Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0D03280singletonON58058028950.0
TBLA0D032708.843ON55054517660.0
Kpol_541.168.843ON52847915090.0
Skud_13.258.843ON53752214840.0
YML116W (ATR1)8.843ON54251814530.0
Suva_13.278.843ON55352214350.0
TPHA0C047908.843ON55648014320.0
NDAI0E002808.843ON54956914220.0
Smik_13.188.843ON54554014070.0
KNAG0J002608.843ON55052813830.0
TDEL0B005508.843ON53749013790.0
SAKL0D01386g8.843ON52148913770.0
NCAS0B002908.843ON54247013710.0
NCAS0A02540singletonON53949813650.0
Kwal_27.102458.843ON51548713590.0
Suva_13.4678.843ON54348013590.0
CAGL0B02343g8.843ON53748913570.0
Skud_13.4518.843ON53948613540.0
KLTH0C03806g8.843ON52549513520.0
TBLA0C01160singletonON60058213580.0
CAGL0M03003g8.843ON55848313520.0
KNAG0G034308.843ON54247813460.0
KAFR0B03930singletonON55552313460.0
YMR279C8.843ON54047913341e-179
Smik_13.4928.843ON54348913331e-179
NDAI0K004008.843ON55350113291e-178
KAFR0B039408.843ON54749313201e-177
NCAS0C004008.843ON51748212741e-170
KAFR0A028408.843ON52045312321e-164
Smik_15.560na 1ON5165088421e-105
YOR378Wna 1ON5155078221e-102
Skud_15.545na 1ON5164828101e-101
Suva_8.435na 1ON5155097855e-97
Kwal_23.6547na 1ON5115007715e-95
KLTH0C10560gna 1ON5154697578e-93
KLLA0B00352gna 1ON4984327104e-86
TDEL0G04950singletonON5124546102e-71
KNAG0D00130na 1ON5654965013e-55
KAFR0C04860na 1ON5344564257e-45
NCAS0A05720na 1ON5635194223e-44
SAKL0C06116gsingletonON1851903534e-38
CAGL0L02519gna 1ON5294993739e-38
NDAI0K02730singletonON6045443432e-33
KLLA0C18931gna 2ON5535061457e-09
Smik_13.2722.473ON5611751332e-07
Kwal_34.15746na 2ON5181321322e-07
SAKL0F00440gsingletonON5441541314e-07
NCAS0C03460na 3ON6304001271e-06
Smik_6.24na 4ON5441331242e-06
Skud_6.16na 4ON5491321206e-06
NCAS0A078102.473ON5681781207e-06
YMR088C (VBA1)2.473ON5621571172e-05
Suva_10.11singletonON5401331162e-05
Suva_13.2652.473ON5611741162e-05
Skud_13.2442.473ON5621731152e-05
NDAI0H022002.473ON5711591143e-05
NDAI0D010202.242ON5922251126e-05
TPHA0M00120singletonON619521126e-05
Kpol_467.242.473ON3701611091e-04
Smik_16.81na 3ON6252371092e-04
Kpol_358.4na 5ON617521082e-04
NDAI0B037702.242ON5712731082e-04
TDEL0G03260singletonON6121671082e-04
ZYRO0C01430g8.272ON5902961072e-04
KLLA0F13684g2.473ON5711011073e-04
YPR198W (SGE1)singletonON5431531063e-04
TDEL0F039908.272ON6314091054e-04
Suva_9.712.241ON5612111054e-04
KLTH0G09504gna 6ON624521054e-04
Ecym_73992.473ON5631611045e-04
KLTH0H16214gsingletonON5511111037e-04
Suva_5.2na 5ON627521010.001
TDEL0A024902.473ON5541491010.001
SAKL0E02992g2.473ON5701241010.001
Kpol_416.5singletonON6072011000.002
Kwal_23.5241na 7ON591441000.002
CAGL0J01375g2.473ON564183990.002
Kwal_23.4853na 6ON60345990.002
KAFR0J009302.242ON566273990.003
SAKL0C12122gna 7ON61152980.003
KLTH0D16962gsingletonON571169980.003
SAKL0A00726gsingletonON598211980.003
Skud_2.423na 8ON560415970.004
SAKL0E04246gna 9ON56590960.004
AGR076C8.272ON68691960.005
TDEL0D06610singletonON49791960.005
SAKL0C02178gsingletonON565109960.006
SAKL0A08228gsingletonON569152950.006
Skud_18.6singletonON61069950.007
YKR106W (GEX2)singletonON61543950.007
YCL073C (GEX1)singletonON61543950.007
KLLA0D19941gsingletonON611135950.008
SAKL0C05588gsingletonON677332940.008
NCAS0D02350na 5ON63457940.009
Smik_2.434na 8ON474384930.010
Smik_21.4singletonON60535930.013
SAKL0B12716gsingletonON632447920.016
KLTH0C10142gsingletonON573139920.016
KLTH0A01562gna 7ON61544920.018
Kpol_416.6singletonON597217910.019
KLTH0B10142gsingletonON568169910.021
CAGL0B02079gna 3ON624162910.024
KLLA0A04631g8.272ON579111900.028
Kpol_543.448.272ON64376900.030
YOL158C (ENB1)singletonON60635900.031
SAKL0F00792gsingletonON61743890.031
Kwal_26.6697singletonON577451890.035
TPHA0G031502.473ON60064890.036
TBLA0F030408.272ON906442890.037
Kwal_56.22298singletonON61043880.041
TDEL0H00130singletonON62151880.049
ABL040W2.473ON56764870.061
YKR105C (VBA5)singletonON582173870.063
TDEL0G04740singletonON601109870.064
KLTH0D18150gsingletonON607133870.066
SAKL0G06600gsingletonON62943870.068
CAGL0E04092gna 10ON64543870.071
KNAG0E025602.473ON57898860.071
Suva_4.553na 8ON562396860.076
KAFR0I01560singletonON63243860.079
TBLA0B046406.155ON482145860.080
Skud_16.503singletonON543150860.081
ZYRO0G03234g2.473ON562142860.083
KLLA0C19272gsingletonON62343860.092
Smik_5.22na 5ON628119850.097
Skud_5.24na 5ON62752850.10
YBR293W (VBA2)na 8ON474361850.11
YEL065W (SIT1)na 5ON628119850.12
KLLA0F17776gna 9ON553202840.14
YGR224W (AZR1)na 3ON613153840.15
Kwal_26.9616singletonON562310840.15
Smik_17.11singletonON544134840.16
KLLA0E14609gsingletonON63943840.16
Smik_11.370singletonON44067830.18
NDAI0I02650na 5ON638120830.19
SAKL0G03300gsingletonON61677830.20
SAKL0H16808g8.272ON65776830.21
NCAS0I00110na 10ON45277810.26
KLTH0B00594gsingletonON618151810.30
ZYRO0G07414gsingletonON707232810.31
KNAG0I019102.242ON598219810.31
KLTH0C10120gsingletonON651151810.32
Suva_26.1singletonON53435810.33
Kwal_26.77552.473ON559138810.33
KLTH0D00506gsingletonON61669810.35
SAKL0F00110gsingletonON62051800.39
ZYRO0A00330gsingletonON576369800.42
NDAI0H00140na 10ON63243800.43
NDAI0A02050singletonON617108800.44
KNAG0J02980singletonON636131800.47
KLLA0E24113g8.570ON575137790.50
Kwal_34.15711na 10ON61843790.51
TDEL0H01600singletonON60435790.52
TBLA0C01040singletonON66943790.52
Skud_7.560na 3ON642153790.53
KLLA0A10439gsingletonON63447790.58
Kwal_56.237548.272ON58999790.60
KLLA0B06798g3.245ON663119790.62
Skud_2.1553.245ON688145790.64
TPHA0K02330singletonON631131790.65
Kpol_513.33singletonON62645780.70
Suva_4.2753.245ON683136780.78
Smik_18.10singletonON53182770.83
Suva_10.9singletonON63742770.93
Ecym_42988.272ON67880770.94
Kwal_23.2794singletonON61951771.1
Smik_6.22singletonON63642761.1
ABL210CsingletonON47882761.2
TPHA0A017508.272ON636104761.3
Skud_6.14singletonON63642761.4
NCAS0A11500singletonON61452761.4
Kpol_534.276.155ON502121751.5
SAKL0D11286g1.463ON116277761.5
YHL040C (ARN1)na 10ON627212751.6
CAGL0J09020g7.309ON85676751.6
Suva_14.2762.242ON562177751.7
ZYRO0D13310gsingletonON616157751.7
Kwal_14.782na 11ON491113741.9
KNAG0K01020singletonON599150742.0
KLTH0E16720gsingletonON574436742.0
SAKL0E08756g2.242ON565286742.1
AFR333WsingletonON50089742.1
KLTH0A07964gsingletonON61951742.1
Skud_8.3na 10ON63143742.2
AAR192Cna 12ON50082742.3
KLTH0D05434g2.473ON576103742.3
Kwal_14.722singletonON61151742.4
SAKL0D04070g3.245ON667119732.8
KLTH0B00110gsingletonON62743733.2
SAKL0F00198gsingletonON537440723.5
KLTH0G13464g8.272ON59398723.5
KLTH0D00110gsingletonON62055723.9
KLTH0B10450gsingletonON62055723.9
Suva_8.12na 10ON63343724.1
KLTH0H02728gna 13ON584200724.1
KLTH0E03234gsingletonON521153724.2
NCAS0G029902.242ON581149714.6
YBR043C (QDR3)3.245ON689145714.8
SAKL0D04510gna 12ON53157715.4
Smik_2.1613.245ON689136706.0
NDAI0A015107.411ON67950706.1
YAL067C (SEO1)singletonON593122707.0
TDEL0C00120singletonON569446707.1
TBLA0G025502.242ON613143707.4
KLLA0C19019gna 11ON511117697.9
NDAI0K03000na 14ON592122698.0
TDEL0C045902.242ON529177698.0
TDEL0F05630singletonON54549698.1
SAKL0A07480gsingletonON573136698.4
Kwal_23.48242.242ON553279698.6
SAKL0E00132gsingletonON62055698.8
Smik_11.368singletonON580442699.1
Kwal_56.229493.245ON6421226910.0
YIL047C (SYG1)7.233ON902406910.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0D03280
         (580 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0D03280 Chr4 complement(815937..817679) [1743 bp, 580 aa] {O...  1119   0.0  
TBLA0D03270 Chr4 complement(813041..814693) [1653 bp, 550 aa] {O...   684   0.0  
Kpol_541.16 s541 complement(43396..44982) [1587 bp, 528 aa] {ON}...   585   0.0  
Skud_13.25 Chr13 (37872..39485) [1614 bp, 537 aa] {ON} YML116W (...   576   0.0  
YML116W Chr13 (38196..39824) [1629 bp, 542 aa] {ON}  ATR1Multidr...   564   0.0  
Suva_13.27 Chr13 (37895..39556) [1662 bp, 553 aa] {ON} YML116W (...   557   0.0  
TPHA0C04790 Chr3 complement(1033653..1035323) [1671 bp, 556 aa] ...   556   0.0  
NDAI0E00280 Chr5 (37676..39325) [1650 bp, 549 aa] {ON} Anc_8.843      552   0.0  
Smik_13.18 Chr13 (34422..36059) [1638 bp, 545 aa] {ON} YML116W (...   546   0.0  
KNAG0J00260 Chr10 (37950..39602) [1653 bp, 550 aa] {ON} Anc_8.84...   537   0.0  
TDEL0B00550 Chr2 (105483..107096) [1614 bp, 537 aa] {ON} Anc_8.8...   535   0.0  
SAKL0D01386g Chr4 (109619..111184) [1566 bp, 521 aa] {ON} unipro...   535   0.0  
NCAS0B00290 Chr2 (33760..35388) [1629 bp, 542 aa] {ON} Anc_8.843      532   0.0  
NCAS0A02540 Chr1 complement(481807..483426) [1620 bp, 539 aa] {O...   530   0.0  
Kwal_27.10245 s27 (259090..260637) [1548 bp, 515 aa] {ON} YML116...   528   0.0  
Suva_13.467 Chr13 complement(807375..809006) [1632 bp, 543 aa] {...   528   0.0  
CAGL0B02343g Chr2 complement(222130..223743) [1614 bp, 537 aa] {...   527   0.0  
Skud_13.451 Chr13 complement(798006..799625) [1620 bp, 539 aa] {...   526   0.0  
KLTH0C03806g Chr3 (332195..333772) [1578 bp, 525 aa] {ON} simila...   525   0.0  
TBLA0C01160 Chr3 complement(246034..247836) [1803 bp, 600 aa] {O...   527   0.0  
CAGL0M03003g Chr13 complement(337942..339618) [1677 bp, 558 aa] ...   525   0.0  
KNAG0G03430 Chr7 complement(734828..736456) [1629 bp, 542 aa] {O...   523   0.0  
KAFR0B03930 Chr2 complement(816351..818018) [1668 bp, 555 aa] {O...   523   0.0  
YMR279C Chr13 complement(824729..826351) [1623 bp, 540 aa] {ON} ...   518   e-179
Smik_13.492 Chr13 complement(807726..809357) [1632 bp, 543 aa] {...   518   e-179
NDAI0K00400 Chr11 (90040..91701) [1662 bp, 553 aa] {ON}               516   e-178
KAFR0B03940 Chr2 complement(820954..822597) [1644 bp, 547 aa] {O...   513   e-177
NCAS0C00400 Chr3 (61257..62810) [1554 bp, 517 aa] {ON} Anc_8.843      495   e-170
KAFR0A02840 Chr1 complement(588197..589759) [1563 bp, 520 aa] {O...   479   e-164
Smik_15.560 Chr15 (995453..997003) [1551 bp, 516 aa] {ON} YOR378...   328   e-105
YOR378W Chr15 (1049511..1051058) [1548 bp, 515 aa] {ON} Putative...   321   e-102
Skud_15.545 Chr15 (988549..990099) [1551 bp, 516 aa] {ON} YOR378...   316   e-101
Suva_8.435 Chr8 (786917..788464) [1548 bp, 515 aa] {ON} YOR378W ...   306   5e-97
Kwal_23.6547 s23 (1635677..1637212) [1536 bp, 511 aa] {ON} YOR37...   301   5e-95
KLTH0C10560g Chr3 (875216..876763) [1548 bp, 515 aa] {ON} simila...   296   8e-93
KLLA0B00352g Chr2 (22476..23972) [1497 bp, 498 aa] {ON} highly s...   278   4e-86
TDEL0G04950 Chr7 complement(922428..923966) [1539 bp, 512 aa] {O...   239   2e-71
KNAG0D00130 Chr4 complement(6264..7961) [1698 bp, 565 aa] {ON}  ...   197   3e-55
KAFR0C04860 Chr3 (964552..966156) [1605 bp, 534 aa] {ON}  YOR378W     168   7e-45
NCAS0A05720 Chr1 (1117491..1119182) [1692 bp, 563 aa] {ON}            167   3e-44
SAKL0C06116g Chr3 complement(571813..572370) [558 bp, 185 aa] {O...   140   4e-38
CAGL0L02519g Chr12 complement(297555..299144) [1590 bp, 529 aa] ...   148   9e-38
NDAI0K02730 Chr11 complement(612590..614404) [1815 bp, 604 aa] {...   136   2e-33
KLLA0C18931g Chr3 (1680133..1681794) [1662 bp, 553 aa] {ON} unip...    60   7e-09
Smik_13.272 Chr13 complement(427283..428968) [1686 bp, 561 aa] {...    56   2e-07
Kwal_34.15746 s34 (37757..39313) [1557 bp, 518 aa] {ON} YGR224W ...    55   2e-07
SAKL0F00440g Chr6 complement(36452..38086) [1635 bp, 544 aa] {ON...    55   4e-07
NCAS0C03460 Chr3 complement(690089..691981) [1893 bp, 630 aa] {O...    54   1e-06
Smik_6.24 Chr6 (39520..41154) [1635 bp, 544 aa] {ON} YMR279C (REAL)    52   2e-06
Skud_6.16 Chr6 (26284..27933) [1650 bp, 549 aa] {ON} YOR378W (REAL)    51   6e-06
NCAS0A07810 Chr1 complement(1554541..1556247) [1707 bp, 568 aa] ...    51   7e-06
YMR088C Chr13 complement(443414..445102) [1689 bp, 562 aa] {ON} ...    50   2e-05
Suva_10.11 Chr10 (18934..20556) [1623 bp, 540 aa] {ON} YOR378W (...    49   2e-05
Suva_13.265 Chr13 complement(424929..426614) [1686 bp, 561 aa] {...    49   2e-05
Skud_13.244 Chr13 complement(417271..418959) [1689 bp, 562 aa] {...    49   2e-05
NDAI0H02200 Chr8 complement(536385..538100) [1716 bp, 571 aa] {O...    49   3e-05
NDAI0D01020 Chr4 complement(229357..231135) [1779 bp, 592 aa] {O...    48   6e-05
TPHA0M00120 Chr13 (23458..25317) [1860 bp, 619 aa] {ON}                48   6e-05
Kpol_467.24 s467 (55523..56632) [1110 bp, 370 aa] {ON} (55523..5...    47   1e-04
Smik_16.81 Chr16 complement(152022..153515,153516..153899) [1878...    47   2e-04
Kpol_358.4 s358 complement(9458..11311) [1854 bp, 617 aa] {ON} c...    46   2e-04
NDAI0B03770 Chr2 complement(947945..949660) [1716 bp, 571 aa] {O...    46   2e-04
TDEL0G03260 Chr7 (605429..607267) [1839 bp, 612 aa] {ON}               46   2e-04
ZYRO0C01430g Chr3 complement(101140..102912) [1773 bp, 590 aa] {...    46   2e-04
KLLA0F13684g Chr6 complement(1267367..1269082) [1716 bp, 571 aa]...    46   3e-04
YPR198W Chr16 (934034..935665) [1632 bp, 543 aa] {ON}  SGE1Plasm...    45   3e-04
TDEL0F03990 Chr6 (740471..742366) [1896 bp, 631 aa] {ON} Anc_8.2...    45   4e-04
Suva_9.71 Chr9 (129275..130960) [1686 bp, 561 aa] {ON} YIL121W (...    45   4e-04
KLTH0G09504g Chr7 complement(792202..794076) [1875 bp, 624 aa] {...    45   4e-04
Ecym_7399 Chr7 complement(820280..821971) [1692 bp, 563 aa] {ON}...    45   5e-04
KLTH0H16214g Chr8 complement(1398230..1399885) [1656 bp, 551 aa]...    44   7e-04
Suva_5.2 Chr5 (3340..5223) [1884 bp, 627 aa] {ON} YEL065W (REAL)       44   0.001
TDEL0A02490 Chr1 (446429..448093) [1665 bp, 554 aa] {ON} Anc_2.4...    44   0.001
SAKL0E02992g Chr5 complement(243652..245364) [1713 bp, 570 aa] {...    44   0.001
Kpol_416.5 s416 (23208..25031) [1824 bp, 607 aa] {ON} (23208..25...    43   0.002
Kwal_23.5241 s23 (1071768..1073543) [1776 bp, 591 aa] {ON} YEL06...    43   0.002
CAGL0J01375g Chr10 (127843..129537) [1695 bp, 564 aa] {ON} simil...    43   0.002
Kwal_23.4853 s23 complement(895045..896856) [1812 bp, 603 aa] {O...    43   0.002
KAFR0J00930 Chr10 (168674..170374) [1701 bp, 566 aa] {ON} Anc_2....    43   0.003
SAKL0C12122g Chr3 (1086281..1088116) [1836 bp, 611 aa] {ON} simi...    42   0.003
KLTH0D16962g Chr4 (1399514..1401229) [1716 bp, 571 aa] {ON} simi...    42   0.003
SAKL0A00726g Chr1 (82164..83960) [1797 bp, 598 aa] {ON} similar ...    42   0.003
Skud_2.423 Chr2 (756345..758027) [1683 bp, 560 aa] {ON} YBR293W ...    42   0.004
SAKL0E04246g Chr5 (336416..338113) [1698 bp, 565 aa] {ON} weakly...    42   0.004
AGR076C Chr7 complement(871564..873624) [2061 bp, 686 aa] {ON} S...    42   0.005
TDEL0D06610 Chr4 complement(1195341..1196834) [1494 bp, 497 aa] ...    42   0.005
SAKL0C02178g Chr3 complement(191542..193239) [1698 bp, 565 aa] {...    42   0.006
SAKL0A08228g Chr1 complement(732518..734227) [1710 bp, 569 aa] {...    41   0.006
Skud_18.6 Chr18 (14597..16429) [1833 bp, 610 aa] {ON} YCL073C (R...    41   0.007
YKR106W Chr11 (661442..663289) [1848 bp, 615 aa] {ON}  GEX2Proto...    41   0.007
YCL073C Chr3 complement(6479..8326) [1848 bp, 615 aa] {ON}  GEX1...    41   0.007
KLLA0D19941g Chr4 complement(1698889..1700724) [1836 bp, 611 aa]...    41   0.008
SAKL0C05588g Chr3 (527748..529781) [2034 bp, 677 aa] {ON} simila...    41   0.008
NCAS0D02350 Chr4 (439325..441229) [1905 bp, 634 aa] {ON}               41   0.009
Smik_2.434 Chr2 (773094..774518) [1425 bp, 474 aa] {ON} YBR293W ...    40   0.010
Smik_21.4 Chr21 (1261..3078) [1818 bp, 605 aa] {ON} YOL158C (REAL)     40   0.013
SAKL0B12716g Chr2 (1101141..1103039) [1899 bp, 632 aa] {ON} simi...    40   0.016
KLTH0C10142g Chr3 (842371..844092) [1722 bp, 573 aa] {ON} simila...    40   0.016
KLTH0A01562g Chr1 complement(138389..140236) [1848 bp, 615 aa] {...    40   0.018
Kpol_416.6 s416 (26742..28535) [1794 bp, 597 aa] {ON} (26742..28...    40   0.019
KLTH0B10142g Chr2 complement(847376..849082) [1707 bp, 568 aa] {...    40   0.021
CAGL0B02079g Chr2 complement(191736..193610) [1875 bp, 624 aa] {...    40   0.024
KLLA0A04631g Chr1 complement(415070..416809) [1740 bp, 579 aa] {...    39   0.028
Kpol_543.44 s543 (96992..98923) [1932 bp, 643 aa] {ON} (96992..9...    39   0.030
YOL158C Chr15 complement(19491..21311) [1821 bp, 606 aa] {ON}  E...    39   0.031
SAKL0F00792g Chr6 (70444..72297) [1854 bp, 617 aa] {ON} similar ...    39   0.031
Kwal_26.6697 s26 complement(26786..28519) [1734 bp, 577 aa] {ON}...    39   0.035
TPHA0G03150 Chr7 (670343..672145) [1803 bp, 600 aa] {ON} Anc_2.4...    39   0.036
TBLA0F03040 Chr6 complement(735352..738072) [2721 bp, 906 aa] {O...    39   0.037
Kwal_56.22298 s56 (31819..33651) [1833 bp, 610 aa] {ON} YHL040C ...    39   0.041
TDEL0H00130 Chr8 complement(10267..12132) [1866 bp, 621 aa] {ON}       39   0.049
ABL040W Chr2 (321534..323237) [1704 bp, 567 aa] {ON} Syntenic ho...    38   0.061
YKR105C Chr11 complement(658716..660464) [1749 bp, 582 aa] {ON} ...    38   0.063
TDEL0G04740 Chr7 complement(865319..867124) [1806 bp, 601 aa] {O...    38   0.064
KLTH0D18150g Chr4 complement(1502817..1504640) [1824 bp, 607 aa]...    38   0.066
SAKL0G06600g Chr7 complement(549492..551381) [1890 bp, 629 aa] {...    38   0.068
CAGL0E04092g Chr5 (394380..396317) [1938 bp, 645 aa] {ON} simila...    38   0.071
KNAG0E02560 Chr5 (506517..508253) [1737 bp, 578 aa] {ON} Anc_2.4...    38   0.071
Suva_4.553 Chr4 (959592..961280) [1689 bp, 562 aa] {ON} YBR293W ...    38   0.076
KAFR0I01560 Chr9 (328940..330838) [1899 bp, 632 aa] {ON}  YHL040C      38   0.079
TBLA0B04640 Chr2 complement(1082147..1083595) [1449 bp, 482 aa] ...    38   0.080
Skud_16.503 Chr16 (880571..882202) [1632 bp, 543 aa] {ON} YPR198...    38   0.081
ZYRO0G03234g Chr7 (247798..249486) [1689 bp, 562 aa] {ON} simila...    38   0.083
KLLA0C19272g Chr3 complement(1717903..1719774) [1872 bp, 623 aa]...    38   0.092
Smik_5.22 Chr5 (30048..31934) [1887 bp, 628 aa] {ON} YEL065W (REAL)    37   0.097
Skud_5.24 Chr5 (26839..28722) [1884 bp, 627 aa] {ON} YEL065W (REAL)    37   0.10 
YBR293W Chr2 (787006..788430) [1425 bp, 474 aa] {ON}  VBA2Permea...    37   0.11 
YEL065W Chr5 (27657..29543) [1887 bp, 628 aa] {ON}  SIT1Ferrioxa...    37   0.12 
KLLA0F17776g Chr6 complement(1627198..1628859) [1662 bp, 553 aa]...    37   0.14 
YGR224W Chr7 (942806..944647) [1842 bp, 613 aa] {ON}  AZR1Plasma...    37   0.15 
Kwal_26.9616 s26 (1294683..1296371) [1689 bp, 562 aa] {ON} YPR19...    37   0.15 
Smik_17.11 Chr17 complement(8582..10216) [1635 bp, 544 aa] {ON} ...    37   0.16 
KLLA0E14609g Chr5 (1302073..1303992) [1920 bp, 639 aa] {ON} simi...    37   0.16 
Smik_11.370 Chr11 (653235..654554) [1320 bp, 440 aa] {ON} YKR106...    37   0.18 
NDAI0I02650 Chr9 (617474..619390) [1917 bp, 638 aa] {ON}               37   0.19 
SAKL0G03300g Chr7 (268199..270049) [1851 bp, 616 aa] {ON} simila...    37   0.20 
SAKL0H16808g Chr8 complement(1477137..1479110) [1974 bp, 657 aa]...    37   0.21 
NCAS0I00110 Chr9 complement(5312..6670) [1359 bp, 452 aa] {ON}         36   0.26 
KLTH0B00594g Chr2 (64332..66188) [1857 bp, 618 aa] {ON} similar ...    36   0.30 
ZYRO0G07414g Chr7 complement(583978..586101) [2124 bp, 707 aa] {...    36   0.31 
KNAG0I01910 Chr9 complement(373073..374869) [1797 bp, 598 aa] {O...    36   0.31 
KLTH0C10120g Chr3 (839780..841735) [1956 bp, 651 aa] {ON} simila...    36   0.32 
Suva_26.1 Chr26 (1..1602) [1602 bp, 534 aa] {ON} YOL158C (REAL)        36   0.33 
Kwal_26.7755 s26 (500034..501713) [1680 bp, 559 aa] {ON} YMR088C...    36   0.33 
KLTH0D00506g Chr4 (47320..49170) [1851 bp, 616 aa] {ON} similar ...    36   0.35 
SAKL0F00110g Chr6 (1456..3318) [1863 bp, 620 aa] {ON} similar to...    35   0.39 
ZYRO0A00330g Chr1 (19597..21327) [1731 bp, 576 aa] {ON} similar ...    35   0.42 
NDAI0H00140 Chr8 complement(10247..12145) [1899 bp, 632 aa] {ON}       35   0.43 
NDAI0A02050 Chr1 complement(456678..458531) [1854 bp, 617 aa] {O...    35   0.44 
KNAG0J02980 Chr10 (571855..573765) [1911 bp, 636 aa] {ON}              35   0.47 
KLLA0E24113g Chr5 complement(2148115..2149842) [1728 bp, 575 aa]...    35   0.50 
Kwal_34.15711 s34 (21213..23069) [1857 bp, 618 aa] {ON} YHL047C ...    35   0.51 
TDEL0H01600 Chr8 complement(273692..275506) [1815 bp, 604 aa] {O...    35   0.52 
TBLA0C01040 Chr3 (208261..210270) [2010 bp, 669 aa] {ON}               35   0.52 
Skud_7.560 Chr7 (917668..919596) [1929 bp, 642 aa] {ON} YGR224W ...    35   0.53 
KLLA0A10439g Chr1 complement(913342..915246) [1905 bp, 634 aa] {...    35   0.58 
Kwal_56.23754 s56 complement(690851..692620) [1770 bp, 589 aa] {...    35   0.60 
KLLA0B06798g Chr2 (596500..598491) [1992 bp, 663 aa] {ON} simila...    35   0.62 
Skud_2.155 Chr2 complement(291487..293553) [2067 bp, 688 aa] {ON...    35   0.64 
TPHA0K02330 Chr11 (506158..508053) [1896 bp, 631 aa] {ON}              35   0.65 
Kpol_513.33 s513 complement(95274..97154) [1881 bp, 626 aa] {ON}...    35   0.70 
Suva_4.275 Chr4 complement(487620..489671) [2052 bp, 683 aa] {ON...    35   0.78 
Smik_18.10 Chr18 complement(16419..18014) [1596 bp, 531 aa] {ON}...    34   0.83 
Suva_10.9 Chr10 complement(12679..14592) [1914 bp, 637 aa] {ON} ...    34   0.93 
Ecym_4298 Chr4 complement(636605..638641) [2037 bp, 678 aa] {ON}...    34   0.94 
Kwal_23.2794 s23 (15194..17053) [1860 bp, 619 aa] {ON} YHL047C (...    34   1.1  
Smik_6.22 Chr6 complement(31536..33446) [1911 bp, 636 aa] {ON} Y...    34   1.1  
ABL210C Chr2 complement(7071..8507) [1437 bp, 478 aa] {ON} Non-s...    34   1.2  
TPHA0A01750 Chr1 complement(354061..355971) [1911 bp, 636 aa] {O...    34   1.3  
Skud_6.14 Chr6 complement(19547..21457) [1911 bp, 636 aa] {ON} Y...    34   1.4  
NCAS0A11500 Chr1 complement(2274436..2276280) [1845 bp, 614 aa] ...    34   1.4  
Kpol_534.27 s534 (61814..63322) [1509 bp, 502 aa] {ON} (61814..6...    33   1.5  
SAKL0D11286g Chr4 (938289..941777) [3489 bp, 1162 aa] {ON} some ...    34   1.5  
YHL040C Chr8 complement(19088..20971) [1884 bp, 627 aa] {ON}  AR...    33   1.6  
CAGL0J09020g Chr10 (889269..891839) [2571 bp, 856 aa] {ON} highl...    33   1.6  
Suva_14.276 Chr14 (502686..504374) [1689 bp, 562 aa] {ON} YNL065...    33   1.7  
ZYRO0D13310g Chr4 complement(1118820..1120670) [1851 bp, 616 aa]...    33   1.7  
Kwal_14.782 s14 (42720..44195) [1476 bp, 491 aa] {ON} YGR260W (T...    33   1.9  
KNAG0K01020 Chr11 complement(198213..200012) [1800 bp, 599 aa] {...    33   2.0  
KLTH0E16720g Chr5 (1482846..1484570) [1725 bp, 574 aa] {ON} simi...    33   2.0  
SAKL0E08756g Chr5 complement(714902..716599) [1698 bp, 565 aa] {...    33   2.1  
AFR333W Chr6 (1041317..1042819) [1503 bp, 500 aa] {ON} Non-synte...    33   2.1  
KLTH0A07964g Chr1 complement(670591..672450) [1860 bp, 619 aa] {...    33   2.1  
Skud_8.3 Chr8 complement(7094..8989) [1896 bp, 631 aa] {ON} YHL0...    33   2.2  
AAR192C Chr1 complement(686882..688384) [1503 bp, 500 aa] {ON} N...    33   2.3  
KLTH0D05434g Chr4 (486319..488049) [1731 bp, 576 aa] {ON} simila...    33   2.3  
Kwal_14.722 s14 (9019..10854) [1836 bp, 611 aa] {ON} YCL073C - H...    33   2.4  
SAKL0D04070g Chr4 (331254..333257) [2004 bp, 667 aa] {ON} simila...    33   2.8  
KLTH0B00110g Chr2 complement(1655..3538) [1884 bp, 627 aa] {ON} ...    33   3.2  
SAKL0F00198g Chr6 complement(10713..12326) [1614 bp, 537 aa] {ON...    32   3.5  
KLTH0G13464g Chr7 complement(1154304..1156085) [1782 bp, 593 aa]...    32   3.5  
KLTH0D00110g Chr4 (796..2658) [1863 bp, 620 aa] {ON} similar to ...    32   3.9  
KLTH0B10450g Chr2 complement(885429..887291) [1863 bp, 620 aa] {...    32   3.9  
Suva_8.12 Chr8 complement(20611..22512) [1902 bp, 633 aa] {ON} Y...    32   4.1  
KLTH0H02728g Chr8 complement(242682..244436) [1755 bp, 584 aa] {...    32   4.1  
KLTH0E03234g Chr5 complement(293162..294727) [1566 bp, 521 aa] {...    32   4.2  
NCAS0G02990 Chr7 complement(549460..551205) [1746 bp, 581 aa] {O...    32   4.6  
YBR043C Chr2 complement(321876..323945) [2070 bp, 689 aa] {ON}  ...    32   4.8  
SAKL0D04510g Chr4 complement(360010..361605) [1596 bp, 531 aa] {...    32   5.4  
Smik_2.161 Chr2 complement(302754..304823) [2070 bp, 689 aa] {ON...    32   6.0  
NDAI0A01510 Chr1 (335693..337732) [2040 bp, 679 aa] {ON} Anc_7.4...    32   6.1  
YAL067C Chr1 complement(7235..9016) [1782 bp, 593 aa] {ON}  SEO1...    32   7.0  
TDEL0C00120 Chr3 complement(7481..9190) [1710 bp, 569 aa] {ON}         32   7.1  
TBLA0G02550 Chr7 complement(668523..670364) [1842 bp, 613 aa] {O...    32   7.4  
KLLA0C19019g Chr3 (1689555..1691090) [1536 bp, 511 aa] {ON} simi...    31   7.9  
NDAI0K03000 Chr11 (686056..687834) [1779 bp, 592 aa] {ON}              31   8.0  
TDEL0C04590 Chr3 (831668..833257) [1590 bp, 529 aa] {ON} Anc_2.2...    31   8.0  
TDEL0F05630 Chr6 complement(1053523..1055160) [1638 bp, 545 aa] ...    31   8.1  
SAKL0A07480g Chr1 complement(658699..660420) [1722 bp, 573 aa] {...    31   8.4  
Kwal_23.4824 s23 (883258..884919) [1662 bp, 553 aa] {ON} YNL065W...    31   8.6  
SAKL0E00132g Chr5 (3269..5131) [1863 bp, 620 aa] {ON} similar to...    31   8.8  
Smik_11.368 Chr11 complement(649880..651622) [1743 bp, 580 aa] {...    31   9.1  
Kwal_56.22949 s56 complement(342503..344431) [1929 bp, 642 aa] {...    31   10.0 
YIL047C Chr9 complement(265115..267823) [2709 bp, 902 aa] {ON}  ...    31   10.0 

