832010..832879) [870 bp, 289 aa] {ON} 
          Length = 289

 Score =  401 bits (1031), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 198/289 (68%), Positives = 230/289 (79%)

Query: 112 VWPQLWVLGREADPLSLARDGLRYDSASDNVWRTXXXXXXXXXXGIEQHGITKDEIKQYI 171
           +W Q++ +GR A   S+ RDGLRY+  S   W            G+ QH +TKD+I QYI
Sbjct: 1   MWVQIYAMGRRAPLASIKRDGLRYNVVSSGTWIDEGNKKELEKIGLVQHQLTKDDINQYI 60

Query: 172 KDYVQGARNSIKCGADGIEIHAANGYLLNQFLDPVSNKRTDEYGGSIKNRACFTLEVVDA 231
           +D+V GA+N+I+CGADG+EIHAANG+LLNQFLDP+SNKRTDEYGGSI+NRA   LEVVDA
Sbjct: 61  QDFVNGAKNAIECGADGVEIHAANGFLLNQFLDPISNKRTDEYGGSIENRARIILEVVDA 120

Query: 232 LVDAIGEDKVGIRLAPYNTNGDMSGSWDPTVFAHYAYVLGKLEKRAQAGKRLAFVHIFEP 291
           LVDAI EDKVGIR +PY  +G MSGSWDPTVFAHYAYV  +LEKRAQ GKRLAF+HI+EP
Sbjct: 121 LVDAISEDKVGIRFSPYTDSGGMSGSWDPTVFAHYAYVFAQLEKRAQEGKRLAFIHIYEP 180

Query: 292 RVSNPWDNEGDGAYNGGTTDYVYSIWKGVVIRTGNLAIHPEIAKEFLKQPNTLLGYGRYF 351
            V+  W ++G G Y GGTTD++YSI KG VIRTGNL IHPE+AKEFLKQPNTLLGYGRYF
Sbjct: 181 GVTANWVDDGTGTYVGGTTDFIYSIGKGTVIRTGNLTIHPEVAKEFLKQPNTLLGYGRYF 240

Query: 352 ISNPDLVDRLEKGLPLNLYDRPRFYAMPDKGYIDYPTYDEAIKMGWGEK 400
           ISNPDLVDRLE GLPLN YDR  FY   DKGY DYPTY EAIK+GW ++
Sbjct: 241 ISNPDLVDRLENGLPLNSYDRSTFYTDADKGYTDYPTYKEAIKLGWDKQ 289

>TPHA0P01030 Chr16 (207281..208462) [1182 bp, 393 aa] {ON} 
          Length = 393

 Score =  405 bits (1042), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 195/398 (48%), Positives = 277/398 (69%), Gaps = 10/398 (2%)

Query: 1   MPFNTESKPVALKDTDLFKPLKVGNTTVLNRVVLPPLTRMRAHYPGNVPNRDWTLEYYDQ 60
           M F   +    LK+++LFKP+ VG+ T+  R+ + PLTRMRA    +VP ++    YY Q
Sbjct: 1   MSFVKNNSNAFLKESNLFKPITVGDITLGQRISMSPLTRMRADPSNHVP-KEIVTTYYKQ 59

Query: 61  RSKRPGTMLITEGVFPSAKAGGYDNAPGIWTEEQMVEWKKIFDKIHENESFVWPQLWVLG 120
           R++R GT++I+E  F S  A GYD+APGI+++EQ+  WKKI   +H+  SF + QLW LG
Sbjct: 60  RAERKGTLIISEATFISEAATGYDHAPGIYSKEQIEAWKKIIKAVHDEGSFFFSQLWSLG 119

Query: 121 READPLSLARDGLRYDSASDNVWRTXXXXXXXXXXGIEQHGITKDEIKQYIKDYVQGARN 180
            +A P S+A+ GL+Y + S++ +             ++QH +TK+EIK  + DYVQ A+N
Sbjct: 120 WQASPESIAKHGLQYLAPSESPFMDETQEKACKDNNVKQHAMTKEEIKSMVADYVQAAKN 179

Query: 181 SIKCGADGIEIHAANGYLLNQFLDPVSNKRTDEYGGSIKNRACFTLEVVDALVDAIGEDK 240
           +I+ GADG+EIHAANGYL NQFLDP+SN+RTDEYGGSI+NR  F LE+VD +++A+G  K
Sbjct: 180 AIEAGADGVEIHAANGYLPNQFLDPLSNRRTDEYGGSIENRCRFVLEIVDGVIEAVGASK 239

Query: 241 VGIRLAPYNTNGDMSGSWDPTVFAHYAYVLGKLEKRAQAGKRLAFVHIFEPRVSNPWDNE 300
           VGIRL+PY T G M+GS DPT+ A YA+V+G+LEKRA++GKR+A++H  EP  S   D E
Sbjct: 240 VGIRLSPYGTYGSMTGSADPTLLATYAFVVGELEKRAKSGKRMAYIHAIEPEKS---DIE 296

Query: 301 GDGAYNGGTTDYVYSIWKGVVIRTGNLAIHPEIAKEFLKQPN-TLLGYGRYFISNPDLVD 359
                 G + ++++SIW+GVVIR  N+  + E  KEF+   + T++ YG +FI+NPDL+D
Sbjct: 297 A-----GKSLNFIFSIWEGVVIRAANMIQNFEKTKEFVDNNDRTIISYGSFFIANPDLID 351

Query: 360 RLEKGLPLNLYDRPRFYAMPDKGYIDYPTYDEAIKMGW 397
           RLEKGLP N  D   F+    +GYIDYP Y +A+K+G+
Sbjct: 352 RLEKGLPFNKPDVSLFFTREKEGYIDYPVYADAVKLGY 389

>Kpol_370.4 s370 (5694..6863) [1170 bp, 389 aa] {ON} (5694..6863)
           [1170 nt, 390 aa]
          Length = 389

 Score =  394 bits (1011), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 194/395 (49%), Positives = 261/395 (66%), Gaps = 10/395 (2%)

Query: 1   MPFNTESKPVALKDTDLFKPLKVGNTTVLNRVVLPPLTRMRAHYPGNVPNRDWTLEYYDQ 60
           M F     PV+   T +F P+KVGN  + + VV+ PLTRMR    GNVP +D  +EYYDQ
Sbjct: 1   MGFVEGYIPVSYDGTSMFNPIKVGNMQLSHHVVMAPLTRMRVTRQGNVP-KDIMIEYYDQ 59

Query: 61  RSKRPGTMLITEGVFPSAKAGGYDNAPGIWTEEQMVEWKKIFDKIHENESFVWPQLWVLG 120
           RS+R G+++I E    SA+AGGYDN PG+W+ EQ+ +W KI   +H N+SF+WPQLW LG
Sbjct: 60  RSRREGSLIIGEAAIISAEAGGYDNIPGVWSGEQLSQWCKIIGVVHRNKSFIWPQLWALG 119