>TBLA0D03280 Chr4 complement(815937..817679) [1743 bp, 580 aa] {ON} 
          Length = 580

 Score = 1119 bits (2895), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 554/580 (95%), Positives = 554/580 (95%)

Query: 1   MSEQNINQNLQKENTQISIISLSTAETLDIDATPESKERKDYFQLKKNYSQDSQTNTSMN 60
           MSEQNINQNLQKENTQISIISLSTAETLDIDATPESKERKDYFQLKKNYSQDSQTNTSMN
Sbjct: 1   MSEQNINQNLQKENTQISIISLSTAETLDIDATPESKERKDYFQLKKNYSQDSQTNTSMN 60

Query: 61  EVIGXXXXXXXXXXXXXENLQSENKVLSPKYFKNRTHEYLFIISCMVSQFMSQAGLTQAL 120
           EVIG             ENLQSENKVLSPKYFKNRTHEYLFIISCMVSQFMSQAGLTQAL
Sbjct: 61  EVIGSISSVSNDSDINSENLQSENKVLSPKYFKNRTHEYLFIISCMVSQFMSQAGLTQAL 120

Query: 121 SIMNILAEELNAEKSRQAWLMASFTLSMGSFILVSGRLGDIYGLKKVLLGGYAILTIWSL 180
           SIMNILAEELNAEKSRQAWLMASFTLSMGSFILVSGRLGDIYGLKKVLLGGYAILTIWSL
Sbjct: 121 SIMNILAEELNAEKSRQAWLMASFTLSMGSFILVSGRLGDIYGLKKVLLGGYAILTIWSL 180

Query: 181 ICGFSSYSHNDAFFITSRAFQGLGLAFVLPNSLGLIGVIYEPGSMKKNMIIGTLGAMSPI 240
           ICGFSSYSHNDAFFITSRAFQGLGLAFVLPNSLGLIGVIYEPGSMKKNMIIGTLGAMSPI
Sbjct: 181 ICGFSSYSHNDAFFITSRAFQGLGLAFVLPNSLGLIGVIYEPGSMKKNMIIGTLGAMSPI 240

Query: 241 GATLGGLFAGIIGTKDPKQWPWSFYSFGIVSFCNMILSWYSIPNNIPTNIYNLSMDWXXX 300
           GATLGGLFAGIIGTKDPKQWPWSFYSFGIVSFCNMILSWYSIPNNIPTNIYNLSMDW   
Sbjct: 241 GATLGGLFAGIIGTKDPKQWPWSFYSFGIVSFCNMILSWYSIPNNIPTNIYNLSMDWIGA 300

Query: 301 XXXXXXXXXXNFVFNQAPIVGWQSAYIIVLLVLSFCALVIFVVYEVKYAKTPLIPKAISS 360
                     NFVFNQAPIVGWQSAYIIVLLVLSFCALVIFVVYEVKYAKTPLIPKAISS
Sbjct: 301 ILGIFGLLILNFVFNQAPIVGWQSAYIIVLLVLSFCALVIFVVYEVKYAKTPLIPKAISS 360

Query: 361 NRGMLMILFALFCGWGAFGTWTFYYFSFVLNVRGYTAAWAGGSYFIFIVSGCAIATLCGF 420
           NRGMLMILFALFCGWGAFGTWTFYYFSFVLNVRGYTAAWAGGSYFIFIVSGCAIATLCGF
Sbjct: 361 NRGMLMILFALFCGWGAFGTWTFYYFSFVLNVRGYTAAWAGGSYFIFIVSGCAIATLCGF 420

Query: 421 MMKKVPPSVILYISMIGFMGGCVMLTVTPIHQSYFQNILGIMFVLPIGIDLSFPAASIIL 480
           MMKKVPPSVILYISMIGFMGGCVMLTVTPIHQSYFQNILGIMFVLPIGIDLSFPAASIIL
Sbjct: 421 MMKKVPPSVILYISMIGFMGGCVMLTVTPIHQSYFQNILGIMFVLPIGIDLSFPAASIIL 480

Query: 481 SDALPIQYQGMAGSLVYTITNYSTSICLGMAGSVEAYHNDNGQNILKGYRNAMIFADALA 540
           SDALPIQYQGMAGSLVYTITNYSTSICLGMAGSVEAYHNDNGQNILKGYRNAMIFADALA
Sbjct: 481 SDALPIQYQGMAGSLVYTITNYSTSICLGMAGSVEAYHNDNGQNILKGYRNAMIFADALA 540

Query: 541 GLGIIVSGIYMVINLITIRENSKSTNKPKHLETYSTDAEC 580
           GLGIIVSGIYMVINLITIRENSKSTNKPKHLETYSTDAEC
Sbjct: 541 GLGIIVSGIYMVINLITIRENSKSTNKPKHLETYSTDAEC 580

>TBLA0D03270 Chr4 complement(813041..814693) [1653 bp, 550 aa] {ON}
           Anc_8.843 YMR279C
          Length = 550

 Score =  684 bits (1766), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 336/545 (61%), Positives = 412/545 (75%), Gaps = 10/545 (1%)

Query: 29  DIDATPESKERKDYFQLKKNYSQDSQTNTSMNEVIGXXXXXXXXXXXXXENLQSENKVLS 88
           +I+ T     +    Q  KN    S  N+S+ +V+              +N +S +   +
Sbjct: 15  EINYTNNEDCKNPEQQSLKNIDSRSSLNSSLTQVLSTDTA---------DNDESSS-YQN 64

Query: 89  PKYFKNRTHEYLFIISCMVSQFMSQAGLTQALSIMNILAEELNAEKSRQAWLMASFTLSM 148
           P YFKN+  E+ FI S M+ Q +SQAGLTQ LSIMN+LA+EL++  SRQAWLM+SF L++
Sbjct: 65  PDYFKNKYQEFGFIFSGMIGQLLSQAGLTQTLSIMNVLAKELDSTSSRQAWLMSSFPLAL 124

Query: 149 GSFILVSGRLGDIYGLKKVLLGGYAILTIWSLICGFSSYSHNDAFFITSRAFQGLGLAFV 208
           GSFILVSGRLGDIYGLKK+LLGGY I T+WS+ICG SSY+HNDAFFIT+RAFQGLGLAF 
Sbjct: 125 GSFILVSGRLGDIYGLKKILLGGYIITTVWSIICGLSSYAHNDAFFITARAFQGLGLAFA 184

Query: 209 LPNSLGLIGVIYEPGSMKKNMIIGTLGAMSPIGATLGGLFAGIIGTKDPKQWPWSFYSFG 268
           LPN +GLIG IY PG  +KNMII  +GAMSP GATLGGLFAG+    D   WPWSFY+FG
Sbjct: 185 LPNMIGLIGTIYRPGCFRKNMIISIIGAMSPTGATLGGLFAGLTVKYDKSNWPWSFYAFG 244

Query: 269 IVSFCNMILSWYSIPNNIPTNIYNLSMDWXXXXXXXXXXXXXNFVFNQAPIVGWQSAYII 328
           ++SF N+I+SWY IPN+IPTNI+ L MDW             NFVFNQAPIVGWQSAYII
Sbjct: 245 LISFVNLIISWYCIPNSIPTNIHGLKMDWLGSVLGVFGLIILNFVFNQAPIVGWQSAYII 304

Query: 329 VLLVLSFCALVIFVVYEVKYAKTPLIPKAISSNRGMLMILFALFCGWGAFGTWTFYYFSF 388
           VLLVLSFCALVIFVVYEVKYAKTPLIPKAISSNRGMLMILF+LFCGWG+FG WTFYYFSF
Sbjct: 305 VLLVLSFCALVIFVVYEVKYAKTPLIPKAISSNRGMLMILFSLFCGWGSFGIWTFYYFSF 364

Query: 389 VLNVRGYTAAWAGGSYFIFIVSGCAIATLCGFMMKKVPPSVILYISMIGFMGGCVMLTVT 448
            LN+R Y+  WAG SYFIF++SG  +A +CG  +KK+ PSV+   SM+GF+GG ++   T
Sbjct: 365 ELNLRHYSPLWAGSSYFIFVISGSTVAIVCGLTIKKIKPSVLFCCSMMGFLGGNIIFAAT 424

Query: 449 PIHQSYFQNILGIMFVLPIGIDLSFPAASIILSDALPIQYQGMAGSLVYTITNYSTSICL 508
           P++Q++F+N+LG MF+LP+G+D SFPA+SIILSD+LP+QYQGMAGSLV T+ NYSTSICL
Sbjct: 425 PVNQTFFRNMLGCMFLLPLGMDFSFPASSIILSDSLPMQYQGMAGSLVNTVINYSTSICL 484

Query: 509 GMAGSVEAYHNDNGQNILKGYRNAMIFADALAGLGIIVSGIYMVINLITIRENSKSTNKP 568
           GMAG+VE  HN +G+++L GYR A+ FA  LAGL + VSG YM+  L   R  S   NK 
Sbjct: 485 GMAGTVEMKHNSHGKDLLNGYRAAIYFAIGLAGLAVCVSGGYMIECLWKDRVLSLEENKQ 544

Query: 569 KHLET 573
             +E+
Sbjct: 545 TDIES 549

>Kpol_541.16 s541 complement(43396..44982) [1587 bp, 528 aa] {ON}
           complement(43396..44982) [1587 nt, 529 aa]
          Length = 528

 Score =  585 bits (1509), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/479 (57%), Positives = 364/479 (75%)

Query: 88  SPKYFKNRTHEYLFIISCMVSQFMSQAGLTQALSIMNILAEELNAEKSRQAWLMASFTLS 147
           +P YF + T EY FI SCM+SQ ++ AG TQ LSIMN+L  +L++  S + WL+ASF L 
Sbjct: 44  NPDYFNSTTQEYAFIFSCMLSQLLNLAGTTQTLSIMNVLTRQLHSSDSLKVWLVASFPLV 103

Query: 148 MGSFILVSGRLGDIYGLKKVLLGGYAILTIWSLICGFSSYSHNDAFFITSRAFQGLGLAF 207
            GSFILVSGRLGDIYGLKK+L+ GY IL IWSLI G S YSH+  FFI +RAFQGLG++ 
Sbjct: 104 SGSFILVSGRLGDIYGLKKMLILGYVILVIWSLITGLSGYSHSGIFFIIARAFQGLGISL 163

Query: 208 VLPNSLGLIGVIYEPGSMKKNMIIGTLGAMSPIGATLGGLFAGIIGTKDPKQWPWSFYSF 267
           VLPN LGLIG+IY+PG++KKNM+I  +GAMSPIGATLGGLF+G++ T+    WPW+FY++
Sbjct: 164 VLPNVLGLIGMIYKPGTLKKNMVISIVGAMSPIGATLGGLFSGLVATESEGSWPWAFYAY 223

Query: 268 GIVSFCNMILSWYSIPNNIPTNIYNLSMDWXXXXXXXXXXXXXNFVFNQAPIVGWQSAYI 327
            + +F N  +S+YSIPNNIPTN+  LSMDW             NFV+NQAP  GW SAY+
Sbjct: 224 TLAAFINTFISYYSIPNNIPTNVNRLSMDWIGSFTGVLGLILFNFVWNQAPADGWNSAYL 283