Query: 121 READPLSLARDGLRYDSASDNVWRTXXXXXXXXXXGIEQHGITKDEIKQYIKDYVQGARN 180
           R + P  LAR+G R+ S S+ V+                HG++K E++QY  DY+  A+ 
Sbjct: 120 RISFPEVLAREGYRFVSPSEEVYIDAEQKNEAIRCDNRLHGLSKLEMQQYKTDYINCAKK 179

Query: 181 SIKCGADGIEIHAANGYLLNQFLDPVSNKRTDEYGGSIKNRACFTLEVVDALVDAIGEDK 240
            I  GADGIE+H A G LLNQFLDP+SNKR DEYGGSI+NR  F LE++D L+  IG  +
Sbjct: 180 LINIGADGIELHLAYGCLLNQFLDPISNKRLDEYGGSIENRCKFILEIIDGLIIEIGCRR 239

Query: 241 VGIRLAPYNTNGDMSGSWDPTVFAHYAYVLGKLEKRAQAGKRLAFVHIFEPRVSNPWDNE 300
           VGIRL+P++ +G MSG  DPT+ + Y Y++G+LE++ + G+R+A++H+ EP         
Sbjct: 240 VGIRLSPFDESGGMSGDNDPTLLSTYMYLIGRLEEQGKMGERIAYIHLVEP--------S 291

Query: 301 GDGAYNGGTTDYVYSIWKGVVIRTGNLAIHPEIAKEFL-KQPNTLLGYGRYFISNPDLVD 359
            +    G + D++YSIWKG+VIR GNL  +   AK +L K  NTL+ YG+YFISNPDLV 
Sbjct: 292 RNKKLKGISNDFIYSIWKGIVIRCGNLIYNSNEAKMYLEKHKNTLIAYGKYFISNPDLVT 351

Query: 360 RLEKGLPLNLYDRPRFYAMPDKGYIDYPTYDEAIK 394
           RLEK L LN +D   FY    KGY DY TY+E +K
Sbjct: 352 RLEKKLLLNKFDESTFYTSNSKGYTDYLTYEEEMK 386

>ZYRO0C11924g Chr3 (932751..933917) [1167 bp, 388 aa] {ON} similar
           to uniprot|Q03558 Saccharomyces cerevisiae YHR179W OYE2
           Widely conserved NADPH oxidoreductase containing flavin
           mononucleotide (FMN) homologous to Oye3p with slight
           differences in ligand binding and catalytic properties
           may be involved in sterol metabolism
          Length = 388

 Score =  393 bits (1009), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 190/382 (49%), Positives = 259/382 (67%), Gaps = 15/382 (3%)

Query: 9   PVALKDTDLFKPLKVGNTTVLNRVVLPPLTRMRAHYPGNVPNRDWTLEYYDQRSKRPGTM 68
           PVAL+ T LFKP+KVG   + +R+V+ PLTR+RA  P  +P+ DW   YYDQRSKR G++
Sbjct: 16  PVALRGTKLFKPIKVGGLVLNHRLVMAPLTRLRA--PNGIPHEDWMTTYYDQRSKRTGSL 73

Query: 69  LITEGVFPSAKAGGYDNAPGIWTEEQMVEWKKIFDKIHENESFVWPQLWVLGREADPLSL 128
           +ITEG  P  + GG DNAPG+W+ EQ   W K+  +IH N S+V+ QLW +G +ADPL L
Sbjct: 74  IITEGSVPQPQFGGLDNAPGLWSPEQRRAWTKVIRRIHGNGSYVFIQLWSMGSQADPLIL 133

Query: 129 ARDGLRYDSASDNVWRTXXXXXXXXXXGIEQHGITKDEIKQYIKDYVQGARNSIKCGADG 188
           A+DGL Y SA+D  + +          G  QHG+T+ EI++Y+  +V+ ++  I+ GADG
Sbjct: 134 AKDGLPYVSATDETYVSEELKEKALKAGNPQHGLTQREIQEYVSGFVEASQRCIEMGADG 193

Query: 189 IEIHAANGYLLNQFLDPVSNKRTDEYGGSIKNRACFTLEVVDALVDAIGEDKVGIRLAPY 248
           +EIHAANGYLLNQFLDP SNKR D YGGSI+NR+ F L+VVDA+VD +G  KVGIR++P+
Sbjct: 194 VEIHAANGYLLNQFLDPSSNKRVDTYGGSIENRSRFLLQVVDAVVDRVGSSKVGIRISPF 253

Query: 249 NTNGDMSGSWDPTVFAHYAYVLGKLEKRAQAGKRLAFVHIFEPRVSNPWDNEGDGAYNGG 308
              G MS    PT+ + Y ++LG+LE+RA++G+RLA+VHI +P   N             
Sbjct: 254 CNFGSMSELDIPTLSSQYTHLLGQLEERARSGRRLAYVHIVDPHQRN------------- 300

Query: 309 TTDYVYSIWKGVVIRTGNLAIHPEIAKEFLKQPNTLLGYGRYFISNPDLVDRLEKGLPLN 368
             D+VY++WKG+VIR G LA  P++  + ++   T+L YGRYF SNPDLVDR+E G P  
Sbjct: 301 LNDFVYTVWKGIVIRAGGLATRPQVGVKLVENDRTILSYGRYFTSNPDLVDRIENGWPFT 360

Query: 369 LYDRPRFYAMPDKGYIDYPTYD 390
            YD   F +    GYIDYP ++
Sbjct: 361 PYDPDTFTSGGSGGYIDYPPWE 382

>TBLA0A04730 Chr1 complement(1173457..1174266) [810 bp, 269 aa] {ON}
           
          Length = 269

 Score =  313 bits (803), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 153/270 (56%), Positives = 192/270 (71%), Gaps = 1/270 (0%)

Query: 128 LARDGLRYDSASDNVWRTXXXXXXXXXXGIEQHGITKDEIKQYIKDYVQGARNSIKCGAD 187
           + RDGLRYD+ S +++            GIE+H +T D+I+QYI DYVQ A+NSI+CGAD
Sbjct: 1   MKRDGLRYDAPSFDLFIDEDTRVKLAKLGIERHTLTADDIRQYINDYVQAAKNSIECGAD 60

Query: 188 GIEIHAANGYLLNQFLDPVSNKRTDEYGGSIKNRACFTLEVVDALVDAIGEDKVGIRLAP 247
           GIEIHAAN YLLNQF+DP SN RTD+YGG+I+NR+ F LEVVDA+V AIG +KV IR +P
Sbjct: 61  GIEIHAANSYLLNQFIDPNSNNRTDKYGGTIENRSRFILEVVDAIVAAIGAEKVDIRFSP 120

Query: 248 YNTNGDMSGSWDPTVFAHYAYVLGKLEKRAQAGKRLAFVHIFEPRVSNPWDNEGDGAYNG 307
           +++ G MS   DP + + Y  ++G+LEKRAQ  KRLA++HI+EPR  N    E       
Sbjct: 121 FHSFGGMSPEDDPLIISQYTCLIGQLEKRAQDVKRLAYIHIYEPR-DNIDVGELSEEVET 179