Query: 328 IVLLVLSFCALVIFVVYEVKYAKTPLIPKAISSNRGMLMILFALFCGWGAFGTWTFYYFS 387
           IVLLV+S  AL+ F +YE++YA+ PL+P  I  NR ++MIL A+  GWG+FG WTFYYFS
Sbjct: 284 IVLLVISVIALIAFGIYELRYAENPLLPSEIIRNRQLIMILTAMTFGWGSFGIWTFYYFS 343

Query: 388 FVLNVRGYTAAWAGGSYFIFIVSGCAIATLCGFMMKKVPPSVILYISMIGFMGGCVMLTV 447
           FVLN+R Y+  WAGGSYFIF++SG   A  CGF+MKK+ P+V+L  SM+GF  GC++ +V
Sbjct: 344 FVLNLRNYSPLWAGGSYFIFVISGTITAISCGFLMKKIRPAVLLTFSMVGFNLGCIIFSV 403

Query: 448 TPIHQSYFQNILGIMFVLPIGIDLSFPAASIILSDALPIQYQGMAGSLVYTITNYSTSIC 507
           TP+HQ+YF+NILG M +LP+G+DLSFPA+SIILSD LP Q+QGMAGSLV T+ NYS S+ 
Sbjct: 404 TPVHQTYFRNILGTMIILPLGMDLSFPASSIILSDNLPNQHQGMAGSLVNTVINYSNSLF 463

Query: 508 LGMAGSVEAYHNDNGQNILKGYRNAMIFADALAGLGIIVSGIYMVINLITIRENSKSTN 566
           LG+AG+VE + N NG ++L+GYR A+ F  A +G+ ++++G+YMV  +    ++ K  +
Sbjct: 464 LGIAGTVEQHCNKNGTDLLRGYRGALYFGIACSGVAVLIAGLYMVETIFDSYKDRKEKD 522

>Skud_13.25 Chr13 (37872..39485) [1614 bp, 537 aa] {ON} YML116W
           (REAL)
          Length = 537

 Score =  576 bits (1484), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/522 (53%), Positives = 371/522 (71%), Gaps = 3/522 (0%)

Query: 35  ESKERKDYFQLKKNYSQDSQTNTSMNEVIGXXXXXXXXXXXXXENLQSENKVLSPKYFKN 94
            ++ R+D F+  +N S  +   +S ++  G             E    + +  +P YFKN
Sbjct: 9   SAESRQDSFE-AENESVSAVKKSSRHD--GNEETVTISTDHGEEMTVDKQRWQNPNYFKN 65

Query: 95  RTHEYLFIISCMVSQFMSQAGLTQALSIMNILAEELNAEKSRQAWLMASFTLSMGSFILV 154
             HEYLFI +CM+SQ ++QAG TQ LSIMNI+A    + ++ + WLMASF L  GSFIL+
Sbjct: 66  SWHEYLFIFTCMISQLLNQAGTTQTLSIMNIIANSFGSNENSRTWLMASFPLVSGSFILI 125

Query: 155 SGRLGDIYGLKKVLLGGYAILTIWSLICGFSSYSHNDAFFITSRAFQGLGLAFVLPNSLG 214
           SGRLGDIYGLKK+L  GY ++ IWSLICG + YS +D FFI SRAFQGLG+AFVLPN LG
Sbjct: 126 SGRLGDIYGLKKMLTIGYVVIIIWSLICGLTKYSGSDTFFIISRAFQGLGIAFVLPNVLG 185

Query: 215 LIGVIYEPGSMKKNMIIGTLGAMSPIGATLGGLFAGIIGTKDPKQWPWSFYSFGIVSFCN 274
           +IG IY  G+ +KN++I  +GAM+P+GATLG LFAG+IGTK+PKQWPW+FY++ I S  N
Sbjct: 186 IIGNIYVSGTFRKNIVISLVGAMAPVGATLGCLFAGLIGTKNPKQWPWAFYAYTITSIIN 245

Query: 275 MILSWYSIPNNIPTNIYNLSMDWXXXXXXXXXXXXXNFVFNQAPIVGWQSAYIIVLLVLS 334
           + LS YSIPNNIPTNI + SMDW             NFV+NQAPI GW  AYIIVLLV+S
Sbjct: 246 LALSVYSIPNNIPTNIQHFSMDWIGSALGVIGLVLMNFVWNQAPISGWDQAYIIVLLVIS 305

Query: 335 FCALVIFVVYEVKYAKTPLIPKAISSNRGMLMILFALFCGWGAFGTWTFYYFSFVLNVRG 394
              LV+F++YE ++AK+PL+P+A+  +R M+ I+ ALF GWG+FG +TFYYF F LN+R 
Sbjct: 306 VVFLVVFIIYENRFAKSPLLPRAVLKDRHMIQIMLALFFGWGSFGIFTFYYFQFQLNIRH 365

Query: 395 YTAAWAGGSYFIFIVSGCAIATLCGFMMKKVPPSVILYISMIGFMGGCVMLTVTPIHQSY 454
           Y+A WAGG+YF+F++ G   A L G  +KKV PSV L++SM+ F  G +M +VTP+H++Y
Sbjct: 366 YSAVWAGGTYFMFLIWGIIAALLVGIYIKKVSPSVFLFLSMMAFNIGSIMASVTPVHETY 425

Query: 455 FQNILGIMFVLPIGIDLSFPAASIILSDALPIQYQGMAGSLVYTITNYSTSICLGMAGSV 514
           F+  LG M +L  G+D SFPA+SII SD LP++YQGMAGSLV T+ NYS S+CLGM  +V
Sbjct: 426 FRTQLGTMIILSFGMDFSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLCLGMGATV 485

Query: 515 EAYHNDNGQNILKGYRNAMIFADALAGLGIIVSGIYMVINLI 556
           E + + +G+++LKGYR A      LA L  I+SG+YMV  +I
Sbjct: 486 ETHVDPDGKHVLKGYRGAQYLGIGLASLACIISGLYMVERII 527

>YML116W Chr13 (38196..39824) [1629 bp, 542 aa] {ON}  ATR1Multidrug
           efflux pump of the major facilitator superfamily,
           required for resistance to aminotriazole and
           4-nitroquinoline-N-oxide
          Length = 542

 Score =  564 bits (1453), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/518 (53%), Positives = 369/518 (71%), Gaps = 3/518 (0%)

Query: 46  KKNYSQDSQ---TNTSMNEVIGXXXXXXXXXXXXXENLQSENKVLSPKYFKNRTHEYLFI 102
           K  Y  +++     +S +  IG             E + S  K  +P YFK    EYLFI
Sbjct: 13  KGEYENETELPVKKSSRDNNIGESLTATAFTQSEDEMVDSNQKWQNPNYFKYAWQEYLFI 72

Query: 103 ISCMVSQFMSQAGLTQALSIMNILAEELNAEKSRQAWLMASFTLSMGSFILVSGRLGDIY 162
            +CM+SQ ++QAG TQ LSIMNIL++   +E + ++WLMASF L  GSFIL+SGRLGDIY
Sbjct: 73  FTCMISQLLNQAGTTQTLSIMNILSDSFGSEGNSKSWLMASFPLVSGSFILISGRLGDIY 132

Query: 163 GLKKVLLGGYAILTIWSLICGFSSYSHNDAFFITSRAFQGLGLAFVLPNSLGLIGVIYEP 222
           GLKK+LL GY ++ IWSLICG + YS +D FFI SRAFQGLG+AFVLPN LG+IG IY  
Sbjct: 133 GLKKMLLVGYVLVIIWSLICGITKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIGNIYVG 192

Query: 223 GSMKKNMIIGTLGAMSPIGATLGGLFAGIIGTKDPKQWPWSFYSFGIVSFCNMILSWYSI 282
           G+ +KN++I  +GAM+PIGATLG LFAG+IGT+DPKQWPW+FY++ I +F N +LS Y+I
Sbjct: 193 GTFRKNIVISFVGAMAPIGATLGCLFAGLIGTEDPKQWPWAFYAYSIAAFINFVLSIYAI 252

Query: 283 PNNIPTNIYNLSMDWXXXXXXXXXXXXXNFVFNQAPIVGWQSAYIIVLLVLSFCALVIFV 342
           P+ IPTNI++ SMDW             NFV+NQAPI GW  AYIIV+L++S   LV+F+
Sbjct: 253 PSTIPTNIHHFSMDWIGSVLGVIGLILLNFVWNQAPISGWNQAYIIVILIISVIFLVVFI 312

Query: 343 VYEVKYAKTPLIPKAISSNRGMLMILFALFCGWGAFGTWTFYYFSFVLNVRGYTAAWAGG 402
           +YE+++AKTPL+P+A+  +R M+ I+ ALF GWG+FG +TFYYF F LN+R YTA WAGG
Sbjct: 313 IYEIRFAKTPLLPRAVIKDRHMIQIMLALFFGWGSFGIFTFYYFQFQLNIRQYTALWAGG 372

Query: 403 SYFIFIVSGCAIATLCGFMMKKVPPSVILYISMIGFMGGCVMLTVTPIHQSYFQNILGIM 462
           +YF+F++ G   A L GF +K V PSV L+ SM+ F  G +M +VTP+H++YF+  LG M
Sbjct: 373 TYFMFLIWGIIAALLVGFTIKNVSPSVFLFFSMVAFNVGSIMASVTPVHETYFRTQLGTM 432

Query: 463 FVLPIGIDLSFPAASIILSDALPIQYQGMAGSLVYTITNYSTSICLGMAGSVEAYHNDNG 522
            +L  G+DLSFPA+SII SD LP++YQGMAGSLV T+ NYS S+CLGM  +VE   N +G
Sbjct: 433 IILSFGMDLSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVETQVNSDG 492

Query: 523 QNILKGYRNAMIFADALAGLGIIVSGIYMVINLITIRE 560
           +++LKGYR A      LA L  ++SG+YMV + I  R 
Sbjct: 493 KHLLKGYRGAQYLGIGLASLACMISGLYMVESFIKGRR 530

>Suva_13.27 Chr13 (37895..39556) [1662 bp, 553 aa] {ON} YML116W
           (REAL)
          Length = 553

 Score =  557 bits (1435), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 269/522 (51%), Positives = 369/522 (70%), Gaps = 4/522 (0%)

Query: 34  PESK---ERKDYFQLKKNYSQDSQTNTSMNEVIGXXXXXXXXXXXXXENLQSENKVLSPK 90
           PE K   + +DY +++   + +++ ++  N   G             E ++++ K  +P 
Sbjct: 13  PEVKTAGKEEDYLEIENEVALEAEDSSPRNNKEGALTTIVLTNSED-EVMKTKQKWQNPN 71

Query: 91  YFKNRTHEYLFIISCMVSQFMSQAGLTQALSIMNILAEELNAEKSRQAWLMASFTLSMGS 150
           YFK    EYLFI +CM+SQ ++Q+G TQ LSIMNILA+   ++ + ++WLMASF L  GS
Sbjct: 72  YFKYPWQEYLFIFTCMISQLLNQSGTTQTLSIMNILADSFGSDANSRSWLMASFPLVSGS 131

Query: 151 FILVSGRLGDIYGLKKVLLGGYAILTIWSLICGFSSYSHNDAFFITSRAFQGLGLAFVLP 210
           FIL+SGR+GDI+GLK +LL GY ++ IWSLICG + YS +D FFI SRAFQGLG+AFVLP
Sbjct: 132 FILISGRMGDIFGLKNMLLIGYVMIIIWSLICGLTKYSGSDTFFIVSRAFQGLGIAFVLP 191

Query: 211 NSLGLIGVIYEPGSMKKNMIIGTLGAMSPIGATLGGLFAGIIGTKDPKQWPWSFYSFGIV 270
           N LG+IG +Y  G+ +KN++I  +GAM+PIGATLG  FAG+IGT +P QWPW+FY++ I 
Sbjct: 192 NVLGIIGNVYVGGTFRKNIVISFIGAMAPIGATLGCFFAGLIGTMNPNQWPWAFYAYTIT 251

Query: 271 SFCNMILSWYSIPNNIPTNIYNLSMDWXXXXXXXXXXXXXNFVFNQAPIVGWQSAYIIVL 330
           +  N+ILS Y+IPNNIPTN++  SMDW             N V+NQAPI GW  AYIIVL
Sbjct: 252 AVINLILSIYAIPNNIPTNVHRFSMDWIGSGLGVIGLVLLNLVWNQAPISGWNQAYIIVL 311

Query: 331 LVLSFCALVIFVVYEVKYAKTPLIPKAISSNRGMLMILFALFCGWGAFGTWTFYYFSFVL 390
           L++S   LV+F VYE+ +AK+PL+P+A+  +R M+ I+ +LF GWG+FG +TFYYF F L
Sbjct: 312 LIISVLFLVLFGVYEIHFAKSPLLPQAVMKDRHMIQIMLSLFFGWGSFGIFTFYYFQFQL 371

Query: 391 NVRGYTAAWAGGSYFIFIVSGCAIATLCGFMMKKVPPSVILYISMIGFMGGCVMLTVTPI 450
           N+R YT  WAGGSYF+F++ G   A L GF +K+V PSV L+ +M+ F  G +M +VTP+
Sbjct: 372 NIRHYTPLWAGGSYFMFLIWGIIAALLVGFSIKRVSPSVFLFFAMVAFNVGSIMASVTPV 431

Query: 451 HQSYFQNILGIMFVLPIGIDLSFPAASIILSDALPIQYQGMAGSLVYTITNYSTSICLGM 510
           H++YF+  +G M +L  G+DLSFPA+SII SD LP++YQGMAGSLV T+ NYS S+CLGM
Sbjct: 432 HETYFRMQMGTMIILSFGMDLSFPASSIIFSDYLPMEYQGMAGSLVNTVVNYSMSLCLGM 491

Query: 511 AGSVEAYHNDNGQNILKGYRNAMIFADALAGLGIIVSGIYMV 552
             +VE   + +G++ILKGYR A      LA L  I+SG+YMV
Sbjct: 492 GATVEMQLDPDGKHILKGYRGAQYLGIGLASLACIISGLYMV 533

>TPHA0C04790 Chr3 complement(1033653..1035323) [1671 bp, 556 aa]
           {ON} Anc_8.843 YMR279C
          Length = 556

 Score =  556 bits (1432), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 262/480 (54%), Positives = 352/480 (73%), Gaps = 1/480 (0%)

Query: 89  PKYFKNRTHEYLFIISCMVSQFMSQAGLTQALSIMNILAEELNAEKSRQAWLMASFTLSM 148
           P+YF ++ HE+ FI +C++ Q ++QAG TQ++SIMNI+AE+  +E S+QAWL ASF L  
Sbjct: 68  PQYFSSKLHEWAFIFTCLMGQLLNQAGTTQSMSIMNIIAEDFGSETSKQAWLFASFPLVS 127

Query: 149 GSFILVSGRLGDIYGLKKVLLGGYAILTIWSLICGFSSYSHNDAFFITSRAFQGLGLAFV 208
           GSFILV GR GDIYGLKK+LL GYAILTIWS+ICG + Y+H+D FFI ++AFQGLG++F+
Sbjct: 128 GSFILVGGRFGDIYGLKKMLLLGYAILTIWSIICGLTHYTHSDDFFIVAKAFQGLGVSFI 187

Query: 209 LPNSLGLIGVIYEPGSMKKNMIIGTLGAMSPIGATLGGLFAGIIGTKDPKQWPWSFYSFG 268
           LPN +GL+G IYEPGSMKKN+ I  +GAM+P+GAT GGLF+GI+  KD K WPW+FY+F 
Sbjct: 188 LPNIIGLVGTIYEPGSMKKNITISFIGAMAPLGATFGGLFSGIVVVKDDKNWPWTFYAFA 247

Query: 269 IVSFCNMILSWYSIPNNIPTNIYNLSMDWXXXXXXXXXXXXXNFVFNQAPIVGWQSAYII 328
           IVSF   +  ++ +P+N+PTN  NL MDW             +FV+NQAP+ GW  AYII
Sbjct: 248 IVSFLVGVTCYFFVPDNVPTNTNNLKMDWIGSAVGVVGLLLFSFVWNQAPMDGWDKAYII 307

Query: 329 VLLVLSFCALVIFVVYEVKYAKTPLIPKAISSNRGMLMILFALFCGWGAFGTWTFYYFSF 388
           VLLV+S   ++ F +YE+ YA+ PL+PKAI+ NR ++MIL A+F GWG FG W+FYYFSF
Sbjct: 308 VLLVISVILIIAFFIYEINYAEVPLLPKAITGNRHIIMILLAIFMGWGTFGIWSFYYFSF 367

Query: 389 VLNVRGYTAAWAGGSYFIFIVSGCAIATLCGFMMKKVPPSVILYISMIGFMGGCVMLTVT 448
            LN+R ++  W GG+YF FI+SG  IA+  GF++K + PS+IL IS+ GF  G ++  VT
Sbjct: 368 SLNLRHFSPVWTGGAYFAFILSGFTIASCVGFLIKIIRPSIILVISITGFTMGNLIFAVT 427

Query: 449 PIHQSYFQNILGIMFVLPIGIDLSFPAASIILSDALPIQYQGMAGSLVYTITNYSTSICL 508
           P  Q+Y++N  G+M +LP+G+DLSFPA+SIILSD LP +YQGMAGSLV T+ NYS S CL
Sbjct: 428 PADQTYWRNTFGMMLLLPLGMDLSFPASSIILSDQLPPEYQGMAGSLVNTMVNYSQSFCL 487

Query: 509 GMAGSVEAYHNDNGQNILKGYRNAMIFADALAGLGIIVSGIYMVINLIT-IRENSKSTNK 567
           G+A +VE   N +G ++LKGYR A      +  LGI ++ +YM     T  +E +K  N 
Sbjct: 488 GVATTVEKQINSSGDDLLKGYRAAFYTGVGIGTLGISIASLYMFETFWTDYKEKTKLAND 547

>NDAI0E00280 Chr5 (37676..39325) [1650 bp, 549 aa] {ON} Anc_8.843
          Length = 549

 Score =  552 bits (1422), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/569 (49%), Positives = 386/569 (67%), Gaps = 26/569 (4%)

Query: 3   EQNINQNLQKENTQISIISLSTAETLDIDATPESKERKDYFQLKKNYSQDSQTNTSMNEV 62
            ++ ++N+++E      I+ ST+  ++ + +  +KE  +     +  S + + NT     
Sbjct: 6   HRHNSKNVEEEKE----ITQSTSSIIEEECSSITKEENNEVSEDELPSSEQEDNT----- 56

Query: 63  IGXXXXXXXXXXXXXENLQSENKVLSPKYFKNRTHEYLFIISCMVSQFMSQAGLTQALSI 122
                            +   +K  +P YF+N+  EYLFI SCM+SQ ++QA   Q LSI
Sbjct: 57  -----------------IGDHSKWQNPDYFQNKWQEYLFIFSCMMSQLLNQAATPQTLSI 99

Query: 123 MNILAEELNAEKSRQAWLMASFTLSMGSFILVSGRLGDIYGLKKVLLGGYAILTIWSLIC 182
           MNI+ +   +E  ++ WL+ASF L  GSFIL+SGR+GDIYGLKK L+GGY    IWSLI 
Sbjct: 100 MNIITDSFKSEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLIGGYLFFIIWSLIS 159

Query: 183 GFSSYSHNDAFFITSRAFQGLGLAFVLPNSLGLIGVIYEPGSMKKNMIIGTLGAMSPIGA 242
           GF+ YSHND FFI SRAFQGLG+AF+LPN +G++G IY+P + +KN++I  +GA +PIGA
Sbjct: 160 GFTDYSHNDIFFIISRAFQGLGIAFILPNVMGIVGNIYKPDTQRKNIVISMIGASAPIGA 219

Query: 243 TLGGLFAGIIGTKDPKQWPWSFYSFGIVSFCNMILSWYSIPNNIPTNIYNLSMDWXXXXX 302
            +G LFAG+IGT++PKQWPW+FY+F I S  N+ +S YSIPNNIPTNI+  +MDW     
Sbjct: 220 FMGSLFAGLIGTENPKQWPWAFYAFAIASAINLAISIYSIPNNIPTNIHGFAMDWIGSIM 279

Query: 303 XXXXXXXXNFVFNQAPIVGWQSAYIIVLLVLSFCALVIFVVYEVKYAKTPLIPKAISSNR 362
                   NFV+NQ PIVGWQ AYIIVLL++S  ALV+F  YE+KYAK+P++P  ++ NR
Sbjct: 280 AVIGLILLNFVWNQGPIVGWQKAYIIVLLIISIIALVLFFTYEIKYAKSPILPVEVTKNR 339

Query: 363 GMLMILFALFCGWGAFGTWTFYYFSFVLNVRGYTAAWAGGSYFIFIVSGCAIATLCGFMM 422
            ++MIL ALF GWG+FG ++FYYFSF+LN+R Y+A WAG +YF+F + G   A + G  +
Sbjct: 340 HIIMILAALFLGWGSFGIFSFYYFSFLLNLRHYSALWAGTTYFMFAIWGTVAAVIVGAFI 399

Query: 423 KKVPPSVILYISMIGFMGGCVMLTVTPIHQSYFQNILGIMFVLPIGIDLSFPAASIILSD 482
           K++  SVIL+ SMI F  G +ML+VTP+ Q+YF+  LG M +L  G+D+SFPAA+IILSD
Sbjct: 400 KRISASVILFFSMIAFNIGLIMLSVTPVDQTYFRMNLGTMIILSFGMDMSFPAAAIILSD 459

Query: 483 ALPIQYQGMAGSLVYTITNYSTSICLGMAGSVEAYHNDNGQNILKGYRNAMIFADALAGL 542
            L +QYQGMAGSL  T+ NYS S+CLGM  +VE   N +G+ ILKGYR A      LAGL
Sbjct: 460 GLTMQYQGMAGSLANTMVNYSMSLCLGMGTTVERQINKSGKEILKGYRAAEYLGVGLAGL 519

Query: 543 GIIVSGIYMVINLITIRENSKSTNKPKHL 571
           GI++SGIYM   L   R+   S+N+   +
Sbjct: 520 GIVISGIYMAEVLWAKRKERLSSNRDHDM 548

>Smik_13.18 Chr13 (34422..36059) [1638 bp, 545 aa] {ON} YML116W
           (REAL)
          Length = 545

 Score =  546 bits (1407), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/540 (51%), Positives = 370/540 (68%)

Query: 28  LDIDATPESKERKDYFQLKKNYSQDSQTNTSMNEVIGXXXXXXXXXXXXXENLQSENKVL 87
           + +    ES+E+ D     +N +      +S +                 E ++   K  
Sbjct: 1   MSVHVLVESEEKNDDCMEVENEAVFPPKKSSRDNGSEETLRGTAFTNLEDEMVECNQKWQ 60

Query: 88  SPKYFKNRTHEYLFIISCMVSQFMSQAGLTQALSIMNILAEELNAEKSRQAWLMASFTLS 147
           +PKYFK    EYLFI +CM+SQ ++QAG TQ LSIMNIL++   +E + ++WLMASF L 
Sbjct: 61  NPKYFKYAWQEYLFIFTCMISQLLNQAGTTQTLSIMNILSDSFGSEGNSKSWLMASFPLV 120