Query: 308 GTTDYVYSIWKGVVIRTGNLAIHPEIAKEFLKQPNTLLGYGRYFISNPDLVDRLEKGLPL 367
              D+VYS+WKG++IRT NL + P + K  LK   TLLGY RYF+SNPDLVDRLE GLPL
Sbjct: 180 FPIDFVYSVWKGIIIRTSNLPLLPNVTKTVLKANRTLLGYRRYFLSNPDLVDRLENGLPL 239

Query: 368 NLYDRPRFYAMPDKGYIDYPTYDEAIKMGW 397
           N YDR   +     GYIDYPTYDEA+KM W
Sbjct: 240 NNYDRATMFTQTKAGYIDYPTYDEALKMNW 269

>KAFR0I00110 Chr9 (21926..22549) [624 bp, 207 aa] {ON} 
          Length = 207

 Score =  243 bits (621), Expect = 6e-79,   Method: Compositional matrix adjust.
 Identities = 104/193 (53%), Positives = 151/193 (78%)

Query: 158 EQHGITKDEIKQYIKDYVQGARNSIKCGADGIEIHAANGYLLNQFLDPVSNKRTDEYGGS 217
           +QHG+TK+EIK ++ D+   A+NS+K GADG+E+H+  G++LNQFLDP SNKRTDEYGGS
Sbjct: 15  QQHGLTKEEIKSFVADFANAAKNSVKAGADGVEVHSTFGFILNQFLDPASNKRTDEYGGS 74

Query: 218 IKNRACFTLEVVDALVDAIGEDKVGIRLAPYNTNGDMSGSWDPTVFAHYAYVLGKLEKRA 277
           I+NR+ FTLEV+DA ++A+G ++VG+RL+P+ T G MSG  DPT+ A YA +LG+LEKR 
Sbjct: 75  IENRSRFTLEVIDACIEAVGAERVGVRLSPWATYGAMSGGEDPTLLATYANILGELEKRG 134

Query: 278 QAGKRLAFVHIFEPRVSNPWDNEGDGAYNGGTTDYVYSIWKGVVIRTGNLAIHPEIAKEF 337
           +AG  LA+VH+ +PR+++P+  EG G Y  G  D+ +SIWKG +I++GNLA++ E+ K+ 
Sbjct: 135 KAGMCLAYVHLIKPRITDPFSPEGQGVYKNGNNDFAHSIWKGPIIKSGNLALNSEVVKDM 194

Query: 338 LKQPNTLLGYGRY 350
           +K   TL+ YG +
Sbjct: 195 VKDARTLISYGTF 207

>ZYRO0F16852g Chr6 complement(1402055..1403068) [1014 bp, 337 aa]
           {ON} similar to uniprot|Q03558 Saccharomyces cerevisiae
           YHR179W OYE2 Widely conserved NADPH oxidoreductase
           containing flavin mononucleotide (FMN) homologous to
           Oye3p with slight differences in ligand binding and
           catalytic properties may be involved in sterol
           metabolism
          Length = 337

 Score =  244 bits (622), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 144/348 (41%), Positives = 203/348 (58%), Gaps = 28/348 (8%)

Query: 12  LKDTDLFKPLKVGNTTVLNRVVLPPLTRMRAHYPGNVPNRDWTL-EYYDQRSKRPGTMLI 70
           L+D ++F P++VG+   L+R V+PPL+RM      ++P +  +L EYY  +S+ PGT++I
Sbjct: 6   LRDPNIFNPIQVGHVRPLHRAVMPPLSRMSTI--DSMPLQLESLPEYYGIKSQTPGTLVI 63

Query: 71  TEGVFPSAKAGGYDNAPGIWTEEQMVEWKKIFDKIHENESFVWPQLWVLGREADPLSLAR 130
            E    S    G       WT ++M  W++IF++IH N S+V+ QL   G  AD   LA 
Sbjct: 64  VESTLLSPPNNG--EVVKAWTPQEMEFWRQIFEQIHMNNSYVFVQLANWGSPADANDLAE 121

Query: 131 DGLRYDSASDNVWRTXXXXXXXXXXGIEQHGITKDE-IKQYIKDYVQGARNSIKCGADGI 189
               +   S N   T          G++    +  E + Q+++DYVQ A+N I  GADG+
Sbjct: 122 S---FGRVSLNANGTDS--------GLQGTDPSNQEFVDQFVRDYVQAAQNCILAGADGV 170

Query: 190 EIHAANGYLLNQFLDPVSNKRTDEYGGSIKNRACFTLEVVDALVDAIGEDKVGIRLAPYN 249
           EIH  NG LLNQFLDP SN R D+YGGSI NRA  TL VV+AL + IG ++VGI  +PY 
Sbjct: 171 EIHHVNGSLLNQFLDPQSNTRADDYGGSIGNRARLTLRVVEALANTIGVERVGISFSPYA 230

Query: 250 TNGDMSGSWDPTVFAHYAYVLGKLEKRAQAGKRLAFVHIFEPRVSNPWDNEGDGAYNGGT 309
           ++            A YAY+LG+LE+ +Q G RLA+VH+ EP VS     EG    N G 
Sbjct: 231 SSSHF------LSVAQYAYILGELERSSQDGNRLAYVHLEEP-VSGSLPPEGQIGPNQGA 283

Query: 310 TDYVYSIWKGVVIRTGNLA----IHPEIAKEFLKQPNTLLGYGRYFIS 353
              +YSIW+G VIR GNL+    +HPE+ ++  K   TL+  GR+F+S
Sbjct: 284 GSLIYSIWRGPVIRAGNLSSYPTLHPEVLEDMAKNDRTLVSDGRFFLS 331

>NDAI0A07930 Chr1 complement(1823416..1823859) [444 bp, 147 aa] {ON}
           
          Length = 147

 Score =  220 bits (561), Expect = 8e-71,   Method: Compositional matrix adjust.
 Identities = 99/147 (67%), Positives = 123/147 (83%)

Query: 254 MSGSWDPTVFAHYAYVLGKLEKRAQAGKRLAFVHIFEPRVSNPWDNEGDGAYNGGTTDYV 313
           MSG  DPT+ A YAYVLG+LEKRA+AGKRLAFVH+ EPRV+NP+  EG+G YN GT D+ 
Sbjct: 1   MSGGADPTLLAQYAYVLGELEKRAKAGKRLAFVHLVEPRVTNPFMTEGEGEYNDGTNDFA 60

Query: 314 YSIWKGVVIRTGNLAIHPEIAKEFLKQPNTLLGYGRYFISNPDLVDRLEKGLPLNLYDRP 373
           YSIWKGV+IR GNLA+HPE+A+E +    TLLGYGR+FI+NPDLV+RL KGLPLN Y+R 
Sbjct: 61  YSIWKGVIIRAGNLALHPEVARELVANDRTLLGYGRFFIANPDLVERLAKGLPLNKYNRD 120

Query: 374 RFYAMPDKGYIDYPTYDEAIKMGWGEK 400
            FYAM  +GY+DYPTY+EA+K+GW ++
Sbjct: 121 TFYAMTQEGYLDYPTYEEALKLGWDKQ 147