Query: 148 MGSFILVSGRLGDIYGLKKVLLGGYAILTIWSLICGFSSYSHNDAFFITSRAFQGLGLAF 207
            GSFIL+SGRLGDIYGLKK+LL GY ++ IWSLICG ++YS +D FFI  RAFQGLG+AF
Sbjct: 121 SGSFILISGRLGDIYGLKKMLLVGYVLVIIWSLICGITNYSGSDTFFIICRAFQGLGIAF 180

Query: 208 VLPNSLGLIGVIYEPGSMKKNMIIGTLGAMSPIGATLGGLFAGIIGTKDPKQWPWSFYSF 267
           VLPN LG+IG IY  G+ +KN++I  +GAM+PIGATLG LFAG+IGT++P QWPW+FY+F
Sbjct: 181 VLPNVLGIIGNIYVGGTFRKNIVISFVGAMAPIGATLGCLFAGLIGTENPNQWPWAFYAF 240

Query: 268 GIVSFCNMILSWYSIPNNIPTNIYNLSMDWXXXXXXXXXXXXXNFVFNQAPIVGWQSAYI 327
            I S  N  LS Y+IPNNIPTNI++ SMDW             NFV+NQAPI GW  AYI
Sbjct: 241 SIASLINFGLSIYAIPNNIPTNIHHFSMDWIGSVLGVIGLILLNFVWNQAPISGWSQAYI 300

Query: 328 IVLLVLSFCALVIFVVYEVKYAKTPLIPKAISSNRGMLMILFALFCGWGAFGTWTFYYFS 387
           IV+L++S   L +F++YE+ +AK+PL+P A+  +  M+ I+ ALF GWG+FG +TFYYF 
Sbjct: 301 IVILIISVIFLAVFIIYEMWFAKSPLLPHAVIKDYHMIQIMLALFFGWGSFGIFTFYYFQ 360

Query: 388 FVLNVRGYTAAWAGGSYFIFIVSGCAIATLCGFMMKKVPPSVILYISMIGFMGGCVMLTV 447
           F LN+R YTA WAGG+YF+F++ G   A L GF +K V PSV L+ SM+ F  G +M +V
Sbjct: 361 FQLNIRHYTALWAGGTYFMFLIWGIIAALLVGFTIKNVSPSVYLFFSMVAFNVGSIMASV 420

Query: 448 TPIHQSYFQNILGIMFVLPIGIDLSFPAASIILSDALPIQYQGMAGSLVYTITNYSTSIC 507
           TP+H++YF+  LG M +L  G+DLSFPA+SII SD LP++YQGMAGSLV T+ NYS S+C
Sbjct: 421 TPVHETYFRTQLGTMIILSFGMDLSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLC 480

Query: 508 LGMAGSVEAYHNDNGQNILKGYRNAMIFADALAGLGIIVSGIYMVINLITIRENSKSTNK 567
           LGM  +VE   + +G+++LKGYR A      LA L  ++SG+YMV + I   +   +T  
Sbjct: 481 LGMGATVETQLDPDGKHLLKGYRGAQYLGIGLASLACMISGLYMVESFINDHKAKAATEN 540

>KNAG0J00260 Chr10 (37950..39602) [1653 bp, 550 aa] {ON} Anc_8.843
           YMR279C
          Length = 550

 Score =  537 bits (1383), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 261/528 (49%), Positives = 358/528 (67%), Gaps = 4/528 (0%)

Query: 26  ETLDIDATPESKERKDYFQLKKN--YSQDSQTNTSMNEVIGXXXXXXXXXXXXXENLQSE 83
           E  D ++       +D+  + +   Y+++ QTN  + E                E   ++
Sbjct: 2   ELSDSESECTKTITRDHITINQEAEYTKNDQTN--VEEKKNCSTESEAEWCSESEFTDND 59

Query: 84  NKVLSPKYFKNRTHEYLFIISCMVSQFMSQAGLTQALSIMNILAEELNAEKSRQAWLMAS 143
               +P YF NR  EY FI +CM++Q ++QAG  QA + MNILA+  N+   +Q WLMAS
Sbjct: 60  TPWQNPTYFANRWQEYAFISTCMLAQLLNQAGQAQATAPMNILADAFNSSAKKQTWLMAS 119

Query: 144 FTLSMGSFILVSGRLGDIYGLKKVLLGGYAILTIWSLICGFSSYSHNDAFFITSRAFQGL 203
           F L  GSFILVSGR+GDIYGLKK L+GGY ++ IWSLICGF++Y+HNDAFFI  RAFQGL
Sbjct: 120 FPLVSGSFILVSGRIGDIYGLKKTLIGGYLVVLIWSLICGFANYTHNDAFFILCRAFQGL 179

Query: 204 GLAFVLPNSLGLIGVIYEPGSMKKNMIIGTLGAMSPIGATLGGLFAGIIGTKDPKQWPWS 263
           G+AF+LPN +GLIG IY+  +++KN +I  +G  +PIGA LGG+++G+I  ++PKQWPW 
Sbjct: 180 GIAFILPNVMGLIGNIYKANTLRKNFVISFVGMCAPIGAALGGVWSGLIAHENPKQWPWI 239

Query: 264 FYSFGIVSFCNMILSWYSIPNNIPTNIYNLSMDWXXXXXXXXXXXXXNFVFNQAPIVGWQ 323
           FY++ IV   NM+++ YSIP+ +PTNI+   MDW             NFV+NQ PI GW 
Sbjct: 240 FYAYAIVVAINMVMAIYSIPSTVPTNIHGFGMDWTGSAIGVVGMILFNFVWNQGPIDGWN 299

Query: 324 SAYIIVLLVLSFCALVIFVVYEVKYAKTPLIPKAISSNRGMLMILFALFCGWGAFGTWTF 383
             YII LL++S   L+ F +YE+K+AK+PL+P  +  NR + MIL A+F GWG+FG WTF
Sbjct: 300 KGYIIALLIVSVFLLIAFFIYEIKFAKSPLLPPEVIKNRHIGMILLAVFMGWGSFGIWTF 359

Query: 384 YYFSFVLNVRGYTAAWAGGSYFIFIVSGCAIATLCGFMMKKVPPSVILYISMIGFMGGCV 443
           YY++F LN+R Y+A WAGG++F+F++ G   A L    +K+V PSV+L  SM GF  GC+
Sbjct: 360 YYYAFQLNLRHYSAVWAGGTFFMFVIWGTIAAFLVALTIKRVGPSVLLCFSMTGFTVGCI 419

Query: 444 MLTVTPIHQSYFQNILGIMFVLPIGIDLSFPAASIILSDALPIQYQGMAGSLVYTITNYS 503
           ML+VTP+HQSY++  LG+  +L  G+DLSFPA+SIILSD LP QYQGMAGSLV T+ NYS
Sbjct: 420 MLSVTPVHQSYWKMNLGMQIILSFGMDLSFPASSIILSDFLPSQYQGMAGSLVNTMVNYS 479

Query: 504 TSICLGMAGSVEAYHNDNGQNILKGYRNAMIFADALAGLGIIVSGIYM 551
           TS+CLG+  + EA  N NG + LKGYR A+     L   G++V+  Y+
Sbjct: 480 TSLCLGVGSTAEAQVNKNGTDKLKGYRAALYVGIGLGACGMLVAFCYL 527

>TDEL0B00550 Chr2 (105483..107096) [1614 bp, 537 aa] {ON} Anc_8.843
           YMR279C
          Length = 537

 Score =  535 bits (1379), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 248/490 (50%), Positives = 351/490 (71%), Gaps = 1/490 (0%)

Query: 81  QSENKVLSPKYFKNRTHEYLFIISCMVSQFMSQAGLTQALSIMNILAEELNAEKSRQAWL 140
           + E+    P YFK +  E LF++SCM+ Q ++QAG T  LS M +L  EL++  ++ +WL
Sbjct: 46  EPESPWQDPNYFKGKWDEVLFVLSCMMGQLLNQAGSTMTLSTMKVLERELDSSSAKSSWL 105

Query: 141 MASFTLSMGSFILVSGRLGDIYGLKKVLLGGYAILTIWSLICGFSSYSHNDAFFITSRAF 200
           MASF L  GSFIL+SGRLGDIYGLKK+LL GY  LTIWSLICG SS+SHND FFITSRAF
Sbjct: 106 MASFPLVSGSFILISGRLGDIYGLKKMLLLGYIWLTIWSLICGLSSFSHNDTFFITSRAF 165

Query: 201 QGLGLAFVLPNSLGLIGVIYEPGSMKKNMIIGTLGAMSPIGATLGGLFAGIIGTKDPKQW 260
           QGLG++FVLPN LG++G IY+PG+ +KN++I  +G  +PIGAT GGLFAG++  +    W
Sbjct: 166 QGLGISFVLPNLLGIVGNIYKPGTRRKNIVISLIGMCAPIGATFGGLFAGVVVIRKDSDW 225

Query: 261 PWSFYSFGIVSFCNMILSWYSIPNNIPTNIYNLSMDWXXXXXXXXXXXXXNFVFNQAPIV 320
           PW+FY++ I +F   I+S++ IPN+IP N+   +MDW             NFV+NQ+ +V
Sbjct: 226 PWAFYAYTIAAFLTTIISYFVIPNSIPVNVNKFAMDWIGSALGVSGLVLFNFVWNQSTVV 285

Query: 321 GWQSAYIIVLLVLSFCALVIFVVYEVKYAKTPLIPKAISSNRGMLMILFALFCGWGAFGT 380
           GW + YII LL++S   + +F ++E+KYAK PL+PK ++ +R ++MIL +L  GWG+FG 
Sbjct: 286 GWATGYIIALLIVSIFLIALFFIFEIKYAKVPLLPKEVTESRSIIMILASLMAGWGSFGI 345

Query: 381 WTFYYFSFVLNVRGYTAAWAGGSYFIFIVSGCAIATLCGFMMKKVPPSVILYISMIGFMG 440
           W FYYF FVL +R Y+  WAGG++F+  + GC  A   GF +K+V P+V+L+ SMI F  
Sbjct: 346 WIFYYFQFVLTLRNYSPVWAGGTFFMVSIVGCIAALTVGFSIKRVGPAVLLFFSMIAFTC 405

Query: 441 GCVMLTVTPIHQSYFQNILGIMFVLPIGIDLSFPAASIILSDALPIQYQGMAGSLVYTIT 500
           G ++L+VTP+H++YF++ LG M +L  G+DLSFPAASIILSD L +QYQGMAGSLV T+ 
Sbjct: 406 GSIILSVTPVHETYFRSCLGAMVILSFGMDLSFPAASIILSDELSMQYQGMAGSLVNTVV 465

Query: 501 NYSTSICLGMAGSVEAYHNDNGQNILKGYRNAMIFADALAGLGIIVSGIYMVINLITIRE 560
           NYS S+ LG+ G++E   N +G  +L+G+R A+ FA  +  LGI++SG++ V+    +R 
Sbjct: 466 NYSMSLFLGIGGTIERQINKSGDRLLEGFRAALYFAIGVGSLGILISGVF-VLQKELMRS 524

Query: 561 NSKSTNKPKH 570
            S+  N+ ++
Sbjct: 525 KSRKENELEY 534

>SAKL0D01386g Chr4 (109619..111184) [1566 bp, 521 aa] {ON}
           uniprot|Q875S7 Saccharomyces kluyveri ATR1
          Length = 521

 Score =  535 bits (1377), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 261/489 (53%), Positives = 352/489 (71%), Gaps = 5/489 (1%)

Query: 78  ENLQSENK----VLSPKYFKNRTHEYLFIISCMVSQFMSQAGLTQALSIMNILAEELNAE 133
            ++Q ++K    +  P YF     EYLFI + M+SQ ++QAG TQ LS++NIL++  ++ 
Sbjct: 29  SDVQVDDKKWPSIQDPTYFSAPWKEYLFIFASMMSQLLNQAGTTQTLSLINILSKNFDSS 88

Query: 134 KSRQAWLMASFTLSMGSFILVSGRLGDIYGLKKVLLGGYAILTIWSLICGFSSYSHNDAF 193
            S+Q WLMASF L  GSFILVSG++GDIYGLKK LL GY +  IWSLICG +SY+ +  F
Sbjct: 89  TSQQTWLMASFPLVSGSFILVSGKIGDIYGLKKTLLVGYVVTIIWSLICGLTSYTSSVEF 148

Query: 194 FITSRAFQGLGLAFVLPNSLGLIGVIYEPGSMKKNMIIGTLGAMSPIGATLGGLFAGIIG 253
           FI SRAFQGLG+AF+LPN +G++G IY  G+ +KNM+I  +GA +PIGAT+G LF+G+IG
Sbjct: 149 FIISRAFQGLGIAFILPNIMGIVGNIYVAGTTRKNMVISLIGACAPIGATMGVLFSGLIG 208

Query: 254 TKDPKQWPWSFYSFGIVSFCNMILSWYSIPNNIPTNIYNLSMDWXXXXXXXXXXXXXNFV 313
           T   ++W W+FY++ I +  NM LS + IPN IPTN+   SMDW             NFV
Sbjct: 209 TLS-ERWAWTFYAYTITAAINMGLSIWVIPNTIPTNVRGSSMDWIGSGIGLLGMILFNFV 267

Query: 314 FNQAPIVGWQSAYIIVLLVLSFCALVIFVVYEVKYAKTPLIPKAISSNRGMLMILFALFC 373
           +NQ PIVGW +AYIIVLL++S  A+V F +YE KYA  PLIP+    N  +LM L A+F 
Sbjct: 268 WNQGPIVGWDTAYIIVLLIVSVAAIVAFFLYETKYANDPLIPRPAMHNHRLLMTLLAVFF 327

Query: 374 GWGAFGTWTFYYFSFVLNVRGYTAAWAGGSYFIFIVSGCAIATLCGFMMKKVPPSVILYI 433
           GWG+FG WTFYYF FVLN+R YT  WAGGSYF+F++ G   A   G+ +K++PPS+IL++
Sbjct: 328 GWGSFGIWTFYYFCFVLNLREYTPLWAGGSYFMFLIWGIIAAISVGYTIKRIPPSLILFL 387

Query: 434 SMIGFMGGCVMLTVTPIHQSYFQNILGIMFVLPIGIDLSFPAASIILSDALPIQYQGMAG 493
           SM+ F  GC+ML+VTP+ Q+YF+ ILG+M +L  G+DLSFPA+SIILSD LP++ QGMAG
Sbjct: 388 SMLAFDCGCIMLSVTPVDQTYFRMILGMMIILSFGMDLSFPASSIILSDELPMENQGMAG 447

Query: 494 SLVYTITNYSTSICLGMAGSVEAYHNDNGQNILKGYRNAMIFADALAGLGIIVSGIYMVI 553
           SLV T+ NYS S+CLG+AG+VE   N NG ++LKGYR A+     LA LG+ +S ++M+ 
Sbjct: 448 SLVSTMINYSMSMCLGIAGTVEHQINKNGDDLLKGYRAALYLGIGLASLGVFISALFMLE 507

Query: 554 NLITIRENS 562
           N + +R  +
Sbjct: 508 NYLRMRRRN 516

>NCAS0B00290 Chr2 (33760..35388) [1629 bp, 542 aa] {ON} Anc_8.843
          Length = 542

 Score =  532 bits (1371), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 256/470 (54%), Positives = 343/470 (72%)

Query: 82  SENKVLSPKYFKNRTHEYLFIISCMVSQFMSQAGLTQALSIMNILAEELNAEKSRQAWLM 141
             +K  +P YF+N+  EYLFI SCM+SQ ++QA   Q LSIMNI+ +  N+E  ++ WL+
Sbjct: 52  EHSKWQNPDYFQNQWQEYLFIFSCMMSQLLNQAATPQTLSIMNIITDSFNSEGGKETWLI 111

Query: 142 ASFTLSMGSFILVSGRLGDIYGLKKVLLGGYAILTIWSLICGFSSYSHNDAFFITSRAFQ 201
           ASF L  GSFIL+SGR+GDIYGLKK L+GGY    IWS+I G + YSH+D FFI SRAFQ
Sbjct: 112 ASFPLVSGSFILISGRIGDIYGLKKTLVGGYIFFIIWSIISGLTKYSHSDTFFIVSRAFQ 171

Query: 202 GLGLAFVLPNSLGLIGVIYEPGSMKKNMIIGTLGAMSPIGATLGGLFAGIIGTKDPKQWP 261
           GL +AF+LPN +G++G IY+P S +KN++I  +GA +PIGA  G LFAG+IGT+DP QWP
Sbjct: 172 GLSIAFILPNVMGIVGNIYKPDSNRKNIVISMIGASAPIGAFFGSLFAGLIGTEDPDQWP 231

Query: 262 WSFYSFGIVSFCNMILSWYSIPNNIPTNIYNLSMDWXXXXXXXXXXXXXNFVFNQAPIVG 321
           W+FY+F I S  N+ +S YSIPN++PTN++  +MDW             NFV+NQ PIVG
Sbjct: 232 WAFYAFAIASAFNLAISIYSIPNSVPTNVHGFAMDWIGSVLAVIGLILLNFVWNQGPIVG 291

Query: 322 WQSAYIIVLLVLSFCALVIFVVYEVKYAKTPLIPKAISSNRGMLMILFALFCGWGAFGTW 381
           WQ+AYII LLV+S   L +F  YEVKYA++PL+P  ++ NR ++MIL ALF GWG+FG +
Sbjct: 292 WQTAYIIALLVVSVFFLALFFTYEVKYAESPLLPVEVTKNRHIIMILAALFLGWGSFGIF 351

Query: 382 TFYYFSFVLNVRGYTAAWAGGSYFIFIVSGCAIATLCGFMMKKVPPSVILYISMIGFMGG 441
           +FYYFSF+LN+R Y+A WAG +YF+F + G   A + G  +KK+  + IL++SM+ F  G
Sbjct: 352 SFYYFSFLLNLRHYSALWAGTTYFMFAIWGTVAAVIVGAFIKKISAAFILFMSMVAFNIG 411

Query: 442 CVMLTVTPIHQSYFQNILGIMFVLPIGIDLSFPAASIILSDALPIQYQGMAGSLVYTITN 501
            +ML+VTP+ Q+YF+  LG M +L  G+D+SFPAA+IILSD L +QYQGMAGSL  T+ N
Sbjct: 412 IIMLSVTPVDQTYFRMNLGTMIILSFGMDMSFPAAAIILSDGLTMQYQGMAGSLANTMVN 471

Query: 502 YSTSICLGMAGSVEAYHNDNGQNILKGYRNAMIFADALAGLGIIVSGIYM 551
           YS S+CLGM  +VE   N +G ++LKGYR A      LAGLGII++ IY+
Sbjct: 472 YSMSLCLGMGTTVERQINKSGNDLLKGYRGAEYLGIGLAGLGIIITAIYL 521

>NCAS0A02540 Chr1 complement(481807..483426) [1620 bp, 539 aa] {ON} 
          Length = 539

 Score =  530 bits (1365), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 250/498 (50%), Positives = 351/498 (70%), Gaps = 5/498 (1%)

Query: 80  LQSENKVLSPKYFKNRTHEYLFIISCMVSQFMSQAGLTQALSIMNILAEELNAEKSRQAW 139
           L  ++   +P YF ++  EY FI +CMV+  ++QAG TQ LS MN+++E  +++  +Q W
Sbjct: 44  LDDDSPWQNPNYFSSKYKEYFFIFTCMVANLLNQAGQTQVLSTMNVISESFHSDSGKQTW 103

Query: 140 LMASFTLSMGSFILVSGRLGDIYGLKKVLLGGYAILTIWSLICGFSSYSHNDAFFITSRA 199
           LMASF L  GSFIL+SGR+GDIYGLKK ++GGY  + IWSL+CGF+ ++HND FFI  RA
Sbjct: 104 LMASFPLVSGSFILISGRIGDIYGLKKTMIGGYIFMIIWSLLCGFADFTHNDTFFIVCRA 163

Query: 200 FQGLGLAFVLPNSLGLIGVIYEPGSMKKNMIIGTLGAMSPIGATLGGLFAGIIGTKDPKQ 259
           FQGLG++F+LPN +GLIG IY+ G+++KN++I  +G  +P GA +G L+ G+I T++ KQ
Sbjct: 164 FQGLGISFILPNVMGLIGNIYKVGTLRKNIVISMIGLTAPTGACMGALWGGLIVTENAKQ 223

Query: 260 WPWSFYSFGIVSFCNMILSWYSIPNNIPTNIYNLSMDWXXXXXXXXXXXXXNFVFNQAPI 319
           WPW FY++ +    N+I++ YS+PN IPTN++N +MDW             NFV+NQ P+
Sbjct: 224 WPWIFYAYALTGLVNLIMALYSVPNCIPTNVHNFAMDWIGSIIGVVGLILFNFVWNQGPV 283

Query: 320 VGWQSAYIIVLLVLSFCALVIFVVYEVKYAKTPLIPKAISSNRGMLMILFALFCGWGAFG 379
            GW  AYIIVLL++S   LV FVVYE+KY  +PL+P  ++ N  +L IL  LF GWGAFG
Sbjct: 284 AGWDKAYIIVLLIISVLFLVAFVVYELKYPISPLLPVEVTKNGQILTILSILFLGWGAFG 343

Query: 380 TWTFYYFSFVLNVRGYTAAWAGGSYFIFIVSGCAIATLCGFMMKKVPPSVILYISMIGFM 439
            WTFYYF+F LN+R Y+  W GG+YF+FI+ G   A +  F +KKV P+++L+ S +GF 
Sbjct: 344 IWTFYYFAFQLNLRDYSPVWVGGTYFMFIIWGTIAALIVAFTIKKVGPAILLFFSALGFT 403

Query: 440 GGCVMLTVTPIHQSYFQNILGIMFVLPIGIDLSFPAASIILSDALPIQYQGMAGSLVYTI 499
            G +ML+VTPIHQ Y++  LG+  +L  G+DLSFPA+SIILSD LP+QYQGMAGSLV T+
Sbjct: 404 MGSLMLSVTPIHQMYWRMNLGMQIILCFGMDLSFPASSIILSDHLPMQYQGMAGSLVNTV 463

Query: 500 TNYSTSICLGMAGSVEAYHNDNGQNILKGYRNAMIFADALAGLGIIVSGIYMVINLITIR 559
            NY+TS+CLGM  +VE   N +G+++LKGYR+A+  A  L GLG  ++ I +   L   R
Sbjct: 464 INYATSLCLGMGTTVERQINKSGEDLLKGYRSALYLAVGLGGLGSCIAFINLCYTLWMKR 523

Query: 560 ENSKSTNKPKHLETYSTD 577
                 ++   L++ STD
Sbjct: 524 R-----DRLADLKSVSTD 536

>Kwal_27.10245 s27 (259090..260637) [1548 bp, 515 aa] {ON} YML116W
           (ATR1) - predicted protein is very hydrophobic, has many
           membrane-spanning regions, several potential
           glycosylation sites, potential ATP-binding site [contig
           38] FULL
          Length = 515

 Score =  528 bits (1359), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 249/487 (51%), Positives = 352/487 (72%), Gaps = 1/487 (0%)