>ZYRO0G15444g Chr7 (1256468..1257487) [1020 bp, 339 aa] {ON} weakly
           similar to uniprot|Q03558 Saccharomyces cerevisiae
           YHR179W OYE2 Widely conserved NADPH oxidoreductase
           containing flavin mononucleotide (FMN) homologous to
           Oye3p with slight differences in ligand binding and
           catalytic properties may be involved in sterol
           metabolism
          Length = 339

 Score =  174 bits (442), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 122/353 (34%), Positives = 181/353 (51%), Gaps = 75/353 (21%)

Query: 16  DLFKPLKVGNTTVLNRVVLPPLTRMRAHYPGNVPNRDWTLEYYDQRS-KRPGTMLITEGV 74
           D  +P+ V    + +R+V  P       + G  P       + +++S K PG+++I  G+
Sbjct: 10  DFHRPIAVDGLKLDHRLVRVP------GFQGKHP-------FCEKKSMKEPGSLVIAGGI 56

Query: 75  FPS----------------AKAGGYDNAPGIWTEEQMVEWKKIFDKIHENESFVWPQLWV 118
           FP                  K  GY       ++ QM  WK+   KIH + SFV+ QL+ 
Sbjct: 57  FPQWDDRDDDDDIANIDDNQKYSGY-------SKLQMQVWKESCRKIHASGSFVFVQLFS 109

Query: 119 LGR-EADPLSLARDGLRYDSASDNVWRTXXXXXXXXXXGIEQHGITKDEIKQYIKDYVQG 177
           + +      S  R+G   +   DN   +                +T++EI+ YI  YV+ 
Sbjct: 110 IDKLGGQEFSETRNG---EGLVDNFVNS----------------LTREEIQLYIDAYVRA 150

Query: 178 ARNSIKCGADGIEIHAANGYLLNQFLDPVSNKRTDEYGGSIKNRACFTLEVVDALVDAIG 237
           A+ S+  GADG+E+H A GYLL+ FL+  +N+R DEYGGSI NRA F LEVVDA+V AIG
Sbjct: 151 AKTSLMFGADGVELHGAAGYLLDGFLNAKTNRRADEYGGSIANRAKFILEVVDAIVKAIG 210

Query: 238 EDKVGIRLAPYNTNGDMSGSWDPTVFAHYAYVLGKLEKRAQAGKRLAFVHIFEPRVSNPW 297
             ++ I L+P   +         ++   Y+Y+LG+LEKRA  G+RLA++H+ E    +P 
Sbjct: 211 SSRISICLSPSEKH--------ISLVTQYSYLLGQLEKRAVWGQRLAYIHLEE----SPV 258

Query: 298 DNEGDGAY-NGGTTDYVYSIWKGVVIRTGNLAIHPEIAKEFLKQPNTLLGYGR 349
           D E D     GG+  +VYSIW+G+VIR      H E+  E  K   TL+ Y R
Sbjct: 259 DLEEDQIRPFGGSHSFVYSIWRGIVIRG-----HSELTDELKKCDQTLIAYER 306

>TBLA0D03350 Chr4 (835570..836055) [486 bp, 161 aa] {ON}  OYE
           family; probable pseudogene; frameshifts relative to
           other OYE gene family members
          Length = 161

 Score =  156 bits (394), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 74/143 (51%), Positives = 100/143 (69%)

Query: 1   MPFNTESKPVALKDTDLFKPLKVGNTTVLNRVVLPPLTRMRAHYPGNVPNRDWTLEYYDQ 60
           MPFNTE KPV+LK T LFKP+KVG T VL+R ++PPL +MRA    ++ N + ++EY+ Q
Sbjct: 1   MPFNTEFKPVSLKHTTLFKPMKVGKTMVLHRAIIPPLNKMRADPETHILNEELSIEYHGQ 60

Query: 61  RSKRPGTMLITEGVFPSAKAGGYDNAPGIWTEEQMVEWKKIFDKIHENESFVWPQLWVLG 120
           RS+ PGTM+ITE    S +AGGY  +P I+++ QM  W+K F KIHEN+SF W QL+ LG
Sbjct: 61  RSQSPGTMIITEPGNISPEAGGYAGSPVIYSKVQMEVWQKFFSKIHENKSFAWVQLYALG 120

Query: 121 READPLSLARDGLRYDSASDNVW 143
            +A P  L  +G +Y SAS   +
Sbjct: 121 SQASPKFLKANGYKYVSASAGAY 143

>Smik_6.368 Chr6
           (596883..597008,597012..597242,597246..597401,
           597415..597468,597472..597489,597493..597612,
           597616..597696,597695..597847,597849..597893) [984 bp,
           328 aa] {OFF} YPL171C (PSEUDO)
          Length = 328

 Score =  146 bits (368), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 118/369 (31%), Positives = 175/369 (47%), Gaps = 51/369 (13%)

Query: 33  VLPPLTRMRAHYPGNVPNRDWTLEYYDQRSKRPGTMLITEGVFPSAKAGGYDNAPGIWTE 92
           V  PLT M+  + GN PN+     Y+       G ++I    +P ++          W  
Sbjct: 4   VRAPLTEMKGIHLGNAPNKKCAAVYH-------GQVMIEVISYPLSRLR--------WLN 48

Query: 93  EQMVEWKKIFDKIHENESFVWPQLWVLGREADPLSLARDGLRYDSASDNVWR-TXXXXXX 151
           E++         IH   SF W +    G    P     +   Y++    + R T      
Sbjct: 49  EKIS-----LLAIHFIRSFAWVEFLFYGWSIFP-----EYTSYETGCAKIVRLTECTSML 98

Query: 152 XXXXGIE----QHGITKDEIKQYIKDYVQGARNSIKCGADGIEIHAANGYLLNQFLDPVS 207
               G E    +H + KD++  Y+++Y   + N I  GAD +EI + N YLLN+FLD  S
Sbjct: 99  RSTRGHEGQHPEHSLIKDDM-NYLENYTHVSMNFIAVGADTVEIDSVNEYLLNRFLDLNS 157

Query: 208 NKRTDEYGGSIKNRACFTLEVVDALVDAIGEDKVGIRLAPYNTNGDMSGSWDPTVFA-HY 266
           +K+TDEYG + +NR            + IG  ++G++ +PY  +G     W  T F    
Sbjct: 158 SKKTDEYGETTENR------------ETIGLVRMGLKSSPY--SGFQYVCWWITYFRPKN 203

Query: 267 AYVLGKLEKRAQAGKRLAFVHIFEPRVSNPWDNEGDGAYNGGTTDYVYSIWKGVVIRTGN 326
             +LG LEKR  +   LAFVH+ +     P  ++ +      TT+  +SIWKG++IRT N
Sbjct: 204 VSILGGLEKRPNSIWLLAFVHLVD-LCHGPTASQSEDI-PESTTNLAHSIWKGLIIRTCN 261