Query: 78  ENLQSENKVLSPKYFKNRTHEYLFIISCMVSQFMSQAGLTQALSIMNILAEELNAEKSRQ 137
           E +  ++++ +P YF     EY+F++S M+SQ ++QA  TQ   + ++L+++LNA+ S+Q
Sbjct: 30  EAIGPKSRLQNPDYFDKPWKEYIFVLSSMLSQLLNQAATTQTNPLFDVLSKDLNAKVSQQ 89

Query: 138 AWLMASFTLSMGSFILVSGRLGDIYGLKKVLLGGYAILTIWSLICGFSSYSHNDAFFITS 197
            WLMASF L  GSFILVSG++GDIYGLKK LLGGY ++ IWSLICG SSY+HN  FF+ +
Sbjct: 90  PWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYVVVVIWSLICGLSSYAHNVDFFVVA 149

Query: 198 RAFQGLGLAFVLPNSLGLIGVIYEPGSMKKNMIIGTLGAMSPIGATLGGLFAGIIGTKDP 257
           R+FQGLG+AFVLPN +G++G IY+P +  KN++   +GA +PIGATLG +F+G+IG +  
Sbjct: 150 RSFQGLGIAFVLPNVMGIVGNIYKPNTEAKNLVFSLIGACAPIGATLGCVFSGLIGART- 208

Query: 258 KQWPWSFYSFGIVSFCNMILSWYSIPNNIPTNIYNLSMDWXXXXXXXXXXXXXNFVFNQA 317
             W W+FY++ I +  N +++ + IPNNIPTN+    MDW             NFV+NQA
Sbjct: 209 DLWGWTFYAYAITAALNGLVALWIIPNNIPTNVNEYKMDWIGSAIGVFGLILFNFVWNQA 268

Query: 318 PIVGWQSAYIIVLLVLSFCALVIFVVYEVKYAKTPLIPKAISSNRGMLMILFALFCGWGA 377
           PI GW SAYIIVLL+++  AL+ F+ YE+++AK PL+P ++  NR ++MIL +LF GWG+
Sbjct: 269 PIAGWGSAYIIVLLIVAVVALIAFITYEIRFAKQPLLPHSVLFNRKLMMILSSLFFGWGS 328

Query: 378 FGTWTFYYFSFVLNVRGYTAAWAGGSYFIFIVSGCAIATLCGFMMKKVPPSVILYISMIG 437
           FG WTFYY SF+LN+R Y+  WAGG+YF+F + G   + L G+ + K  P+VIL++SM+ 
Sbjct: 329 FGIWTFYYMSFMLNLRHYSPLWAGGTYFMFAIWGIVASLLVGYTIHKTGPAVILFLSMVA 388

Query: 438 FMGGCVMLTVTPIHQSYFQNILGIMFVLPIGIDLSFPAASIILSDALPIQYQGMAGSLVY 497
           F  GC+ML VTP+HQ+YF+  LGIM +L  G+DLSFPAASIILSD LP QYQGMAGSLV 
Sbjct: 389 FDCGCIMLAVTPVHQTYFRMTLGIMIILSFGMDLSFPAASIILSDQLPSQYQGMAGSLVS 448

Query: 498 TITNYSTSICLGMAGSVEAYHNDNGQNILKGYRNAMIFADALAGLGIIVSGIYMVINLIT 557
           T+ +YS S+CLG++G+ E   N NG ++LKGY+ A+     LA LG+++SG +M+ +  T
Sbjct: 449 TMISYSMSLCLGISGTAEHQVNKNGIDLLKGYQAALYVGIGLASLGVVISGAFMIEDWWT 508

Query: 558 IRENSKS 564
            R    +
Sbjct: 509 SRRKRTT 515

>Suva_13.467 Chr13 complement(807375..809006) [1632 bp, 543 aa] {ON}
           YMR279C (REAL)
          Length = 543

 Score =  528 bits (1359), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 257/480 (53%), Positives = 342/480 (71%), Gaps = 3/480 (0%)

Query: 88  SPKYFKNRTHEYLFIISCMVSQFMSQAGLTQALSIMNILAEELNAEKSRQAWLMASFTLS 147
            P YF +   E +FI++CM++Q ++QAG T AL+IMN+L++  N+E  +QAWLMASF L 
Sbjct: 59  DPTYFSSFGRELMFIVTCMLAQLLNQAGQTHALTIMNVLSKSFNSESDKQAWLMASFPLV 118

Query: 148 MGSFILVSGRLGDIYGLKKVLLGGYAILTIWSLICGFSSYSHNDAFFITSRAFQGLGLAF 207
            GSFIL+SGRLGDIYGLKK+L+ GY  + +WSLICG S YS+NDAFFIT RAFQGLG+AF
Sbjct: 119 AGSFILISGRLGDIYGLKKMLMIGYVTIIVWSLICGLSKYSNNDAFFITCRAFQGLGIAF 178

Query: 208 VLPNSLGLIGVIYEPGSMKKNMIIGTLGAMSPIGATLGGLFAGIIGTKDPKQWPWSFYSF 267
           +LPN +GL+G +Y+ GS +KN++I  +GA +P G   GGLF G+I  +D +QWPW FY+F
Sbjct: 179 ILPNVMGLVGHVYKVGSTRKNLVISFIGACAPAGGMFGGLFGGLIVNEDSEQWPWVFYAF 238

Query: 268 GIVSFCNMILSWYSIPNNIPTNIYNLSMDWXXXXXXXXXXXXXNFVFNQAPIVGWQSAYI 327
            I  F NMIL+WYSIPNNIPTN++  SMDW             NFV+NQAP  GW +AYI
Sbjct: 239 AIAFFLNMILAWYSIPNNIPTNVHGFSMDWTGSVLAVIGLILFNFVWNQAPTAGWGTAYI 298

Query: 328 IVLLVLSFCALVIFVVYEVKYAKTPLIPKAISSNRGMLMILFALFCGWGAFGTWTFYYFS 387
           I LL++S   LV F VYEVKYAK PL+P A++ NR M+MIL A+F GWG+FG WTFYY S
Sbjct: 299 IALLIISVFFLVAFFVYEVKYAKVPLLPHAVTKNRHMIMILLAVFLGWGSFGIWTFYYMS 358

Query: 388 FVLNVRGYTAAWAGGSYFIFIVSGCAIATLCGFMMKKVPPSVILYISMIGFMGGCVMLTV 447
           F LN+R Y+  W GG+YF+F++ G   A +    +K+V P+ +L  +++ F  G +M +V
Sbjct: 359 FQLNLRHYSPVWTGGTYFVFVIFGTIAAFMVALSIKRVGPAFLLCFALVAFDVGSIMFSV 418

Query: 448 TPIHQSYFQNILGIMFVLPIGIDLSFPAASIILSDALPIQYQGMAGSLVYTITNYSTSIC 507
            P+ QS+++   G+  +L  G+DLSFPA+SIILSD LP++YQGMAGSLV T+ NYS S+C
Sbjct: 419 LPVKQSFWKLNFGMQAILCFGMDLSFPASSIILSDGLPMEYQGMAGSLVNTVINYSASLC 478

Query: 508 LGMAGSVEAYHNDNGQNILKGYRNAMIFADALAGLGIIVSGIYMVINLITIRENSKSTNK 567
           LGM  +VE   N NG+++LKGYR A+     LA LG+++S  YM   L T   N +   K
Sbjct: 479 LGMGATVEHQINKNGKDLLKGYRGAIYLGVGLASLGVLISFTYM---LETFWNNRRDRQK 535

>CAGL0B02343g Chr2 complement(222130..223743) [1614 bp, 537 aa] {ON}
           similar to uniprot|P13090 Saccharomyces cerevisiae
           YML116w ATR1 Aminotriazole resistance protein or
           uniprot|Q03263 Saccharomyces cerevisiae YMR279c
          Length = 537

 Score =  527 bits (1357), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 257/489 (52%), Positives = 354/489 (72%), Gaps = 1/489 (0%)

Query: 78  ENLQSENKVLSPKYFKNRTHEYLFIISCMVSQFMSQAGLTQALSIMNILAEELNAEKSRQ 137
           + +    K  +P+YF +   EYLF+ SC VSQ ++QAG  Q   IMNI+A+ L+++  +Q
Sbjct: 42  QAIDGNQKWQNPEYFDSTLKEYLFLCSCFVSQLLNQAGAIQTQPIMNIVADSLDSQNGKQ 101

Query: 138 AWLMASFTLSMGSFILVSGRLGDIYGLKKVLLGGYAILTIWSLICGFSSYSHNDAFFITS 197
           AWLMA+F L  GSFIL+SGR+GDIYGLKK LL GY  L +WSLICG + Y+H+D+FFI S
Sbjct: 102 AWLMAAFPLISGSFILISGRIGDIYGLKKTLLVGYLFLIVWSLICGLTKYAHSDSFFIVS 161

Query: 198 RAFQGLGLAFVLPNSLGLIGVIYEPGSMKKNMIIGTLGAMSPIGATLGGLFAGIIGTKDP 257
           RAFQGLG++ +LPN LG++G IY  GS +KNM+I  +G M+PIGATLG +F+G+IGT+D 
Sbjct: 162 RAFQGLGISLILPNILGIVGSIYIAGSKRKNMVISLIGCMAPIGATLGAVFSGLIGTEDA 221

Query: 258 KQWPWSFYSFGIVSFCNMILSWYSIPNNIPTNIYNLSMDWXXXXXXXXXXXXXNFVFNQA 317
            QWPW+FYS+ I +  N +LS + IPN IPTN++   MDW             NFV+NQA
Sbjct: 222 NQWPWAFYSYAITAAINFVLSIWLIPNTIPTNVHGHKMDWIGSGLGVVGLIMLNFVWNQA 281

Query: 318 PIVGWQSAYIIVLLVLSFCALVIFVVYEVKYAK-TPLIPKAISSNRGMLMILFALFCGWG 376
           PI GW SAY+IVLL++S   L+ F +YE+ +    PL+PK +  +   +++LFALF GWG
Sbjct: 282 PIDGWDSAYLIVLLIISVLLLIAFFIYELHFVNGNPLLPKEVLKSPKTIIVLFALFFGWG 341

Query: 377 AFGTWTFYYFSFVLNVRGYTAAWAGGSYFIFIVSGCAIATLCGFMMKKVPPSVILYISMI 436
           +FG ++FYYF+F LN+R YT  WAGG+YF+F++ G   A + GF +KKV PS+IL++SM+
Sbjct: 342 SFGIFSFYYFTFQLNLRHYTPLWAGGTYFMFLIWGIVAALVVGFTIKKVYPSIILFLSMV 401

Query: 437 GFMGGCVMLTVTPIHQSYFQNILGIMFVLPIGIDLSFPAASIILSDALPIQYQGMAGSLV 496
            F  G ++++VTPIHQ+YF+N LG+M +L  G+DLSFPA+SI+LSD LP+QYQGMAGSLV
Sbjct: 402 AFNCGSIIMSVTPIHQTYFRNHLGMMIILSFGMDLSFPASSILLSDKLPLQYQGMAGSLV 461

Query: 497 YTITNYSTSICLGMAGSVEAYHNDNGQNILKGYRNAMIFADALAGLGIIVSGIYMVINLI 556
            T+ NYS S CLG+AG VE + N++G+++LKGYR A      LA +  I+SG  M+  +I
Sbjct: 462 NTMVNYSMSFCLGVAGVVEQHVNNHGKDVLKGYRGAFYLGIGLASMACIISGALMLSEII 521

Query: 557 TIRENSKST 565
             R+N K +
Sbjct: 522 QGRKNEKDS 530

>Skud_13.451 Chr13 complement(798006..799625) [1620 bp, 539 aa] {ON}
           YMR279C (REAL)
          Length = 539

 Score =  526 bits (1354), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 256/486 (52%), Positives = 348/486 (71%), Gaps = 4/486 (0%)

Query: 88  SPKYFKNRTHEYLFIISCMVSQFMSQAGLTQALSIMNILAEELNAEKSRQAWLMASFTLS 147
            P YF +   E +FI +CM++Q ++QAG T AL IMN+L++   +E + QAWLMASF L+
Sbjct: 58  DPTYFSSFGKELMFIGTCMLAQLLNQAGQTHALCIMNVLSKSFGSESNNQAWLMASFPLA 117

Query: 148 MGSFILVSGRLGDIYGLKKVLLGGYAILTIWSLICGFSSYSHNDAFFITSRAFQGLGLAF 207
            GSFIL+SGRLGDIYGLKK+L+ GY I+ +WS+I G S YS+ND+FFIT RAFQG+G+AF
Sbjct: 118 AGSFILISGRLGDIYGLKKMLMIGYVIIIVWSIISGLSKYSNNDSFFITCRAFQGVGIAF 177

Query: 208 VLPNSLGLIGVIYEPGSMKKNMIIGTLGAMSPIGATLGGLFAGIIGTKDPKQWPWSFYSF 267
           +LPN +GL+G +Y+ GS++KN++I  +GA  P GA  GG+F G+I T+DP QWPW FY+F
Sbjct: 178 ILPNIMGLVGHVYKVGSLRKNLVISVIGACGPTGALFGGVFGGLIVTEDPNQWPWVFYAF 237

Query: 268 GIVSFCNMILSWYSIPNNIPTNIYNLSMDWXXXXXXXXXXXXXNFVFNQAPIVGWQSAYI 327
           GI +F +M+++WYSIPNN+PTN++ LSMDW             NFV+N+API GW  AYI
Sbjct: 238 GIATFISMLMAWYSIPNNVPTNVHGLSMDWTGSVLAVIGLILFNFVWNEAPIAGWDKAYI 297

Query: 328 IVLLVLSFCALVIFVVYEVKYAKTPLIPKAISSNRGMLMILFALFCGWGAFGTWTFYYFS 387
           IVLLV+S   LV F VYE+KYA+ PL+P A++ NR M+MIL A+F GWG+FG WTFYY S
Sbjct: 298 IVLLVVSVFFLVAFFVYEIKYAEVPLLPHAVTKNRHMIMILLAVFVGWGSFGIWTFYYVS 357

Query: 388 FVLNVRGYTAAWAGGSYFIFIVSGCAIATLCGFMMKKVPPSVILYISMIGFMGGCVMLTV 447
           F LN+R Y+  W GG+YF+F + G   A    F +K++ P+++L  +++ F  G +M +V
Sbjct: 358 FQLNLRHYSPVWTGGTYFVFAIFGTIAAFFVAFSIKRLGPALLLCFALMAFDAGSIMFSV 417

Query: 448 TPIHQSYFQNILGIMFVLPIGIDLSFPAASIILSDALPIQYQGMAGSLVYTITNYSTSIC 507
            P+ QSY++    +  VL  G+DLSFPA+SIILSD LP+QYQGMAGSLV T+ NYS S+C
Sbjct: 418 LPVEQSYWKLNFAMQAVLCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINYSASLC 477

Query: 508 LGMAGSVEAYHNDNGQNILKGYRNAMIFADALAGLGIIVSGIYMVINLITIRENSKSTNK 567
           LGM  +VE   N +G+N+L+GYR A+     LA LG+++S  YM   L T+    K   +
Sbjct: 478 LGMGATVEHQINKSGKNVLEGYRAAVYLGIGLASLGVLISVTYM---LETVWNERKKCQR 534

Query: 568 PKHLET 573
            K LE 
Sbjct: 535 -KSLEA 539

>KLTH0C03806g Chr3 (332195..333772) [1578 bp, 525 aa] {ON} similar
           to uniprot|P13090 Saccharomyces cerevisiae YML116W ATR1
           Multidrug efflux pump of the major facilitator
           superfamily required for resistance to aminotriazole and
           4-nitroquinoline-N-oxide
          Length = 525

 Score =  525 bits (1352), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 265/495 (53%), Positives = 354/495 (71%), Gaps = 3/495 (0%)

Query: 80  LQSENKVLSPKYFKNRTHEYLFIISCMVSQFMSQAGLTQALSIMNILAEELNAEKSRQAW 139
           L S +++ +P YF  +  EYLF+IS M+SQ ++QA   QA  + ++L+E+L A+ S+QAW
Sbjct: 32  LASRSRLQNPDYFDKQWKEYLFVISSMLSQLLNQAAALQANPLFDLLSEDLKAKASQQAW 91

Query: 140 LMASFTLSMGSFILVSGRLGDIYGLKKVLLGGYAILTIWSLICGFSSYSHNDAFFITSRA 199
           LMASF L  GSFILVSG++GDIYGLKK LLGGYA++ IWSLICG SSY+HN  FFI +R+
Sbjct: 92  LMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYAVVVIWSLICGLSSYAHNVDFFIVARS 151

Query: 200 FQGLGLAFVLPNSLGLIGVIYEPGSMKKNMIIGTLGAMSPIGATLGGLFAGIIGTKDPKQ 259
           FQGLG+AFVLPN  G++G IY+P +  KNM+   +GA +PIGATLG LF+G+IGT + + 
Sbjct: 152 FQGLGIAFVLPNVTGIVGNIYKPNTKAKNMVFSMIGACAPIGATLGCLFSGLIGT-ESEA 210

Query: 260 WPWSFYSFGIVSFCNMILSWYSIPNNIPTNIYNLSMDWXXXXXXXXXXXXXNFVFNQAPI 319
           W W+FY++ IV+  N +++WY IP+NIPTN++   MDW             NFV+NQAP 
Sbjct: 211 WAWTFYAYTIVAALNGLIAWYVIPDNIPTNVHKFKMDWLGSFLGVCGLIMFNFVWNQAPT 270

Query: 320 VGWQSAYIIVLLVLSFCALVIFVVYEVKYAKTPLIPKAISSNRGMLMILFALFCGWGAFG 379
            GW SAYIIVLLV+S   L+IF+++E ++AK PL+P+A+  NR ++MIL +LF GWG+FG
Sbjct: 271 DGWDSAYIIVLLVISVILLLIFIIFEARFAKEPLLPRAVLFNRKLMMILASLFLGWGSFG 330

Query: 380 TWTFYYFSFVLNVRGYTAAWAGGSYFIFIVSGCAIATLCGFMMKKVPPSVILYISMIGFM 439
            WT+YY +FVLN+R YT  WAGGSYF+F + G   A L G  + K  P++IL  S+I F 
Sbjct: 331 IWTYYYMAFVLNLRHYTPLWAGGSYFMFAIFGTIAAFLVGHTIHKTGPAIILLASVIAFD 390

Query: 440 GGCVMLTVTPIHQSYFQNILGIMFVLPIGIDLSFPAASIILSDALPIQYQGMAGSLVYTI 499
            GC+ML+VTP+ Q+YF+  LG M +L  G+DLSFPA+SIILSD LP QYQGMAGSLV T+
Sbjct: 391 VGCIMLSVTPVDQTYFRMSLGTMVILSFGMDLSFPASSIILSDQLPSQYQGMAGSLVNTM 450

Query: 500 TNYSTSICLGMAGSVEAYHNDNGQNILKGYRNAMIFADALAGLGIIVSGIYMVINLITIR 559
            NYS S+CLG++G+ E   N +G ++LKGYR A+     LA +GI VSG Y + +  T R
Sbjct: 451 INYSMSLCLGVSGTAERQVNKDGTDLLKGYRAALYVGIGLASVGIFVSGAYAIEDWWTRR 510

Query: 560 ENSKSTNK--PKHLE 572
                  K   KH E
Sbjct: 511 RERSVRIKLDEKHQE 525

>TBLA0C01160 Chr3 complement(246034..247836) [1803 bp, 600 aa] {ON} 
          Length = 600

 Score =  527 bits (1358), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 275/582 (47%), Positives = 368/582 (63%), Gaps = 10/582 (1%)

Query: 3   EQNINQNLQKENTQISIISLSTAET--LDIDATPESKERKDYFQLKKNYSQDSQTNTSMN 60
           +Q +  +L+K   Q++ I  S +E    DI   P            KN +     N    
Sbjct: 22  DQQLELHLKKIKAQLTSIRDSVSENSNEDIYDLPRKPGNNKNILTGKNDTMPKDQNLVCQ 81

Query: 61  EVIGXXXXXXXXXXXXXEN---LQSENKVLSPKYFKNRTHEYLFIISCMVSQFMSQAGLT 117
            ++              +N   +     +  P  FKNR  E+ F++  ++ QF+SQ GLT
Sbjct: 82  NIMQFASFESSLSATPPDNKPFITESQNLRRPDIFKNRFQEFGFVLVGVIGQFLSQVGLT 141

Query: 118 QALSIMNILAEELNAEKSRQAWLMASFTLSMGSFILVSGRLGDIYGLKKVLLGGYAILTI 177
           Q LS MNILAEEL+  K RQ WLMA+F L +G  IL+SGRLGDI+GLKKVLL GY I TI
Sbjct: 142 QVLSTMNILAEELHTTKMRQPWLMAAFPLGLGCTILISGRLGDIFGLKKVLLLGYIITTI 201

Query: 178 WSLICGFSSYSHNDAFFITSRAFQGLGLAFVLPNSLGLIGVIYEPGSMKKNMIIGTLGAM 237
           W+LICGFSSY+H+D  FI SR FQGLGLA  LPN   LIG+IY+P   KKNMI   +GAM
Sbjct: 202 WTLICGFSSYAHSDDLFIVSRTFQGLGLACALPNMFELIGIIYKPHCFKKNMIFCIIGAM 261

Query: 238 SPIGATLGGLFAGIIGTKDPKQWPWSFYSFGIVSFCNMILSWYSIPNNIPTNIYNLSMDW 297
           SPIGATLGG+FAG+    + K WPWSFYSF IV+F N I++W+ IPN+I  N   L MDW
Sbjct: 262 SPIGATLGGIFAGLSVKYNIKNWPWSFYSFAIVAFLNGIIAWFCIPNDIEKNPQGLKMDW 321

Query: 298 XXXXXXXXXXXXXNFVFNQAPIVGWQSAYIIVLLVLSFCALVIFVVYEVKYAKTPLIPKA 357
                        NFVFNQ PI GW SAY+IVLLV+S  AL++FV+YE+  A  PLIPK 
Sbjct: 322 IGSALGLFGLVVLNFVFNQTPIDGWSSAYLIVLLVVSVVALILFVIYELTMANFPLIPKG 381

Query: 358 ISSNRGMLMILFALFCGWGAFGTWTFYYFSFVLNVRGYTAAWAGGSYFIFIVSGCAIATL 417
           I SN  +++IL  LFCGWG F  WTFYYF+F LN+R Y+  WA  S F+ I+SG     +
Sbjct: 382 IHSNYRLILILLTLFCGWGGFAIWTFYYFAFQLNLRHYSPLWASSSNFVLIISGTIYTII 441

Query: 418 CGFMMKKVPPSVILYISMIGFMGGCVMLTVTPIHQSYFQNILGIMFVLPIGIDLSFPAAS 477
           C   ++++ P ++L+ SM+GF+GG ++  VTPIHQ++F+N+ G MF+ P+G+  SFP+AS
Sbjct: 442 CCLAVQRMKPPILLFFSMLGFLGGNILFAVTPIHQTFFRNMFGSMFLFPLGMVFSFPSAS 501

Query: 478 IILSDALPIQYQGMAGSLVYTITNYSTSICLGMAGSVEAYHNDNGQNILKGYRNAMIFAD 537
           ++ ++ LP  Y+ MAGSLV    NY+TSIC+GMAGS    HN++GQ++L G+R A   A 
Sbjct: 502 MMTAETLPTHYKSMAGSLVNVAINYATSICVGMAGSANVNHNNHGQDLLHGFRAASYLAI 561

Query: 538 ALAGLGIIVSGIYMVINLITIRENSKSTNKPKHLETYSTDAE 579
            L+G  + +SG+YM+ ++ T R      NK       +TD+E
Sbjct: 562 GLSGFSVFLSGLYMIGSIWTDRNQKMKENK-----LINTDSE 598

>CAGL0M03003g Chr13 complement(337942..339618) [1677 bp, 558 aa]
           {ON} similar to uniprot|Q03263 Saccharomyces cerevisiae
           YMR279c or uniprot|P13090 Saccharomyces cerevisiae
           YML116w ATR1
          Length = 558

 Score =  525 bits (1352), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 262/483 (54%), Positives = 362/483 (74%)

Query: 81  QSENKVLSPKYFKNRTHEYLFIISCMVSQFMSQAGLTQALSIMNILAEELNAEKSRQAWL 140
           ++++   +P+YF+    E +FIISCMV+Q ++QAG TQ+LS MN+LA+   +  S+Q WL
Sbjct: 68  ENDSPFQNPEYFETGFKEVMFIISCMVAQLLNQAGQTQSLSTMNVLADYFKSNSSKQPWL 127

Query: 141 MASFTLSMGSFILVSGRLGDIYGLKKVLLGGYAILTIWSLICGFSSYSHNDAFFITSRAF 200
           MASF L  GSFIL+SGRLGDIYGLKK L  GY I+T+WS+ICG + Y+++DAFFI  R+F
Sbjct: 128 MASFPLVSGSFILISGRLGDIYGLKKALSVGYIIMTLWSIICGLAKYTNSDAFFIVCRSF 187

Query: 201 QGLGLAFVLPNSLGLIGVIYEPGSMKKNMIIGTLGAMSPIGATLGGLFAGIIGTKDPKQW 260
           QGLG+AF+LPN +GL+G IY+ G+++KN++I  +G M+P GA LG LF G+I T+D +QW
Sbjct: 188 QGLGIAFILPNIMGLVGNIYKVGTLRKNIVISCIGCMAPAGAALGALFGGLIVTEDAEQW 247

Query: 261 PWSFYSFGIVSFCNMILSWYSIPNNIPTNIYNLSMDWXXXXXXXXXXXXXNFVFNQAPIV 320
           PW FY+FGI SF NM+L+ YSIPNN+PTN+ NL+MDW             N V+NQAPIV
Sbjct: 248 PWVFYAFGIASFVNMLLALYSIPNNVPTNLNNLNMDWIGSLLGVSGLLLLNIVWNQAPIV 307

Query: 321 GWQSAYIIVLLVLSFCALVIFVVYEVKYAKTPLIPKAISSNRGMLMILFALFCGWGAFGT 380
           GW  AYIIVLL++S   L+IFVVYE+KYA +PL+P ++  N+ +LMIL ALF GWG+FG 
Sbjct: 308 GWGEAYIIVLLIISIILLLIFVVYEIKYATSPLLPPSVLENKKILMILAALFFGWGSFGI 367

Query: 381 WTFYYFSFVLNVRGYTAAWAGGSYFIFIVSGCAIATLCGFMMKKVPPSVILYISMIGFMG 440
           WT+YY++F LN+R YT  WAGG++F+F++ G   A +    +KKV P+V+L  SM+ F  
Sbjct: 368 WTYYYYAFQLNLRKYTPLWAGGTHFMFVIWGTVAAFVVALTIKKVGPAVLLCFSMVAFDC 427

Query: 441 GCVMLTVTPIHQSYFQNILGIMFVLPIGIDLSFPAASIILSDALPIQYQGMAGSLVYTIT 500
           G +ML+VTP+HQ+Y++  +G+  +L  G+DLSFPA+SIILSD LP+QYQGMAGSLV T+ 
Sbjct: 428 GSIMLSVTPVHQTYWRMNVGMQIILSFGMDLSFPASSIILSDFLPMQYQGMAGSLVNTVV 487

Query: 501 NYSTSICLGMAGSVEAYHNDNGQNILKGYRNAMIFADALAGLGIIVSGIYMVINLITIRE 560
           NYSTS+CLGM  +VE  +N +G ++LKGYR+A+  A  LA  G+ VS +++V ++I  R 
Sbjct: 488 NYSTSLCLGMGNTVEQQYNAHGADLLKGYRSALYLAIGLASAGVCVSLVFLVTDIIAKRH 547

Query: 561 NSK 563
             +
Sbjct: 548 RKR 550

>KNAG0G03430 Chr7 complement(734828..736456) [1629 bp, 542 aa] {ON}
           Anc_8.843 YMR279C
          Length = 542

 Score =  523 bits (1346), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 249/478 (52%), Positives = 343/478 (71%), Gaps = 1/478 (0%)

Query: 91  YFKNRTHEYLFIISCMVSQFMSQAGLTQALSIMNILAEELNAEKSRQAWLMASFTLSMGS 150
           YF+NR  EY+F+ +CM+SQ ++QA + Q LS+MNIL +  ++    Q WLMASF L  GS
Sbjct: 61  YFQNRWQEYIFVGTCMMSQLLNQACIPQTLSLMNILTKSFHSNAKNQTWLMASFPLVSGS 120

Query: 151 FILVSGRLGDIYGLKKVLLGGYAILTIWSLICGFSSYSHNDAFFITSRAFQGLGLAFVLP 210
           FIL+SGR+GDIYGLK  L+GG     IW+LI GF++Y+H+D FFI SR+FQGLG+AF+LP
Sbjct: 121 FILISGRVGDIYGLKWSLVGGNIFFIIWALISGFTNYTHSDTFFIVSRSFQGLGVAFILP 180

Query: 211 NSLGLIGVIYEPGSMKKNMIIGTLGAMSPIGATLGGLFAGIIGTKDPKQWPWSFYSFGIV 270
           N +G +G IY+P + +KN++I  +GA +P+GA +G  FAG+IGTK+P  WPWSFY+  I 
Sbjct: 181 NVMGCVGNIYKPNTFRKNIVISLIGACAPVGAFMGAFFAGLIGTKNPDDWPWSFYAMAIA 240

Query: 271 SFCNMILSWYSIPNNIPTNIYNLSMDWXXXXXXXXXXXXXNFVFNQAPIVGWQSAYIIVL 330
           S   ++ + YSIPN+IPTN++  SMDW             NFV+NQ PI GW  AYIIVL
Sbjct: 241 STLTLLGALYSIPNHIPTNVHGFSMDWIGSGLAVVGLILLNFVWNQGPIDGWGKAYIIVL 300

Query: 331 LVLSFCALVIFVVYEVKYAKTPLIPKAISSNRGMLMILFALFCGWGAFGTWTFYYFSFVL 390
           L++S   L +F +YEV YA +PL+P+ I+ NR M+MIL ALF GWG+FG ++FYYF+F+L
Sbjct: 301 LIVSVFVLTLFFIYEVHYAASPLLPRVITQNRHMVMILMALFLGWGSFGIFSFYYFAFLL 360

Query: 391 NVRGYTAAWAGGSYFIFIVSGCAIATLCGFMMKKVPPSVILYISMIGFMGGCVMLTVTPI 450
           N+R Y+  WAGG+YF+F + G   + + G  ++K+  S+IL+ SMI F  G +ML+VTP+
Sbjct: 361 NLRHYSTVWAGGTYFMFAIWGVVASVVVGLSIRKISASIILFFSMIAFDVGIIMLSVTPV 420

Query: 451 HQSYFQNILGIMFVLPIGIDLSFPAASIILSDALPIQYQGMAGSLVYTITNYSTSICLGM 510
            Q+YF+  LG M +L  G+D+SFPAA+IILSD+LP QYQGMAGSL  T+ NYS S+CLGM
Sbjct: 421 KQTYFRMNLGTMIILSFGMDMSFPAAAIILSDSLPNQYQGMAGSLANTMVNYSMSLCLGM 480

Query: 511 AGSVEAYHNDNGQNILKGYRNAMIFADALAGLGIIVSGIYMVINL-ITIRENSKSTNK 567
             +VE+  N NG+++LKGYR A      +A L +I+S IYM   L I  +E  +ST++
Sbjct: 481 GSTVESQINQNGKDLLKGYRAAEYLGIGIASLAVILSLIYMCERLWIDRKERMESTSE 538

>KAFR0B03930 Chr2 complement(816351..818018) [1668 bp, 555 aa] {ON} 
          Length = 555

 Score =  523 bits (1346), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 248/523 (47%), Positives = 354/523 (67%), Gaps = 23/523 (4%)

Query: 11  QKENTQISIISLSTAETLDIDATPESKERKDYFQLKKNYSQDSQTNTSMNEVIGXXXXXX 70
           +++  ++++   +T  TL+ D++    E+     + +  S D++  +             
Sbjct: 17  EQKQEKVNVAVKATINTLNYDSSTSVSEKTSAISVFEGTSPDAEKFSD------------ 64

Query: 71  XXXXXXXENLQSENKVLSPKYFKNRTHEYLFIISCMVSQFMSQAGLTQALSIMNILAEEL 130
                   N   +N    P YF +R  EYLFI++CM+S  ++QAG TQA S MN++    
Sbjct: 65  -------NNTPWQN----PSYFSSRWKEYLFILTCMLSNLLNQAGQTQATSTMNVIGSAF 113

Query: 131 NAEKSRQAWLMASFTLSMGSFILVSGRLGDIYGLKKVLLGGYAILTIWSLICGFSSYSHN 190
           NA+ S + WLMASF L  GSFILVSGR+GDIYGLK+ ++GG  ++ IWSLICGF++YS +
Sbjct: 114 NADSSSKTWLMASFPLVSGSFILVSGRIGDIYGLKRTMIGGLIVMIIWSLICGFANYSSS 173

Query: 191 DAFFITSRAFQGLGLAFVLPNSLGLIGVIYEPGSMKKNMIIGTLGAMSPIGATLGGLFAG 250
             FFI  RAFQGLG+AFVLPN +GL+G IY+ GS++KN++I  +G  +P GA  G  +AG
Sbjct: 174 VTFFIICRAFQGLGIAFVLPNVMGLVGNIYKVGSLRKNIVISCIGMCAPTGAAFGAFWAG 233

Query: 251 IIGTKDPKQWPWSFYSFGIVSFCNMILSWYSIPNNIPTNIYNLSMDWXXXXXXXXXXXXX 310
           +I TK  KQWPW FY++      N++L+ YSIP+ +P N++  SMDW             
Sbjct: 234 LIATKAEKQWPWIFYAYAFAGILNLVLAIYSIPDTVPVNVHGFSMDWTGSVVGVIGLILF 293

Query: 311 NFVFNQAPIVGWQSAYIIVLLVLSFCALVIFVVYEVKYAKTPLIPKAISSNRGMLMILFA 370
           NFV+N+APIVGW+ AYIIVLL+ S   +V+F +YE+K+AK+PL+P+A++ N  ++MIL A
Sbjct: 294 NFVWNEAPIVGWEKAYIIVLLIFSLLIIVVFFIYEIKFAKSPLLPQAVTHNHNIIMILSA 353

Query: 371 LFCGWGAFGTWTFYYFSFVLNVRGYTAAWAGGSYFIFIVSGCAIATLCGFMMKKVPPSVI 430
           +F GWG+FG WTFYY++F+LN+RGYT   AG S+ +FI+ G   A    F +K+V PSV+
Sbjct: 354 MFMGWGSFGIWTFYYYAFLLNLRGYTPLEAGASHCMFILWGTIAAFTVAFTIKRVGPSVL 413

Query: 431 LYISMIGFMGGCVMLTVTPIHQSYFQNILGIMFVLPIGIDLSFPAASIILSDALPIQYQG 490
           L+ SM+ F  G +ML++TP+HQ+Y++   G+  +L  G+DLSFPA+SIILSDALP++YQG
Sbjct: 414 LFCSMVAFTVGSIMLSITPVHQTYWKMTFGMQIILAFGMDLSFPASSIILSDALPMEYQG 473

Query: 491 MAGSLVYTITNYSTSICLGMAGSVEAYHNDNGQNILKGYRNAM 533
           MAGSLV TI NYSTS+CLGM  + E   N NG ++LKGYR A+
Sbjct: 474 MAGSLVNTIVNYSTSLCLGMGTTAEIQVNKNGTDLLKGYRAAL 516

>YMR279C Chr13 complement(824729..826351) [1623 bp, 540 aa] {ON}
           Putative boron transporter involved in boron efflux and
           resistance; overexpression mutant but not null mutant
           displays boron tolerance phenotype; identified as a
           heat-induced gene in a high-throughout screen; YMR279C
           is not an essential gene; paralog of the efflux pump
           ATR1
          Length = 540

 Score =  518 bits (1334), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 256/479 (53%), Positives = 348/479 (72%)

Query: 88  SPKYFKNRTHEYLFIISCMVSQFMSQAGLTQALSIMNILAEELNAEKSRQAWLMASFTLS 147
            P YF +   E +FI +CM++Q ++QAG T AL IMN+L++  N+E + QAWLMASF L+
Sbjct: 59  DPTYFSSFGKELMFIATCMLAQLLNQAGQTHALCIMNVLSKSFNSEANNQAWLMASFPLA 118

Query: 148 MGSFILVSGRLGDIYGLKKVLLGGYAILTIWSLICGFSSYSHNDAFFITSRAFQGLGLAF 207
            GSFIL+SGRLGDIYGLKK+L+ GY I+ +WS+I G S YS++DAFFITSRAFQG+G+AF
Sbjct: 119 AGSFILISGRLGDIYGLKKMLIVGYVIVIVWSIISGLSKYSNSDAFFITSRAFQGVGIAF 178

Query: 208 VLPNSLGLIGVIYEPGSMKKNMIIGTLGAMSPIGATLGGLFAGIIGTKDPKQWPWSFYSF 267
           +LPN +GL+G +Y+ GS +KN++I  +GA +P G   GGLF G+I T+DP QWPW FY+F
Sbjct: 179 ILPNIMGLVGHVYKVGSFRKNIVISFIGACAPTGGMFGGLFGGLIVTEDPNQWPWVFYAF 238

Query: 268 GIVSFCNMILSWYSIPNNIPTNIYNLSMDWXXXXXXXXXXXXXNFVFNQAPIVGWQSAYI 327
           GI +F +++++WYSIPNN+PTNI+ LSMDW             NFV+NQAPIVGW   YI
Sbjct: 239 GIATFLSLLMAWYSIPNNVPTNIHGLSMDWTGSALAIIGLILFNFVWNQAPIVGWDKPYI 298

Query: 328 IVLLVLSFCALVIFVVYEVKYAKTPLIPKAISSNRGMLMILFALFCGWGAFGTWTFYYFS 387
           IVLL++S   LV F VYE KYA+ PL+P+A++ NR M+MIL A+F GWG+FG WTFYY S
Sbjct: 299 IVLLIISVIFLVAFFVYESKYAEVPLLPRAMTKNRHMIMILLAVFLGWGSFGIWTFYYVS 358

Query: 388 FVLNVRGYTAAWAGGSYFIFIVSGCAIATLCGFMMKKVPPSVILYISMIGFMGGCVMLTV 447
           F LN+R Y+  W GG+YF+F++ G   A    F +K++ P+++L  S++ F  G +M +V
Sbjct: 359 FQLNLRHYSPVWTGGTYFVFVIFGSMAAFFVAFSIKRLGPALLLCFSLMAFDAGSIMFSV 418

Query: 448 TPIHQSYFQNILGIMFVLPIGIDLSFPAASIILSDALPIQYQGMAGSLVYTITNYSTSIC 507
            P+ QSY++    +  +L  G+DLSFPA+SIILSD LP+QYQGMAGSLV T+ NYS S+C
Sbjct: 419 LPVEQSYWKLNFAMQAILCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINYSASLC 478

Query: 508 LGMAGSVEAYHNDNGQNILKGYRNAMIFADALAGLGIIVSGIYMVINLITIRENSKSTN 566
           LGM G+VE   N +G ++LKGYR A+     LA LG+++S  YM+ NL      S+  +
Sbjct: 479 LGMGGTVEHQINKSGNDLLKGYRAAVYLGVGLASLGVVISVTYMLENLWNRHRKSEDRS 537

>Smik_13.492 Chr13 complement(807726..809357) [1632 bp, 543 aa] {ON}
           YMR279C (REAL)
          Length = 543

 Score =  518 bits (1333), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 257/489 (52%), Positives = 352/489 (71%), Gaps = 4/489 (0%)

Query: 88  SPKYFKNRTHEYLFIISCMVSQFMSQAGLTQALSIMNILAEELNAEKSRQAWLMASFTLS 147
            P YF +   E +FI +CM++Q ++QAG T AL IMN+L++  N+E + QAWLMASF L+
Sbjct: 59  DPIYFSSFGKELMFIATCMLAQLLNQAGQTHALCIMNVLSKSFNSESNNQAWLMASFPLA 118

Query: 148 MGSFILVSGRLGDIYGLKKVLLGGYAILTIWSLICGFSSYSHNDAFFITSRAFQGLGLAF 207
            GSFIL+SGRLGDIYGLKK+LL GY I+ IWS+I G S YS++DAFFIT RAFQGLG+AF
Sbjct: 119 AGSFILISGRLGDIYGLKKMLLIGYVIIIIWSIISGLSKYSNSDAFFITCRAFQGLGIAF 178

Query: 208 VLPNSLGLIGVIYEPGSMKKNMIIGTLGAMSPIGATLGGLFAGIIGTKDPKQWPWSFYSF 267
           +LPN +GL+G +Y+ GS++KN++I  +GA +P G   GG+F G+I T+DP+QWPW FY+F
Sbjct: 179 ILPNIMGLVGHVYKVGSLRKNLVISVIGACAPAGGMFGGVFGGLIVTEDPEQWPWVFYAF 238

Query: 268 GIVSFCNMILSWYSIPNNIPTNIYNLSMDWXXXXXXXXXXXXXNFVFNQAPIVGWQSAYI 327
            I +F +++++WYSIPNN+PTN++ LSMDW             NFV+NQAPI GW  AYI
Sbjct: 239 SIATFISLLMAWYSIPNNVPTNVHGLSMDWTGSTLAVLGLILFNFVWNQAPIAGWGEAYI 298

Query: 328 IVLLVLSFCALVIFVVYEVKYAKTPLIPKAISSNRGMLMILFALFCGWGAFGTWTFYYFS 387
           IVLL+LS   L+ F VYE+KYA+ PL+P A++ NR M+MIL A+F GWG+FG WTFYY S
Sbjct: 299 IVLLILSVFFLIAFFVYEIKYAEVPLLPHAVTKNRHMIMILLAVFLGWGSFGIWTFYYVS 358

Query: 388 FVLNVRGYTAAWAGGSYFIFIVSGCAIATLCGFMMKKVPPSVILYISMIGFMGGCVMLTV 447
           F LN+R Y+  W GG+YF+F++ G   A    F +K++ P+++L  +++ F  G +M +V
Sbjct: 359 FQLNLRHYSPVWTGGTYFVFVIFGSIAAFFVAFSIKRLGPAILLCFALMAFDAGSIMFSV 418

Query: 448 TPIHQSYFQNILGIMFVLPIGIDLSFPAASIILSDALPIQYQGMAGSLVYTITNYSTSIC 507
            P+ QSY++    +  +L  G+DLSFPA+SIILSD LP+QYQGMAGSLV T+ NYS S+C
Sbjct: 419 LPVEQSYWKLNFAMQAILCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINYSASLC 478

Query: 508 LGMAGSVEAYHNDNGQNILKGYRNAMIFADALAGLGIIVSGIYMVINLITIRENSKSTNK 567
           LGM  +VE   N +GQN+LKGYR A+     LA LG+++S  YM+ N      N    ++
Sbjct: 479 LGMGVTVERQINKSGQNLLKGYRAAIYLGIGLASLGLLISVTYMLENF----WNKHKESE 534

Query: 568 PKHLETYST 576
            K LE  ++
Sbjct: 535 KKRLEAETS 543

>NDAI0K00400 Chr11 (90040..91701) [1662 bp, 553 aa] {ON} 
          Length = 553

 Score =  516 bits (1329), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 242/501 (48%), Positives = 354/501 (70%), Gaps = 5/501 (0%)

Query: 80  LQSENKVL-SPKYFKNRTHEYLFIISCMVSQFMSQAGLTQALSIMNILAEELNAEKSRQA 138
           LQ  N    +P YF +   EY+F+ +CM++  ++QAG +Q LS MN++++  ++    Q 
Sbjct: 56  LQENNSSWQNPDYFSSSFKEYIFVATCMIANLLNQAGQSQVLSAMNVISDSFHSSTGGQT 115

Query: 139 WLMASFTLSMGSFILVSGRLGDIYGLKKVLLGGYAILTIWSLICGFSSYSHNDAFFITSR 198
           WLMASF L  GSFIL+SGRLGDIYGLK++++GG+  + IWSLICGF++Y+H+D FFI +R
Sbjct: 116 WLMASFPLVSGSFILISGRLGDIYGLKRMMIGGFIFMIIWSLICGFTNYAHSDTFFIVAR 175

Query: 199 AFQGLGLAFVLPNSLGLIGVIYEPGSMKKNMIIGTLGAMSPIGATLGGLFAGIIGTKDPK 258
           AFQGLG++F+LPN +GL+G IY+ G+++KN++I  +G M+P G+  G L+ G+I T++PK
Sbjct: 176 AFQGLGISFILPNVMGLVGNIYKVGTLRKNVVISLIGIMAPTGSCFGALWGGLIVTENPK 235

Query: 259 QWPWSFYSFGIVSFCNMILSWYSIPNNIPTNIYNLSMDWXXXXXXXXXXXXXNFVFNQAP 318
           QWPW FY++ + +   +++ +Y++P+NIPTN+   +MDW             NFV+NQ P
Sbjct: 236 QWPWIFYAYAVAAAVCLVMGYYTVPDNIPTNVNGFTMDWIGSVLGVIGLILFNFVWNQGP 295

Query: 319 IVGWQSAYIIVLLVLSFCALVIFVVYEVKYAKTPLIPKAISSNRGMLMILFALFCGWGAF 378
           IVGW+ AYIIVLL++S   L+ F VYE+KYAK PL+PKA++ N  +L IL  LF GWG+F
Sbjct: 296 IVGWEKAYIIVLLIVSVIFLIAFFVYEIKYAKVPLLPKAVTQNGHILTILTVLFLGWGSF 355

Query: 379 GTWTFYYFSFVLNVRGYTAAWAGGSYFIFIVSGCAIATLCGFMMKKVPPSVILYISMIGF 438
           G WTFYYF+F LN+R Y+  W+GG++F+FI+ G   AT     +KKV P+++L+ S IGF
Sbjct: 356 GIWTFYYFAFQLNLREYSPVWSGGTFFVFIIFGTVAATTVALTIKKVGPAILLFFSAIGF 415