Query: 327 -LAIHPEIAKEFLKQPNTLLGYGRYFISNPDLVDRLEKGLPLNLYDRPRFYAMPDKGYID 385
             A+H E+A E  K P+ L  Y   FISN DL +RLE+ LPLN       Y +  +   D
Sbjct: 262 FFALHLEVAGEQPKDPSRLTSYNILFISNFDLTNRLEESLPLN--KAGLHYTVSAEDCTD 319

Query: 386 YPTYDEAIK 394
           Y  YDEAI+
Sbjct: 320 YSNYDEAIE 328

>NDAI0C04500 Chr3 complement(1020217..1020462) [246 bp, 81 aa] {ON} 
          Length = 81

 Score =  106 bits (265), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 49/72 (68%), Positives = 58/72 (80%)

Query: 238 EDKVGIRLAPYNTNGDMSGSWDPTVFAHYAYVLGKLEKRAQAGKRLAFVHIFEPRVSNPW 297
           + K GIRL+PY T G MSG  DPT+ A YAYVLG+LEKRA+AGKRLAFVH+ EPRV+NP+
Sbjct: 9   KTKFGIRLSPYGTFGTMSGGADPTLLAQYAYVLGELEKRAKAGKRLAFVHLVEPRVTNPF 68

Query: 298 DNEGDGAYNGGT 309
             EG+G YN GT
Sbjct: 69  MTEGEGEYNDGT 80

>KAFR0B04485 Chr2 (930962..931780) [819 bp, 272 aa] {ON}
          Length = 272

 Score =  105 bits (262), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 90/341 (26%), Positives = 155/341 (45%), Gaps = 82/341 (24%)

Query: 9   PVALKDTDLFKPLKVGNTTVLNRVVLPPLTRMRAHYPGNVPNRDWTLEYYDQRSKRPGTM 68
           P  L+DT+L + L +G   +L+R+V  P T+ R +Y          L  +D +S RPGT+
Sbjct: 9   PEQLRDTNLTESLCIGPYEILHRIV--PSTK-RVNYNH--------LCQFDLKSNRPGTL 57

Query: 69  LITEGVFPSAKAGGYDNAPGIWTEEQMVEWKKIFDKIHENESFVWPQL-WVLGREADPLS 127
           +I     P   +   +N             K I +++  N SF+W  + + +   AD   
Sbjct: 58  IIN----PIPPSCTLEN------------LKNIVEQVQVNGSFIWISVEFSISGVAD--- 98

Query: 128 LARDGLRYDSASDNVWRTXXXXXXXXXXGIEQHGITKDEIKQYIKDYVQGARNSIKCGAD 187
              +G+  D    ++ +             EQ  +  + +K                  +
Sbjct: 99  --FNGMTRDQIYTSIRKVQ-----------EQVSVIMEHVK-----------------PN 128

Query: 188 GIEIHAANGYLLNQFLDPVSNKRTDEYGGSIKNRACFTLEVVDALVDAIGEDKVGIRLAP 247
           GIEI A    +++Q L  + N RTDE+GGSI+NR+C  + ++  L+  +    + +++ P
Sbjct: 129 GIEIDATCD-VISQSLHSMKNSRTDEFGGSIQNRSCLLMTIIKELLKVVPSQVLSVKVNP 187

Query: 248 YNTNGDMSGSWDPTVFAHYAYVLGKLEK-RAQAGKRLAFVHIFEPRVSNPWDNEGDGAYN 306
           +    D+    DP   A YAY+ G+LE  R   G  ++F+H+ EP  +    N       
Sbjct: 188 FQ---DLET--DPICLAEYAYIFGELESWRRTNGITISFIHLEEPLHNFDVSN------- 235

Query: 307 GGTTDYVYSIWKGVVIRTGNLA-IHPEIAKEFLKQPNTLLG 346
               ++V+++WKGVV+R GN   IH    K+ +K   TL+ 
Sbjct: 236 ----NFVHAVWKGVVVREGNFRDIHT--IKDLMKNDKTLIA 270

>CAGL0K05687g Chr11 (555370..556536) [1167 bp, 388 aa] {ON} similar
           to uniprot|Q03558 Saccharomyces cerevisiae YHR179w OYE2
           or uniprot|P41816 Saccharomyces cerevisiae YPL171c OYE3
          Length = 388

 Score = 94.0 bits (232), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 94/348 (27%), Positives = 150/348 (43%), Gaps = 36/348 (10%)

Query: 17  LFKPLKVGNTTVLNRVVLPPLTRMRAHYPGNVPNRDWTLEYYDQRSKRPGTMLITEGVFP 76
           LFKPLK+    + NR+ + P   M  +   N    D+ L +Y   + R   ++I E    
Sbjct: 42  LFKPLKIRALEIPNRIGVSP---MCTYSTNNYMPTDFHLMHYGSLATRGPGIIIVECSAV 98

Query: 77  SAKAGGYDNAPGIWTEEQMVE-WKKIFDKIHENESFVWPQLWVLGREADPLSLARDGLRY 135
           S       N  GIW +EQ  E + KI    H     V  QL    R+          +  
Sbjct: 99  SEGTAVTVNDMGIWNKEQASEHFSKIVKFAHSQNVIVGCQLGQFMRKV------VQNVDE 152

Query: 136 DSASDNVWRTXXXXXXXXXXGIEQHGITKDEIKQYIKDYVQGARNSIKCGA-DGIEIHAA 194
           D+ + NV             G E H ++ +EIK  ++ +   A+ +++    D IEI A 
Sbjct: 153 DNKAHNV-----------EVGKEAHDLSTEEIKTIVEQWGTAAKLAVEVAKYDFIEIQAG 201

Query: 195 NGYLLNQFLDPVSNKRTDEYGGSIKNRACFTLEVVDALVDAIGEDK-VGIRLAPYNTNGD 253
            G++ N+F   ++NKR DEYGGS +NR    LE++D +   I ED  + IRL   + N D
Sbjct: 202 KGHITNEFFSRLTNKRKDEYGGSFENRIRILLEIIDNVRKNIPEDTPLFIRLKACD-NLD 260

Query: 254 MSGSW--DPTVFAHYAYVLGKLEKRAQAGKRLAFVHIFEPRVSNPWDNEGDGAYNGGTTD 311
              +W  D T+   +      ++    AG+ L      E      +  +   A+ G T  
Sbjct: 261 HPDAWSTDETIKLSFELAKHGVDVLDIAGRGLRIGPKSEKENKIIFLQQLKEAHKGKT-- 318

Query: 312 YVYSIWKGVVIRTGNLAIHPEIAKEFL-KQPNTLLGYGRYFISNPDLV 358
                   ++I +  +    + A E L K+   ++  GR F+ NP+LV
Sbjct: 319 -------NLLIASSGVISTADYASELLDKEAQDIILVGRPFLKNPNLV 359

>SAKL0C01738g Chr3 complement(147860..149149) [1290 bp, 429 aa] {ON}
           conserved hypothetical protein
          Length = 429

 Score = 93.2 bits (230), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 72/251 (28%), Positives = 111/251 (44%), Gaps = 11/251 (4%)