Query: 439 MGGCVMLTVTPIHQSYFQNILGIMFVLPIGIDLSFPAASIILSDALPIQYQGMAGSLVYT 498
             G ++++VTP+HQ+Y++N  G+  +L  G+DL FPA+SIILSD LP+QYQGMA SLV T
Sbjct: 416 TCGSIIMSVTPVHQTYWRNTFGMQIILVFGMDLPFPASSIILSDYLPMQYQGMAVSLVNT 475

Query: 499 ITNYSTSICLGMAGSVEAYHNDNGQNILKGYRNAMIFADALAGLGIIVSGIYMVINLITI 558
           I NYSTS+CLGM  +VE   N +G ++LKGYR A+ F   +AGLG  ++     +N+   
Sbjct: 476 IVNYSTSLCLGMGTTVERQINKSGDDLLKGYRAALYFGVGIAGLGACIA----FLNVCHD 531

Query: 559 RENSKSTNKPKHLETYSTDAE 579
             + ++   PK L+   T + 
Sbjct: 532 IWSKRNAKDPKDLQRCGTGSN 552

>KAFR0B03940 Chr2 complement(820954..822597) [1644 bp, 547 aa] {ON}
           Anc_8.843 YMR279C
          Length = 547

 Score =  513 bits (1320), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 247/493 (50%), Positives = 341/493 (69%), Gaps = 1/493 (0%)

Query: 78  ENLQSENKVLSPKYFKNRTHEYLFIISCMVSQFMSQAGLTQALSIMNILAEELNAEKSRQ 137
            ++ + +K   P YFK+   EY FI +CM++  ++QAG TQ LS MN+LA+ LN++ + +
Sbjct: 53  SSISNNSKWQDPTYFKSSWQEYTFIGTCMLANLLNQAGQTQTLSTMNVLADSLNSDGAAK 112

Query: 138 AWLMASFTLSMGSFILVSGRLGDIYGLKKVLLGGYAILTIWSLICGFSSYSHNDAFFITS 197
            WLMASFTL+ GSFILVSGR+GDIYGLK   +GG  I  IWS++CG S Y+ N  FFI  
Sbjct: 113 TWLMASFTLASGSFILVSGRIGDIYGLKATFIGGNIIFCIWSILCGVSKYTENVTFFIIC 172

Query: 198 RAFQGLGLAFVLPNSLGLIGVIYEPGSMKKNMIIGTLGAMSPIGATLGGLFAGIIGTKDP 257
           RAFQGLG+AFVLPN +GL+G IY  GSM+KN++I  +G M+P+G T GG++ G+I   + 
Sbjct: 173 RAFQGLGVAFVLPNVMGLVGNIYNVGSMRKNIVISFIGCMAPVGQTFGGMWGGLIVDSNK 232

Query: 258 KQWPWSFYSFGIVSFCNMILSWYSIPNNIPTNIYNLSMDWXXXXXXXXXXXXXNFVFNQA 317
            QWPW F++  I  F N+I+  YSIPN++PTNIYNL MDW             NFV+NQA
Sbjct: 233 DQWPWIFFATAIAVFINLIMGIYSIPNHVPTNIYNLKMDWIGSLLGVIGLILMNFVWNQA 292

Query: 318 PIVGWQSAYIIVLLVLSFCALVIFVVYEVKYAKTPLIPKAISSNRGMLMILFALFCGWGA 377
           PI GW  AYIIV+L+++   LV F +YE+K A++PL+P  ++ NR ++ I+ +LF GWGA
Sbjct: 293 PISGWSKAYIIVILIVAVFFLVAFFIYELKKAESPLLPPEVTKNRHIVTIIISLFLGWGA 352

Query: 378 FGTWTFYYFSFVLNVRGYTAAWAGGSYFIFIVSGCAIATLCGFMMKKVPPSVILYISMIG 437
           FG WTFYY++F LN+R ++  WAG ++F+FI+ G   A    F + KV PSV+  +S IG
Sbjct: 353 FGIWTFYYYAFNLNLRHFSPLWAGSTHFVFIIFGSLTAITVAFTINKVGPSVLFCLSSIG 412

Query: 438 FMGGCVMLTVTPIHQSYFQNILGIMFVLPIGIDLSFPAASIILSDALPIQYQGMAGSLVY 497
           F  G ++ +VT   Q+Y++N LG+  +L +G+DLSFP +SIILSD LP+QYQGM+GSLV 
Sbjct: 413 FTCGNIIFSVTSPDQTYWRNSLGMQIILALGMDLSFPGSSIILSDLLPMQYQGMSGSLVN 472

Query: 498 TITNYSTSICLGMAGSVEAYHNDNGQNILKGYRNAMIFADALAGLGIIVSGIYMVINLIT 557
           TITNY+TS+CLGM  + E  +N+ G+++LKGYR A+  A  L  LG   S  YM  +L  
Sbjct: 473 TITNYATSLCLGMGTTAEVQYNNGGKDVLKGYRAALYVAIGLGALGFAFSFSYMAEDL-W 531

Query: 558 IRENSKSTNKPKH 570
           IR   +  N+ K 
Sbjct: 532 IRYRKRRQNEKKE 544

>NCAS0C00400 Chr3 (61257..62810) [1554 bp, 517 aa] {ON} Anc_8.843
          Length = 517

 Score =  495 bits (1274), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 234/482 (48%), Positives = 344/482 (71%)

Query: 80  LQSENKVLSPKYFKNRTHEYLFIISCMVSQFMSQAGLTQALSIMNILAEELNAEKSRQAW 139
           L++     + +YF++   EY FI +CM +  ++QAG TQ LS MN+++E  +++   Q W
Sbjct: 22  LENSTPWQNEQYFQSHLKEYFFIFTCMFANLLNQAGQTQVLSTMNVISESFHSDVGTQTW 81

Query: 140 LMASFTLSMGSFILVSGRLGDIYGLKKVLLGGYAILTIWSLICGFSSYSHNDAFFITSRA 199
           LMASF L  GSFIL+SGR+GDIYGLKK ++GGY  + IW+L+CGF+ Y+H+D FFI  RA
Sbjct: 82  LMASFPLVSGSFILISGRIGDIYGLKKTMIGGYIFMIIWTLLCGFADYTHSDTFFIVCRA 141

Query: 200 FQGLGLAFVLPNSLGLIGVIYEPGSMKKNMIIGTLGAMSPIGATLGGLFAGIIGTKDPKQ 259
           FQGLG++F+LPN +GL+G IY+ G+++KN++I  +G  +P GA +G L+ G+I T+  +Q
Sbjct: 142 FQGLGISFILPNIMGLVGNIYKVGTLRKNIVISLIGITAPTGACMGALWGGLIATESSRQ 201

Query: 260 WPWSFYSFGIVSFCNMILSWYSIPNNIPTNIYNLSMDWXXXXXXXXXXXXXNFVFNQAPI 319
           WPW FY++ + +F N+I++ YS+P N+PTN++N +MDW             NFV+NQ P+
Sbjct: 202 WPWIFYAYALAAFVNLIMAIYSVPENVPTNVHNFAMDWMGAIIGVVGLILFNFVWNQGPV 261

Query: 320 VGWQSAYIIVLLVLSFCALVIFVVYEVKYAKTPLIPKAISSNRGMLMILFALFCGWGAFG 379
            GW   YIIVLL++S   LV F++YE+K+  +PL+P+ ++ N  +L IL  LF GWG+FG
Sbjct: 262 NGWAKPYIIVLLIISIIFLVAFIIYELKFPISPLLPREVTKNGQILTILGILFLGWGSFG 321

Query: 380 TWTFYYFSFVLNVRGYTAAWAGGSYFIFIVSGCAIATLCGFMMKKVPPSVILYISMIGFM 439
            WTFYY++F LN+R Y+  WAG ++F+FI+ G   A + GF + +V P+V+L+ S +GF 
Sbjct: 322 IWTFYYYAFQLNLRNYSPLWAGATHFMFIIWGSIAAFIVGFTINRVGPAVLLFFSALGFT 381

Query: 440 GGCVMLTVTPIHQSYFQNILGIMFVLPIGIDLSFPAASIILSDALPIQYQGMAGSLVYTI 499
            G +ML+VTPIHQ+Y++  +G+  +L  G+DLSFPA+SIILSD LP+QYQGMAGSLV TI
Sbjct: 382 MGSLMLSVTPIHQTYWRMNVGMQIILSFGMDLSFPASSIILSDHLPMQYQGMAGSLVNTI 441

Query: 500 TNYSTSICLGMAGSVEAYHNDNGQNILKGYRNAMIFADALAGLGIIVSGIYMVINLITIR 559
            NYSTS+CLGM  +VE   N  G+ +L+GYR+A+  A  L GLG  V+ + +  +L   R
Sbjct: 442 INYSTSLCLGMGTTVERQINKTGEELLRGYRSALYLAVGLGGLGACVAFLNLCYDLWRKR 501

Query: 560 EN 561
           ++
Sbjct: 502 KS 503

>KAFR0A02840 Chr1 complement(588197..589759) [1563 bp, 520 aa] {ON}
           Anc_8.843 YMR279C
          Length = 520

 Score =  479 bits (1232), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 242/453 (53%), Positives = 321/453 (70%)

Query: 80  LQSENKVLSPKYFKNRTHEYLFIISCMVSQFMSQAGLTQALSIMNILAEELNAEKSRQAW 139
           ++ ++K   P YFKN   EYLF+ SCM +Q ++QA   Q LSIMN+L++  N+ +S Q W
Sbjct: 31  VREKSKWQDPGYFKNSFQEYLFVGSCMTTQLLNQATTPQTLSIMNVLSDSFNSSRSNQTW 90

Query: 140 LMASFTLSMGSFILVSGRLGDIYGLKKVLLGGYAILTIWSLICGFSSYSHNDAFFITSRA 199
           L+ASF L  GSFIL+SGR+GDIYGLKK L+GGY  L IWSLICGF+ YS +D F I +RA
Sbjct: 91  LVASFPLVAGSFILISGRIGDIYGLKKTLIGGYIFLIIWSLICGFTYYSKSDTFLIIARA 150

Query: 200 FQGLGLAFVLPNSLGLIGVIYEPGSMKKNMIIGTLGAMSPIGATLGGLFAGIIGTKDPKQ 259
           FQGLG+AF LPN +G IG IY  GS++KNM+I  + A +P+GA +GG FAG+I T+ P Q
Sbjct: 151 FQGLGIAFTLPNVVGTIGNIYHVGSLRKNMVISLIAASAPVGAAIGGAFAGLIVTESPSQ 210

Query: 260 WPWSFYSFGIVSFCNMILSWYSIPNNIPTNIYNLSMDWXXXXXXXXXXXXXNFVFNQAPI 319
           WPWSFY+F I    N+++S YSIP+NIPTN+    MDW             NF +NQ PI
Sbjct: 211 WPWSFYAFAIACSFNLLISIYSIPSNIPTNVNGFKMDWIGSALIVTGLILFNFAWNQGPI 270

Query: 320 VGWQSAYIIVLLVLSFCALVIFVVYEVKYAKTPLIPKAISSNRGMLMILFALFCGWGAFG 379
           VGW  AYIIVLL++S   ++ F+ YE+ +A +PLI + I+ +R M++ +F LF GWG++G
Sbjct: 271 VGWDIAYIIVLLIISVIFILAFLTYEINFAPSPLIAREITHSRNMIITIFTLFLGWGSYG 330

Query: 380 TWTFYYFSFVLNVRGYTAAWAGGSYFIFIVSGCAIATLCGFMMKKVPPSVILYISMIGFM 439
            W+FYYFSFVLN+R Y+  WAGGSYFIF + G   +   G  +KK+   VIL  SM+ F 
Sbjct: 331 IWSFYYFSFVLNLRHYSPVWAGGSYFIFGIFGVLASAFVGISIKKITAPVILLFSMVLFC 390

Query: 440 GGCVMLTVTPIHQSYFQNILGIMFVLPIGIDLSFPAASIILSDALPIQYQGMAGSLVYTI 499
            G  +L+V P+ QSYF+  L  M +L +G+D SFPAA+IILSD LP++YQGMAGSL  T+
Sbjct: 391 VGTTLLSVAPVDQSYFKLTLAGMAILGVGLDTSFPAATIILSDGLPMEYQGMAGSLALTM 450

Query: 500 TNYSTSICLGMAGSVEAYHNDNGQNILKGYRNA 532
            NYS S+CLGM  +VE   N +GQ++LKGYR+A
Sbjct: 451 VNYSMSLCLGMGNTVERQINKDGQDVLKGYRSA 483

>Smik_15.560 Chr15 (995453..997003) [1551 bp, 516 aa] {ON} YOR378W
           (REAL)
          Length = 516

 Score =  328 bits (842), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 184/508 (36%), Positives = 295/508 (58%), Gaps = 24/508 (4%)

Query: 78  ENLQSENKVLSPKY-FKNRTHEYLFIISCMV-----SQFMSQAGLTQALSIMNILAEEL- 130
           E L+ +++VLS ++  +    E L   S  V     +Q M+QAGL Q+L+ ++I+ +   
Sbjct: 17  ETLKKDDEVLSDEFDVQEEKPESLLWESAFVGVLCSAQLMTQAGLGQSLAPLHIIGDSFG 76

Query: 131 NAEKSRQAWLMASFTLSMGSFILVSGRLGDIYGLKKVLLGGYAILTIWSLICGFSSYSHN 190
            A   + +W  ++++L++G+FIL++GRLGDI+G KK  + G+    +WSL+ GFS YS N
Sbjct: 77  TANPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFSVYS-N 135

Query: 191 DAFFITSRAFQGLGLAFVLPNSLGLIGVIYEPGSMKKNMIIGTLGAMSPIGATLGGLFAG 250
             FF   RAFQG+G AF+LPN++ ++G  Y+PG  +KNM+    GA +P G  LG +F+ 
Sbjct: 136 QIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGR-RKNMVFSLFGASAPGGFVLGAVFSS 194

Query: 251 IIGTKDPKQWPWSFYSFGIVSFCNMILSWYSIPN----NIPTNIYNL--SMDWXXXXXXX 304
           ++G      WPW+++  GI  F   +  +Y IP+    N     + L   +D+       
Sbjct: 195 MLGQL--AWWPWAYWLMGIACFLLAVAGYYLIPHTPMPNRDVASFKLLERIDFAGSVTGV 252

Query: 305 XXXXXXNFVFNQAPIVGWQSAYIIVLLVLSFCALVIFVVYEVKYAKTPLIP-KAISSNRG 363
                 NF +NQ P+VGWQ+ Y   LL++    L+IF   E + A  PL+P  A+SS+  
Sbjct: 253 VGLILFNFAWNQGPVVGWQTPYTYALLIVGTVFLIIFAFIESR-AAFPLLPFAALSSDTA 311

Query: 364 MLMILFALFCGWGAFGTWTFYYFSFVLNVRGYTAAWAGGSYFIFIVSGCAIATLCGFMMK 423
            ++   A   GW +FG W FY + F+ + RG T   +   +    +SG   A + GF++ 
Sbjct: 312 FVLSCIA--AGWASFGIWIFYTWQFMEDSRGQTPLLSSAQFSPVAISGFCAALMTGFLLS 369

Query: 424 KVPPSVILYISMIGFMGGCVMLTVTPIHQSYFQNILGIMFVLPIGIDLSFPAASIILSDA 483
             PPS +++ +M  F  G +++   P+HQ+Y+      + V+P G+D+SFPAA+I+LSD+
Sbjct: 370 HTPPSTVMFFAMTAFTVGTILIATAPVHQTYWAQTFVSIIVMPWGMDMSFPAATIMLSDS 429

Query: 484 LPIQYQGMAGSLVYTITNYSTSICLGMAGSVEAYHNDNGQNILKGYRNAMIFADALAGLG 543
           +P ++QG+A SLV T+ NYS SI LG+AG++E+  ND G N+LKGYR +      L+G G
Sbjct: 430 MPHEHQGLAASLVNTVVNYSISIGLGIAGTIESNVNDGGANVLKGYRCSWYLGIGLSGFG 489

Query: 544 IIVSGIYMVINLITIRENSKSTNKPKHL 571
           I V+  Y V    T  ++ K  ++ +H 
Sbjct: 490 IFVAATYAV---STFMKSKKRVSEKQHF 514

>YOR378W Chr15 (1049511..1051058) [1548 bp, 515 aa] {ON} Putative
           paralog of ATR1, but not required for boron tolerance;
           member of the DHA2 family of drug:H+ antiporters;
           YOR378W is not an essential gene
          Length = 515

 Score =  321 bits (822), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 184/507 (36%), Positives = 292/507 (57%), Gaps = 23/507 (4%)

Query: 78  ENLQSENKVLSPKYFKNRTHEYLFIISCMV-----SQFMSQAGLTQALSIMNILAEELNA 132
           E L+ E+KVLS    ++   + L   S  V     +Q M+QAGL Q+L+ ++I+      
Sbjct: 17  EALKKEDKVLSEFDIQDERPKSLLWESAFVGVLCSAQLMTQAGLGQSLAPLHIIGNSFGT 76

Query: 133 EKSRQ-AWLMASFTLSMGSFILVSGRLGDIYGLKKVLLGGYAILTIWSLICGFSSYSHND 191
             + Q +W  ++++L++G+FIL++GRLGDI+G KK  + G+    +WSL+ GFS YS N 
Sbjct: 77  TNAGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFSVYS-NQ 135

Query: 192 AFFITSRAFQGLGLAFVLPNSLGLIGVIYEPGSMKKNMIIGTLGAMSPIGATLGGLFAGI 251
            FF   RAFQG+G AF+LPN++ ++G  Y+PG  +KNM+    GA +P G  LG +F+ +
Sbjct: 136 IFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGR-RKNMVFSLFGASAPGGFFLGAVFSSM 194

Query: 252 IGTKDPKQWPWSFYSFGIVSFCNMILSWYSIPNN-IPT---NIYNL--SMDWXXXXXXXX 305
           +G      WPW+++  GI  F   +  ++ IP+  +P+   + + L   +D+        
Sbjct: 195 LGQL--AWWPWAYWIMGIACFVLAVAGYFVIPHTPMPSRDASSFKLLERIDFAGSVTGVV 252

Query: 306 XXXXXNFVFNQAPIVGWQSAYIIVLLVLSFCALVIFVVYEVKYAKTPLIP-KAISSNRGM 364
                NF +NQ P+VGWQ+ Y   LL++    LVIF   E + A  PL+P  A+SS+   
Sbjct: 253 GLILFNFAWNQGPVVGWQTPYTYALLIVGTFFLVIFAYIESR-AAFPLLPFAALSSDTAF 311

Query: 365 LMILFALFCGWGAFGTWTFYYFSFVLNVRGYTAAWAGGSYFIFIVSGCAIATLCGFMMKK 424
           ++   A   GW +FG W FY + F+ + RG T   +   +    +SG   A   GF++  
Sbjct: 312 VLSCIA--AGWASFGIWIFYTWQFMEDSRGQTPLLSSAQFSPVAISGFCAAVTTGFLLSH 369

Query: 425 VPPSVILYISMIGFMGGCVMLTVTPIHQSYFQNILGIMFVLPIGIDLSFPAASIILSDAL 484
            PPS ++  +M  F  G +++   P+HQ+Y+      + V+P G+D+SFPAA+I+LSD++
Sbjct: 370 TPPSTVMLFAMTAFTVGTILIATAPVHQTYWAQTFVSIIVMPWGMDMSFPAATIMLSDSM 429

Query: 485 PIQYQGMAGSLVYTITNYSTSICLGMAGSVEAYHNDNGQNILKGYRNAMIFADALAGLGI 544
           P ++QG+A SLV T+ NYS SI LG+AG++E+  ND G   LKGYR +      L+GLGI
Sbjct: 430 PHEHQGLAASLVNTVVNYSISIGLGIAGTIESRVNDGGAKPLKGYRCSWYMGIGLSGLGI 489

Query: 545 IVSGIYMVINLITIRENSKSTNKPKHL 571
            V+  Y      T  ++ K  ++ +H 
Sbjct: 490 FVAATY---AWSTFMKSKKRISEKQHF 513

>Skud_15.545 Chr15 (988549..990099) [1551 bp, 516 aa] {ON} YOR378W
           (REAL)
          Length = 516

 Score =  316 bits (810), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 176/482 (36%), Positives = 280/482 (58%), Gaps = 18/482 (3%)

Query: 98  EYLFIISCMVSQFMSQAGLTQALSIMNILAEELNAEKSRQ-AWLMASFTLSMGSFILVSG 156
           E  F+     +Q M+QAGL Q+L+ ++I+ +        Q +W  ++++L++G+FIL++G
Sbjct: 43  ETAFVGVLCSAQLMTQAGLGQSLAPLHIIGKSFGTTNPGQLSWFASAYSLTVGTFILIAG 102

Query: 157 RLGDIYGLKKVLLGGYAILTIWSLICGFSSYSHNDAFFITSRAFQGLGLAFVLPNSLGLI 216
           RLGDI+G KK  + G+    +WSL+ GFS YS N  FF   RAFQG+G AF+LPN++ ++
Sbjct: 103 RLGDIFGHKKFFVLGFFWYALWSLLAGFSVYS-NKIFFDCCRAFQGMGPAFLLPNAIAIL 161

Query: 217 GVIYEPGSMKKNMIIGTLGAMSPIGATLGGLFAGIIGTKDPKQWPWSFYSFGIVSFCNMI 276
           G  Y+ G  +KNM+    GA +P G  LG +F+ ++G      WPW+++  GI  F   I
Sbjct: 162 GRTYKSGK-RKNMVFSLFGACAPGGFVLGAVFSSLLGQL--AWWPWAYWIMGIACFFLAI 218

Query: 277 LSWYSIPNNIPTNIYNLS------MDWXXXXXXXXXXXXXNFVFNQAPIVGWQSAYIIVL 330
             ++ IP+    + +  S      +D+             NF +NQ P+VGWQ+ Y  +L
Sbjct: 219 AGYFIIPHTAMPSRHASSFKLLERVDFAGSVTGVIGLILFNFAWNQGPVVGWQTPYTYIL 278

Query: 331 LVLSFCALVIFVVYEVKYAKTPLIP-KAISSNRGMLMILFALFCGWGAFGTWTFYYFSFV 389
           L++    L IF   E + A  PL+P  A+SS+   ++   A   GW +FG W FY + F+
Sbjct: 279 LIVGTVFLAIFAFIESR-AAFPLLPFAALSSDTAFVLSCIA--AGWASFGIWIFYTWQFM 335

Query: 390 LNVRGYTAAWAGGSYFIFIVSGCAIATLCGFMMKKVPPSVILYISMIGFMGGCVMLTVTP 449
            + RG T   +   +    VSG   A   G+++ + PPS ++  +M  F  G +++   P
Sbjct: 336 EDSRGQTPLLSSAQFSPVAVSGFCAALTTGYLLSRTPPSTVMLFAMTAFTAGTILIATAP 395

Query: 450 IHQSYFQNILGIMFVLPIGIDLSFPAASIILSDALPIQYQGMAGSLVYTITNYSTSICLG 509
           +HQ+Y+      + V+P G+D+SFPAA+I+LSD++P ++QG+A SLV T+ NYS SI LG
Sbjct: 396 VHQTYWAQTFVSIIVMPWGMDMSFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLG 455