Query: 17  LFKPLKVGNTTVLNRVVLPPLTRMRAHYPGNVPNRDWTLEYYDQRSKRPGTMLITEGVFP 76
           LF PL V + T  NR+ + P+    +     +P     + Y    ++ PG M+I E    
Sbjct: 44  LFSPLTVRSLTFPNRIGVSPMCTYSSD--NYIPTLYHAIHYGAMAARGPG-MIIVEATAI 100

Query: 77  SAKAGGYDNAPGIWTEEQM-VEWKKIFDKIHENESFVWPQLWVLGREADPLSLARDGLRY 135
                   N  GIWTE+Q    +K+I +  H     +  QL   GR+A   +L +   R 
Sbjct: 101 DQPGAVSPNDLGIWTEKQAHAHYKQIVEFAHSQNCAIGLQLSHGGRKAGGAALYKHLERT 160

Query: 136 DSASDNVWR------TXXXXXXXXXXGIEQHGITKDEIKQYIKDYVQGARNSIKCGA-DG 188
            +  +  W       +              H +T+ EI   ++ +   A+ + +    D 
Sbjct: 161 LTKEEGGWPGNLVAPSPGAFRPGYAYSGRPHELTRCEIHDLVRKWGHAAKLAAEIARYDF 220

Query: 189 IEIHAANGYLLNQFLDPVSNKRTDEYGGSIKNRACFTLEVVDALVDAIGEDKVGIRLAPY 248
           +EIHAA+GYL+++F    SNKR DEYGGS +NR  F LE+VD +   I E          
Sbjct: 221 VEIHAAHGYLISEFYSATSNKRKDEYGGSFENRTRFLLEIVDEVRRNIPEGMPLFMRISA 280

Query: 249 NTNGDMSGSWD 259
           + N D  G+W 
Sbjct: 281 SENSDEPGAWS 291

>KAFR0D04090 Chr4 (808332..809477) [1146 bp, 381 aa] {ON} Anc_1.53
          Length = 381

 Score = 90.9 bits (224), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 73/259 (28%), Positives = 117/259 (45%), Gaps = 37/259 (14%)

Query: 3   FNTESKPVALKDTDLFKPLKVGNTTVLNRVVLPPLTRMRAHYPGNVPNRDWTLEYYDQRS 62
             TE++P AL     FKPLK+ +  + NR+ + P+    A    N    D+   +Y   +
Sbjct: 32  LETENEPPAL-----FKPLKIRSLVIPNRIAVAPMCLYSA---DNFKPTDFHQVHYGSLA 83

Query: 63  KRPGTMLITEGVFPSAKAGGYDNAPGIWTEEQMVEWK-KIFDKIHENESFVWPQLWVLGR 121
            R   ++I E            N  G+WTE+Q ++ + KI +  H   S +  QL     
Sbjct: 84  SRGPGLIIVECAAVEKNGRITMNDLGLWTEDQAIKHREKIVNFAHSQNSIIGIQL----- 138

Query: 122 EADPLSLARDGLRYDSASDNVWRTXXXXXXXXXXGIEQHGITKDEIKQYIKDYVQGARNS 181
                   +  + Y++    V R             E H ++  EIKQ IK +   +  +
Sbjct: 139 -------GQYNVSYETGQSEVIR-------------EPHNLSSAEIKQMIKQWGDASELA 178

Query: 182 IK-CGADGIEIHAANGYLLNQFLDPVSNKRTDEYGGSIKNRACFTLEVVDALVDAI-GED 239
           IK  G D IEI A +G++ + F   + NKR DEYGGS +NR  F ++VVD +   +  E 
Sbjct: 179 IKTAGYDFIEIQATHGHMPDTFCSSLLNKRNDEYGGSFENRTRFLIKVVDEIRSRVPAEV 238

Query: 240 KVGIRLAPYNTNGDMSGSW 258
            + +RL P     + + +W
Sbjct: 239 PIFVRL-PDCEKSESAAAW 256

>KLLA0C01672g Chr3 complement(131543..132772) [1230 bp, 409 aa] {ON}
           weakly similar to uniprot|P41816 Saccharomyces
           cerevisiae YPL171C OYE3 Widely conserved NADPH
           oxidoreductase containing flavin mononucleotide (FMN)
          Length = 409

 Score = 78.2 bits (191), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 67/226 (29%), Positives = 100/226 (44%), Gaps = 9/226 (3%)

Query: 17  LFKPLKVGNTTVLNRVVLPPLTRMRAHYPGNVPNRDWTLEYYDQRSKRPGTMLITEGVFP 76
           LF+PL +   T+ NRV   P+    +    N     + L +Y   S     ++I E    
Sbjct: 40  LFQPLTIRGMTISNRVGTSPMCTYSSE---NFEANKYHLVHYGSISSSGPGLVIVESSAI 96

Query: 77  SAKAGGYDNAPGIWTEEQMVEWKK-IFDKIHENESFVWPQLWVLGREADPLSLARDGL-R 134
                   N  G++T+EQ +  K+ I D  H +   +  QL   GR+A   S     L  
Sbjct: 97  DQIGASSPNDLGLFTDEQAITHKENIVDWAHVHNIKIGVQLGHAGRKASLASPLNGELGV 156

Query: 135 YDSASDNVWRTXXXXXXXX---XXGIEQHGITKDEIKQYIKDYVQGARNSI-KCGADGIE 190
           Y    +  W               G+  + +T  +I++ IK Y   A+ ++ K G D +E
Sbjct: 157 YVPNEEGGWLDKLVAPSTVPFDDSGVIPNELTLAQIEKTIKQYGISAKLAVEKAGYDFVE 216

Query: 191 IHAANGYLLNQFLDPVSNKRTDEYGGSIKNRACFTLEVVDALVDAI 236
           IHA  GYL  QF    +NKR D YGG  +NR  F LEV+D +  +I
Sbjct: 217 IHAGYGYLPCQFYTATANKRNDRYGGPFENRIKFLLEVIDEVRSSI 262

>Kpol_2000.91 s2000 (205107..206255) [1149 bp, 382 aa] {ON}
           (205107..206255) [1149 nt, 383 aa]
          Length = 382

 Score = 63.2 bits (152), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 63/245 (25%), Positives = 111/245 (45%), Gaps = 32/245 (13%)

Query: 17  LFKPLKVGNTTVLNRVVLPPLTRMRAHYPGNVPNRDWTLEYYDQRSKRPGTMLITE--GV 74
           LF+ LK+   T  NR+ + P   M  +   N    D+   +Y   + R   M++ E  GV
Sbjct: 39  LFESLKIRGLTFPNRIGVSP---MCTYSSDNNEPTDFHQVHYGAWATRGCGMIVVECTGV 95

Query: 75  FPSAKAGGYDNAPGIWTEEQMVE-WKKIFDKIHENESFVWPQLWVLGREADPLSLARDGL 133
            P        N  G+W++ Q  + ++KI +  H   + +  QL   G + D  ++A +  
Sbjct: 96  DPDGLTS--PNDLGLWSKHQATKHFQKIVEFAHSQNTNIGIQLGHYGLKKDITAMADE-- 151

Query: 134 RYDSASDNVWRTXXXXXXXXXXGIEQHGITKDEIKQYIKDYVQGARNSIKCGA-DGIEIH 192
                  +++R               H  TK  I+  +K +   A+ ++     D IEI 
Sbjct: 152 -----EQSLYRP--------------HEYTKKMIQDIVKKWGHAAKLAVNNAHYDFIEIQ 192

Query: 193 AANGYLLNQFLDPVSNKRTDEY-GGSIKNRACFTLEVVDALVDAIGED-KVGIRLAPYNT 250
           A +G+L+++F+    N R DEY GGS   R    ++VVD +   IG+   + +RL+  ++
Sbjct: 193 AGHGHLISEFMSCEKNMRDDEYGGGSFATRVQLLMDVVDEVRKNIGDQVPIFLRLSTASS 252

Query: 251 NGDMS 255
             +MS
Sbjct: 253 MEEMS 257

>Skud_16.110 Chr16 complement(198564..198761,198765..198776) [210
           bp, 70 aa] {ON} YHR179W (REAL)
          Length = 70

 Score = 48.9 bits (115), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 25/40 (62%), Positives = 28/40 (70%)

Query: 190 EIHAANGYLLNQFLDPVSNKRTDEYGGSIKNRACFTLEVV 229
           +I  ANGYLLN+  DP SN R  EYGG I+N A F LEVV
Sbjct: 31  KISGANGYLLNKLSDPYSNGRIVEYGGFIENGARFPLEVV 70

>TPHA0B04740 Chr2 (1116411..1117592) [1182 bp, 393 aa] {ON} Anc_1.53
          Length = 393

 Score = 53.1 bits (126), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 58/239 (24%), Positives = 96/239 (40%), Gaps = 25/239 (10%)

Query: 1   MPFNTESKPVALKDTDLFKPLKVGNTTVLNRVVLPPLTRMRAHYPGNVPNRDWTLEYYDQ 60
           + +N   K   L    LF PL + +T   NR+ + P   M  +   N    ++   +Y  
Sbjct: 26  VTYNDSLKGENLAPPKLFHPLAIRDTVFPNRIGVSP---MCTYSSNNHEPTEFHQVHYGA 82

Query: 61  RSKRPGTMLITEGVFPSAKAGGYDNAPGIWTEEQMVEWKKIFDKIHENESFVWPQLWVLG 120
            + R   M+I E            N  GIW +       K ++KI E   F   Q   +G
Sbjct: 83  WASRGCGMIIVECTGVDEAGMISSNDLGIWNKYLA---DKHYEKIVE---FAHSQNCKIG 136

Query: 121 READPLSLARDGLRYDSASDNVWRTXXXXXXXXXXGIEQHGITKDEIKQYIKDYVQGARN 180
            +       ++     +  D++++                 + K  IK+ ++ +   A  
Sbjct: 137 VQLGHCGCKKEMTATGNEIDSLYKPAE--------------LDKKSIKEIVRRWGHAANL 182

Query: 181 SIKCGA-DGIEIHAANGYLLNQFLDPVSNKRTDEYGG-SIKNRACFTLEVVDALVDAIG 237
           ++     D IEI   +G L+++FL+  +N RTDEYGG S  NR     EVV  +   IG
Sbjct: 183 AVNVAHYDFIEIQGGHGNLISEFLNKNTNHRTDEYGGSSFANRCRLLNEVVTEVRKEIG 241

>Kwal_47.17519 s47 (437989..438186) [198 bp, 65 aa] {ON} YHR179W
           (OYE2) - NAPDH dehydrogenase (old yellow enzyme),
           isoform 2 [contig 207] FULL
          Length = 65

 Score = 45.4 bits (106), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 22/38 (57%), Positives = 27/38 (71%)

Query: 106 HENESFVWPQLWVLGREADPLSLARDGLRYDSASDNVW 143
           HENES+   QLWVL REA P  L R+ LRY+ AS+ V+
Sbjct: 8   HENESYTGVQLWVLDREAFPDFLERNDLRYNFASEEVY 45

>Skud_16.109 Chr16 complement(198429..198530) [102 bp, 34 aa] {ON}
           YHR179W (REAL)
          Length = 34

 Score = 41.6 bits (96), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 19/28 (67%), Positives = 21/28 (75%)

Query: 345 LGYGRYFISNPDLVDRLEKGLPLNLYDR 372
           +GYG  FISN  LVDRL KGL LN +DR
Sbjct: 1   IGYGMLFISNAGLVDRLRKGLLLNKHDR 28

>NDAI0F04370 Chr6 (1070446..1071753) [1308 bp, 435 aa] {ON} Anc_1.53
          Length = 435

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 47/223 (21%), Positives = 91/223 (40%), Gaps = 31/223 (13%)

Query: 17  LFKPLKVGNTTVLNRVVLPPLTRMRAHYPGNVPNRDWTLEYYDQRSKRPGTMLITEGVFP 76
           LF+P K+ N TV NR+ + P+         N    ++   +Y   S +   ++I E    
Sbjct: 70  LFQPFKIKNLTVPNRIAVSPMCLYSTSKIENYKPTNFHQIHYGALSLKGPGLIIVECTAV 129

Query: 77  SAKAGGYDNAPGIWTEEQMVEWK-KIFDKIHENESFVWPQLWVLGREADPLSLARDGLRY 135
           S +     N  G+W+ EQ +E + KI +  H+  S +  QL  L           D L  
Sbjct: 130 SPRGLITPNDLGLWSYEQAIEHRNKIVNFAHDCNSLIGIQLGYL-----------DNLHV 178

Query: 136 DSASDNVWRTXXXXXXXXXXGIEQHGITKDEIKQYI-KDYVQGARNSIKCGA-DGIEIHA 193
               +                 +Q   + D++ + I K++   A+ +I     D IEI  
Sbjct: 179 GEGRET----------------KQDSTSFDDLLESIRKEWTDSAKLAIDVAKYDFIEIQG 222

Query: 194 ANGYLLNQFLDPVSNKRTDEYGGSIKNRACFTLEVVDALVDAI 236
            +G++ +  ++ + N    +   +   + C  L+++D++   I
Sbjct: 223 DHGHIFDS-INNIDNNTPLKLASNDNAKFCLVLKIIDSIRSVI 264

>KNAG0F00300 Chr6 complement(35309..36340) [1032 bp, 343 aa] {ON}
           Anc_1.53
          Length = 343

 Score = 37.0 bits (84), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 44/219 (20%), Positives = 83/219 (37%), Gaps = 42/219 (19%)

Query: 17  LFKPLKVGNTTVLNRVVLPPLTRMRAHYPGNVPNRDWTLEYYDQRSKRPGTMLI-TEGVF 75
           LF PLK+ + TV NR+ + P+    A    + P     + Y     + PG +++    V 
Sbjct: 22  LFTPLKIKSLTVPNRIGVSPMCMNSA--VDSKPTNFHQVHYGALALRGPGLIIVECSAVS 79

Query: 76  PSAKAGGYDNAPGIWTEEQMVE-WKKIFDKIHENESFVWPQLWVLGREADPLSLARDGLR 134
           P       D   G+W E      +  I +  H++   +  QL                  
Sbjct: 80  PDGINSSRD--LGLWDEMTAKHHYSSIVEFAHQHRGVIGCQLG----------------S 121

Query: 135 YDSASDNVWRTXXXXXXXXXXGIEQHGITKDEIKQYIKDYVQGARNSIKCGA-DGIEIHA 193
           + S   + W                   + ++I+  + D+ + ++ +++    D +EI  
Sbjct: 122 FKSPPIDHW-------------------SSEDIRASVDDWAKSSKLAVEVARYDFVEIQG 162

Query: 194 ANGYLLNQFLDPVSNKRTDEYGGSIKNRACFTLEVVDAL 232
           + G     FL   +N R D YGG   NR  + L++  ++
Sbjct: 163 SYGSPAQNFLFSATNHRQDCYGGPPSNRMRYLLDLARSV 201

>NDAI0C03920 Chr3 (890187..892775) [2589 bp, 862 aa] {ON} Anc_5.285
          Length = 862

 Score = 33.9 bits (76), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 34/114 (29%), Positives = 48/114 (42%), Gaps = 18/114 (15%)

Query: 2   PFNTESKPVALKDTDLFKPLKVG--------NTTVLNRVVLPPLTRMRAHYPGNVPNRDW 53
           P N + K  AL+    FK  K+         + TVLN+ +  P+  MRAH  G V    W
Sbjct: 716 PSNNDEKIAALRTLGRFKDAKLLERTLGYLLDGTVLNQDIYIPMQGMRAHKEGIVALWGW 775

Query: 54  TLEYYDQRSKR--PGTMLITEGVFPSAKAGGYDNAPGIWTEEQMVEWKKIFDKI 105
               + + SKR  PG  ++  G   +    G+ +   I       E K  FDKI
Sbjct: 776 LQANWTEVSKRLPPGLSML--GSVVTICTSGFTSFKAI------DEIKAFFDKI 821

>Ecym_5296 Chr5 complement(599170..599454,599532..599573) [327 bp,
           108 aa] {ON} similar to Ashbya gossypii AEL001C
          Length = 108

 Score = 31.2 bits (69), Expect = 1.6,   Method: Composition-based stats.
 Identities = 16/43 (37%), Positives = 23/43 (53%), Gaps = 4/43 (9%)

Query: 256 GSWDPTVFAHYAYVLGKLEKRAQAGKRLAFVHIFEPRVSNPWD 298
           G+ DP+V ++ A    K+EKR  A    + VH F   +  PWD
Sbjct: 16  GTSDPSVSSYVA----KIEKRILASDLKSTVHSFGTTIEGPWD 54

>TPHA0G03430 Chr7 (731482..732750) [1269 bp, 422 aa] {ON} Anc_2.519
          Length = 422

 Score = 32.7 bits (73), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 16/60 (26%), Positives = 30/60 (50%)

Query: 320 VVIRTGNLAIHPEIAKEFLKQPNTLLGYGRYFISNPDLVDRLEKGLPLNLYDRPRFYAMP 379
            ++R  +L    E  K+F ++ N+L  Y  YF++N D  +  +K     +  R +F  +P
Sbjct: 90  TLVRNSDLDNMLETIKQFEERFNSLFHYDWYFMNNEDFTEDFKKKTTELISGRTKFIKIP 149

>CAGL0E06226g Chr5 complement(623237..625826,626688..626872) [2775
           bp, 924 aa] {ON} highly similar to uniprot|P32454
           Saccharomyces cerevisiae YKL157w APE2 or uniprot|P37898
           Saccharomyces cerevisiae YHR047c AAP1
          Length = 924

 Score = 32.3 bits (72), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 25/98 (25%), Positives = 43/98 (43%), Gaps = 12/98 (12%)

Query: 2   PFNTESKPVALKDTDLFKPLKVGNTT--------VLNRVVLPPLTRMRAHYPGNVPNRDW 53
           P +T+ K  AL+    FK   + + T        VLN+ +  P+  MRAH  G      W
Sbjct: 779 PVSTDEKLAALRTLGRFKEADLLDRTLGYLFDGTVLNQDIYIPMQGMRAHKEGVTALWKW 838

Query: 54  TLEYYDQRSKR--PGTMLITEGVFPSAKAGGYDNAPGI 89
             E +D+ ++R  PG  ++  G   +    G+ +   +
Sbjct: 839 LQENWDEIARRLPPGLSML--GSVVAISTSGFSSLEAV 874

>NCAS0F02430 Chr6 (480483..483071) [2589 bp, 862 aa] {ON} Anc_5.285
           YHR047C
          Length = 862

 Score = 31.2 bits (69), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 37/79 (46%), Gaps = 10/79 (12%)

Query: 2   PFNTESKPVALKDTDLFKPLKVG--------NTTVLNRVVLPPLTRMRAHYPGNVPNRDW 53
           P N + K  AL+    FK  K+         + TVLN+ +  P+  MR+H  G      W
Sbjct: 716 PINNDEKLAALRTLGRFKDSKLLERTLSYLLDGTVLNQDIYIPMQGMRSHKEGIEALWGW 775

Query: 54  TLEYYDQRSKR--PGTMLI 70
             + +D+ SKR  PG  ++
Sbjct: 776 LQKNWDEVSKRLPPGLSML 794

>KLLA0C11715g Chr3 (1008738..1010867) [2130 bp, 709 aa] {ON} similar
           to uniprot|P40094 Saccharomyces cerevisiae YER157W COG3
           Essential component of the conserved oligomeric Golgi
           complex (Cog1p through Cog8p) a cytosolic tethering
           complex that functions in protein trafficking to mediate
           fusion of transport vesicles to Golgi compartments
          Length = 709

 Score = 30.8 bits (68), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 29/110 (26%), Positives = 43/110 (39%), Gaps = 14/110 (12%)

Query: 160 HGITKDEIKQYIKDYVQGARNSIKCGADGIEIHAANGYLLNQFLDPVSNKRTDEYGGSIK 219
           +GITK    Q  KDY+  +    K     +E+  +    L    D +SN  T++      
Sbjct: 596 NGITKTAADQITKDYLSISETGDKLLEQNMEVRKSIEINLVSIFDQISNFITND------ 649

Query: 220 NRACFTLEVVDALVDAIGEDKVGIRLAPYNTNGDMSGSWDPTVFAHYAYV 269
                  EV   LVDAI ++ V    + Y T  D S   D    +   Y+
Sbjct: 650 -------EVKSHLVDAIQQEVVSRYASYYETLAD-SAKIDSQKLSEIMYI 691

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.138    0.433 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 46,455,612
Number of extensions: 2088402
Number of successful extensions: 4406
Number of sequences better than 10.0: 100
Number of HSP's gapped: 4400
Number of HSP's successfully gapped: 101
Length of query: 400
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 288
Effective length of database: 40,638,807
Effective search space: 11703976416
Effective search space used: 11703976416
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 67 (30.4 bits)