Query: 510 MAGSVEAYHNDNGQNILKGYRNAMIFADALAGLGIIVSGIYMVINLITIRENSKSTNKPK 569
           +AG++E+  ND G   LKGYR +      L+GLGI V+ IY      T +++ K T++ +
Sbjct: 456 IAGTIESNVNDGGAKPLKGYRCSWYMGIGLSGLGIFVAAIY---AWSTFKKSKKRTSEKQ 512

Query: 570 HL 571
           H 
Sbjct: 513 HF 514

>Suva_8.435 Chr8 (786917..788464) [1548 bp, 515 aa] {ON} YOR378W
           (REAL)
          Length = 515

 Score =  306 bits (785), Expect = 5e-97,   Method: Compositional matrix adjust.
 Identities = 175/509 (34%), Positives = 295/509 (57%), Gaps = 24/509 (4%)

Query: 78  ENLQSENKVLSPKY-FKNRTH-----EYLFIISCMVSQFMSQAGLTQALSIMNILAEELN 131
           E  +++++VL  ++  ++ T      E  F+     +Q M+QAGL Q+++ ++I+ +   
Sbjct: 17  ETTKTDDEVLLNQFELQDETPGSLVWEAAFVGVLCSAQLMTQAGLGQSIAPLHIIGDSFG 76

Query: 132 AEKSRQ-AWLMASFTLSMGSFILVSGRLGDIYGLKKVLLGGYAILTIWSLICGFSSYSHN 190
                Q +W  +S++L++G+FIL++GRLGDI+G +K  + G+    +WSL+ GFS YS N
Sbjct: 77  TTNPGQLSWFASSYSLTVGTFILIAGRLGDIFGHRKFFILGFFWYALWSLLAGFSVYS-N 135

Query: 191 DAFFITSRAFQGLGLAFVLPNSLGLIGVIYEPGSMKKNMIIGTLGAMSPIGATLGGLFAG 250
             FF   RAFQG+G AF+LPN++ ++G  Y+PG  +KNM+    GA +P G  LG +F+ 
Sbjct: 136 KIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGK-RKNMVFSLFGASAPGGFVLGAVFSS 194

Query: 251 IIGTKDPKQWPWSFYSFGIVSFCNMILSWYSIPN-NIPTN---IYNL--SMDWXXXXXXX 304
           ++G      WPW+++  GI  F   +  ++ IP+  +P+     +N+   +D+       
Sbjct: 195 MLGQL--AWWPWAYWIMGIACFLLAVAGYFVIPHVQMPSRDSPSFNMLERVDFAGSVTGV 252

Query: 305 XXXXXXNFVFNQAPIVGWQSAYIIVLLVLSFCALVIFVVYEVKYAKTPLIP-KAISSNRG 363
                 NF +NQ P+VGW++ Y  VLL++    L +FV  E + A  PL+P  A+SS+  
Sbjct: 253 IGLILFNFAWNQGPVVGWETPYTYVLLIVGTVFLGVFVFIESR-AAYPLLPFAALSSDAA 311

Query: 364 MLMILFALFCGWGAFGTWTFYYFSFVLNVRGYTAAWAGGSYFIFIVSGCAIATLCGFMMK 423
              +L  +  GW +FG W FY + F+   R  +   +   +    +SG   A   GF++ 
Sbjct: 312 F--VLGCIAAGWSSFGIWIFYTWQFMEESRKQSPLLSSAQFAPVAISGFCAAVTTGFLLS 369

Query: 424 KVPPSVILYISMIGFMGGCVMLTVTPIHQSYFQNILGIMFVLPIGIDLSFPAASIILSDA 483
             P S ++  +M  F  G +++   P+HQ+Y+      + V+P G+D+SFPAA+I+LS++
Sbjct: 370 HTPASTVMLFAMTAFTVGIILIATAPVHQTYWAQTFVSIIVMPWGMDMSFPAATIMLSNS 429

Query: 484 LPIQYQGMAGSLVYTITNYSTSICLGMAGSVEAYHNDNGQNILKGYRNAMIFADALAGLG 543
           +P ++QG+A SLV T+ NYS SI LG+AG++E+  ND G N LKGYR +      L+GLG
Sbjct: 430 MPHEHQGLAASLVNTVVNYSISIGLGIAGTIESQVNDGGANALKGYRCSWYMGIGLSGLG 489

Query: 544 IIVSGIYMVINLITIRENSKSTNKPKHLE 572
           I V+ +Y      T  ++ K  ++ +++E
Sbjct: 490 IFVAAVYAS---STFLKSKKKASEKQYIE 515

>Kwal_23.6547 s23 (1635677..1637212) [1536 bp, 511 aa] {ON} YOR378W
           - Hypothetical ORF [contig 358] FULL
          Length = 511

 Score =  301 bits (771), Expect = 5e-95,   Method: Compositional matrix adjust.
 Identities = 175/500 (35%), Positives = 284/500 (56%), Gaps = 21/500 (4%)

Query: 78  ENLQ-SENKVLSPKYFKNRTHEYLFIISCMVSQFMSQAGLTQALSIMNILAEELNAEKSR 136
           E+LQ  ++ V  P+    R   ++ I+SC  +Q M+QAGL Q+++ + I+          
Sbjct: 21  ESLQLVQSHVEKPQSLM-REALFVGILSC--AQLMTQAGLAQSIAPVRIIGNSFGISNPG 77

Query: 137 Q-AWLMASFTLSMGSFILVSGRLGDIYGLKKVLLGGYAILTIWSLICGFSSYSHNDAFFI 195
           Q +W  A+++L++G+FIL++GRLGD++G KK+ + G+   ++WSL+ GFS YS N  FF 
Sbjct: 78  QLSWFSAAYSLTVGTFILIAGRLGDLFGHKKLFVVGFLWYSLWSLLAGFSVYS-NQIFFD 136

Query: 196 TSRAFQGLGLAFVLPNSLGLIGVIYEPGSMKKNMIIGTLGAMSPIGATLGGLFAGIIGTK 255
             RA QG+G AF+LPNS+ ++G  Y PG  +K M+    GA +P G  LG +F+ I    
Sbjct: 137 CCRALQGIGPAFLLPNSIAILGRTYTPGK-RKQMVFSIFGATAPGGFVLGSVFSSIF--S 193

Query: 256 DPKQWPWSFYSFGIVSFCNMILSWYSIPNNIPTNIYNLS------MDWXXXXXXXXXXXX 309
               WPW++++ G       +     IP   P  I ++S      +D             
Sbjct: 194 QLAWWPWAYWAMGTACLVLGVAGIIVIPQAPPPKI-DISAGILERIDAAGATTGILGLAL 252

Query: 310 XNFVFNQAPIVGWQSAYIIVLLVLSFCALVIFVVYEVKYAKTPLIPKAISSNRGMLMILF 369
            NF +NQ P+VGWQ+ Y   LL++ F  L++F + E + A+ PL+P A  S   +  +L 
Sbjct: 253 VNFAWNQGPVVGWQTPYTYALLIVGFVFLLVFSLIESR-ARFPLLPFAALSTD-LAYVLG 310

Query: 370 ALFCGWGAFGTWTFYYFSFVLNVRGYTAAWAGGSYFIFIVSGCAIATLCGFMMKKVPPSV 429
            +  GW +FG W FY++ F+ + R  +       +    +SG   A   G+++  VP   
Sbjct: 311 CIAAGWSSFGIWIFYFWQFLEDSRSQSPLLTSAQFVPVAISGLCAALTTGYILSHVPACA 370

Query: 430 ILYISMIGFMGGCVMLTVTPIHQSYFQNILGIMFVLPIGIDLSFPAASIILSDALPIQYQ 489
           ++ I+MI F  G V++   PI+Q+Y+      + ++P G+D+SFPAA+I++S+A+P ++Q
Sbjct: 371 VMLIAMIAFTVGGVLVATAPINQTYWAQTFVSLIIMPWGMDMSFPAATIMISNAMPHEHQ 430

Query: 490 GMAGSLVYTITNYSTSICLGMAGSVEAYHNDNGQNILKGYRNAMIFADALAGLGIIVSGI 549
           G+A SLV T+ NYS S+ LG AG++E   N+ G N L+GYR A      L+GLG++V+ +
Sbjct: 431 GLAASLVNTVVNYSISLALGFAGTIETRVNNKGANRLEGYRGAWYMGIGLSGLGVLVAIV 490

Query: 550 YMVINLITIRE---NSKSTN 566
           Y    L   +E   + KS+N
Sbjct: 491 YAWSTLKKFKEEQLSEKSSN 510

>KLTH0C10560g Chr3 (875216..876763) [1548 bp, 515 aa] {ON} similar
           to uniprot|Q08902 Saccharomyces cerevisiae YOR378W
           Hypothetical ORF
          Length = 515

 Score =  296 bits (757), Expect = 8e-93,   Method: Compositional matrix adjust.
 Identities = 169/469 (36%), Positives = 271/469 (57%), Gaps = 18/469 (3%)

Query: 108 SQFMSQAGLTQALSIMNILAEELNAEKSRQ-AWLMASFTLSMGSFILVSGRLGDIYGLKK 166
           +Q M+QAGL Q+++ ++I+ +        Q +W  A+++L++G+FIL++GRLGD+YG KK
Sbjct: 55  AQLMTQAGLGQSIAPLHIIGDSFGTRNPGQLSWFAAAYSLTVGTFILIAGRLGDVYGHKK 114

Query: 167 VLLGGYAILTIWSLICGFSSYSHNDAFFITSRAFQGLGLAFVLPNSLGLIGVIYEPGSMK 226
             + G+    +WSL+ GFS YS N  FF   RAFQG+G A +LPN++ ++G  Y PG  +
Sbjct: 115 FFIIGFFWYALWSLLAGFSVYS-NQIFFDCCRAFQGIGPALLLPNAIAILGRTYVPGR-R 172

Query: 227 KNMIIGTLGAMSPIGATLGGLFAGIIGTKDPKQWPWSFYSFGIVSFCNMILSWYSIPN-- 284
           K MI+   GA +P G  LG +F+ I G      WPW++++ GIV F   +     IP   
Sbjct: 173 KAMILSLFGATAPAGFVLGAVFSSIFGQL--TWWPWAYWAMGIVCFFLAVAGILVIPRMP 230

Query: 285 --NIPTNIYNLS-MDWXXXXXXXXXXXXXNFVFNQAPIVGWQSAYIIVLLVLSFCALVIF 341
              + T++     +D              NF +NQ P+VGWQ+ Y   LL++S   L +F
Sbjct: 231 LPELDTSVSTYQRLDIPGSVTGVIGLVLLNFAWNQGPVVGWQTPYTYSLLIVSAVFLCVF 290

Query: 342 VVYEVKYAKTPLIP-KAISSNRGMLMILFALFCGWGAFGTWTFYYFSFVLNVRGYTAAWA 400
              E + A  PL+P  A+SS+     +L  +  GW +FG W +Y++ F+  +RG++    
Sbjct: 291 AFIESR-APHPLLPLSALSSDAAF--VLGCVGAGWSSFGIWIYYFWLFLEELRGHSPLLT 347

Query: 401 GGSYFIFIVSGCAIATLCGFMMKKVPPSVILYISMIGFMGGCVMLTVTPIHQSYFQNILG 460
              +    +SG   A   GF++ +V  S+++  +M  F  G +++   P+ Q Y+     
Sbjct: 348 SAQFAPVAISGLCAALTTGFVITRVRASLVMLFAMTAFTVGGILIATAPVKQVYWAQAFV 407

Query: 461 IMFVLPIGIDLSFPAASIILSDALPIQYQGMAGSLVYTITNYSTSICLGMAGSVEAYHND 520
            + V+P G+D+SFPAA+I+LSD++P ++QG+A SLV  + NYS SI LG+AG+VE   N+
Sbjct: 408 SIIVMPWGMDMSFPAATIMLSDSMPHEHQGLAASLVNVVVNYSISIGLGLAGTVEGRVNN 467

Query: 521 NGQNILKGYRNAMIFADALAGLGIIVSGIYMVINLITIRENSK-STNKP 568
            G N+LKGYR A      L+G GI+++ +Y      T +++ K  + KP
Sbjct: 468 GGANLLKGYRGAWYMGIGLSGFGILIAFMY---EYHTFKKSKKMPSEKP 513

>KLLA0B00352g Chr2 (22476..23972) [1497 bp, 498 aa] {ON} highly
           similar to uniprot|Q08902 Saccharomyces cerevisiae
           YOR378W
          Length = 498

 Score =  278 bits (710), Expect = 4e-86,   Method: Compositional matrix adjust.
 Identities = 153/432 (35%), Positives = 247/432 (57%), Gaps = 14/432 (3%)

Query: 108 SQFMSQAGLTQALSIMNILAEELNAEKSRQ-AWLMASFTLSMGSFILVSGRLGDIYGLKK 166
           +Q M+QAGL Q++  + I+ +    +   Q +W  ++F+L++G+FIL++GRLGD +G KK
Sbjct: 39  AQLMTQAGLAQSIVPLQIIGDSFGIKNPGQLSWFASAFSLTVGTFILIAGRLGDTFGHKK 98

Query: 167 VLLGGYAILTIWSLICGFSSYSHNDAFFITSRAFQGLGLAFVLPNSLGLIGVIYEPGSMK 226
             + G+    +WS++ GFS YS N  FF   RAFQG+G AF LPN++ +I   Y PG  K
Sbjct: 99  FFVMGFLWYALWSILAGFSVYS-NQIFFDCCRAFQGIGPAFTLPNAIAIIARTYRPGR-K 156

Query: 227 KNMIIGTLGAMSPIGATLGGLFAGIIGTKDPKQWPWSFYSFGIVSFCNMILSWYSIPNNI 286
           +NMI    GA +P G  +G +F+ ++   +   WPW+++  GI  F   +  +  IP++ 
Sbjct: 157 QNMIFSLFGACAPSGFVVGAVFSSLL--SEFAWWPWAYWIMGITCFLLGVAGYLVIPHHP 214

Query: 287 PTNIYNL-----SMDWXXXXXXXXXXXXXNFVFNQAPIVGWQSAYIIVLLVLSFCALVIF 341
           P +          +D              NF +NQ P+VGW+++Y   LL++    L  F
Sbjct: 215 PIHPDEKCSLVERIDVAGSVTGVVGLILFNFAWNQGPVVGWETSYTYALLIVGSAFLAAF 274

Query: 342 VVYEVKYAKTPLIP-KAISSNRGMLMILFALFCGWGAFGTWTFYYFSFVLNVRGYTAAWA 400
              E + AK PL+P + +SS+   + ++  +  GW +FG W +Y +  + N+R      +
Sbjct: 275 GFIESR-AKHPLLPVRKLSSDT--IFVMGCIAAGWSSFGIWVYYTWQLMANLRDQPPLLS 331

Query: 401 GGSYFIFIVSGCAIATLCGFMMKKVPPSVILYISMIGFMGGCVMLTVTPIHQSYFQNILG 460
              +    +SG   A    F++ +  PS ++ I+MI F  G +++   P+ Q+Y+     
Sbjct: 332 SAQFVPVAISGLCAAMSTEFLLTRTSPSTVMIIAMIAFTVGSILVATVPVSQTYWAQTFV 391

Query: 461 IMFVLPIGIDLSFPAASIILSDALPIQYQGMAGSLVYTITNYSTSICLGMAGSVEAYHND 520
            + V+P G+D+SFPAA+IILS A+P  +QG+A SLV TI NYS SI LG AG++E+  +D
Sbjct: 392 SIIVMPWGMDMSFPAATIILSTAMPASHQGLAASLVNTIINYSISIGLGFAGTIESQISD 451

Query: 521 NGQNILKGYRNA 532
              ++LKGYR A
Sbjct: 452 GEDDLLKGYRGA 463

>TDEL0G04950 Chr7 complement(922428..923966) [1539 bp, 512 aa] {ON} 
          Length = 512

 Score =  239 bits (610), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 153/454 (33%), Positives = 258/454 (56%), Gaps = 9/454 (1%)

Query: 98  EYLFIISCMVSQFMSQAGLTQALSIMNILAEELNAEKSRQAWLMASFTLSMGSFILVSGR 157
           EY F+ + +++Q  +QAG T  L ++N+L++  + +     +L+ S+ +  GSF+L+ GR
Sbjct: 50  EYAFVFTGVMAQAFNQAGGTMILPLVNVLSDSFHGK-----FLLNSYPMVCGSFMLIGGR 104

Query: 158 LGDIYGLKKVLLGGYAILTIWSLICGFSSYSHNDAFFITSRAFQGLGLAFVLPNSLGLIG 217
           LG+++G K+ LLGGY IL + SL+ G S YS +  F++  RAFQG+G+A +LPN      
Sbjct: 105 LGEVHGYKETLLGGYIILILSSLLGGLSRYSKSSIFYVICRAFQGVGMALILPNFSAAYD 164

Query: 218 VIYE--PGSMKKNMIIGTLGAMSPIGATLGGLFAGIIGTKDPKQWPWSFYSFGIVSFCNM 275
             Y+    + +K ++   +G  +  GA LG   +GI  T+    W W++Y++ I +   +
Sbjct: 165 YRYQSQAKAHRKTILSTIIGCGASTGAFLGTFLSGICVTRSESNWSWAYYTYTIAATLTL 224

Query: 276 ILSWYSIPNNIPTNIYNLSMDWXXXXXXXXXXXXXNFVFNQAPIVGWQSAYIIVLLVLSF 335
            LS+YS+P+NI                        N   N A +     ++IIVLLV+  
Sbjct: 225 ALSYYSVPDNITKKNKPCLNGLGWFSNRSCGLLMLNVACNLAAVASSNWSHIIVLLVVFV 284

Query: 336 CALVIFVVYEVKYAKTPLIPKAISSNRGMLMILFALFCGWGAFGTWTFYYFSFVLNVRGY 395
           C L++F+V+E+K+++ P+  K + +N  + ++L ++F GWG +G W+ Y+F F+LN+R Y
Sbjct: 285 CLLLLFLVFELKFSEDPVFSKELFTNASVSLVLASIFFGWGTYGIWSGYFFRFLLNLRNY 344

Query: 396 TAAWAGGSYFIFIVSGCAIATLCGFMMKKVPPSVILYISMIGFMGGCVMLTVTPIHQSYF 455
           +   AG +Y   ++ G         ++K+  P + L  S +GF    ++L+VTPIHQSYF
Sbjct: 345 SPLAAGSTYLTLVIGGYVAEIGISMLVKRTGPKLFLLFSSLGFTCSIIILSVTPIHQSYF 404

Query: 456 QNILGIMFVLPIGIDLSFPAASIILSDALPIQYQGMAGSLVYTITNYSTSICLGMAGSVE 515
           ++ LG M  L +G+D SFP+++IIL + LP +Y  M   L   I NY+ S   G+  S  
Sbjct: 405 RSTLGSMIFLALGLDFSFPSSAIILQNELPSKYHEMTAVLTNGIFNYAISFWPGICNS-- 462

Query: 516 AYHNDNGQNILKGYRNAMIFADALAGLGIIVSGI 549
           A  + +   ++K YR    FA  L+ +G+  +GI
Sbjct: 463 ALRSLSSIELIKYYRYVYYFAIGLSAIGLFAAGI 496

>KNAG0D00130 Chr4 complement(6264..7961) [1698 bp, 565 aa] {ON}
           YOR378W
          Length = 565

 Score =  197 bits (501), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 144/496 (29%), Positives = 237/496 (47%), Gaps = 23/496 (4%)

Query: 97  HEYLFIISCMVSQFMSQAGLTQALSIMNILAEELN-AEKSRQAWLMASFTLSMGSFILVS 155
           HE +F++    SQ +  AG  Q +  M+++ E       S   W    +  + GSF+L++
Sbjct: 77  HEIIFVLLVSSSQVLGLAGAVQGIPQMDVIVEWFKLTHPSDSGWCNGGYATTYGSFVLIA 136

Query: 156 GRLGDIYGLKKVLLGGYAILTIWSLICGFSSYSHNDAFFITSRAFQGLGLAFVLPNSLGL 215
           G++GD+ G K + L GYA L +WSL+ GFS Y  +  FF   RA QG+G AF   ++L +
Sbjct: 137 GKMGDMNGHKSMFLIGYAWLALWSLLTGFSRYCPSSHFFFFCRAAQGIGAAFTFTSALSI 196

Query: 216 IGVIYEPGSMKKNMIIGTLGAMSPIGATLGGLFAGIIGTKDPKQWPWSFYSFGIVSFCNM 275
           +G  Y P   +KN I    GA    G  LG +F+ +        W W+++S  I     +
Sbjct: 197 LGKSYPP-CKRKNFIFSFFGACGSFGVVLGMVFSALF--TQLAHWSWAYWSMAIACVVII 253

Query: 276 ILSWYSIPNNI-----PTNIYNLSMDWXXXXXXXXXXXXXNFVFNQAPIVGWQSAYIIVL 330
           ILS + IP ++      +N++    D+             +  +NQAP  G+   Y+ VL
Sbjct: 254 ILSIFFIPGDVVEKHETSNVFYF--DYLGAFLFVTGLVLFSVAWNQAPTYGFGRTYVYVL 311

Query: 331 LVLSFCALVIFVVYEVKYAKTPLIP-KAISSNRGMLMILFALFCGWGAFGTWTFYYFSFV 389
           L++S   L + +  E K    PL+P   IS+N   L +L A+F  + +F  W  Y F F 
Sbjct: 312 LIVSVVILALAMYVETK-VDDPLLPWTHISANT--LKVLLAIFFAYASFTMWAAYTFRFN 368

Query: 390 LNVRGYTAAWAGGSYFIFIVSGCAIATLCGFMMK-KVPPSVILYISMIGFMGGCVMLTVT 448
           L  +G T   A        VSG   A     ++   V   + + IS++ F+   +++   
Sbjct: 369 LMAKGDTLLLAAAKMTPMAVSGVFAALFSALLLNIHVQVQIRMLISLLAFLVPPILMATM 428

Query: 449 PIHQSYFQNILGIMFVLPIGIDLSFPAASIILSDALPIQYQGMAGSLVYTITNYSTSICL 508
              Q+Y+  +     V+  G+D+SFP+A+++LS+ +P +++G+  SLV  + NY+T++  
Sbjct: 429 GAGQTYWGEVFVTTIVISFGLDISFPSATLLLSNRIPDKFKGLGASLVGAVLNYATALGP 488

Query: 509 GMAGSVEAYHNDN-----GQNILKGYRNAMIFADALAGLGIIVSGIYMVINLITIRENSK 563
             A SV  Y   +     G    K            AGLG +V+ I+ VI         K
Sbjct: 489 PTAASVLRYQCPDCMAHKGNAFTKTINIIGYVGIGTAGLGTLVA-IFGVITEYPKVAGKK 547

Query: 564 STNKPKHLETYSTDAE 579
             ++ KH  T +T+  
Sbjct: 548 GEDR-KHSLTLTTNVR 562

>KAFR0C04860 Chr3 (964552..966156) [1605 bp, 534 aa] {ON}  YOR378W
          Length = 534

 Score =  168 bits (425), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 129/456 (28%), Positives = 228/456 (50%), Gaps = 26/456 (5%)

Query: 82  SENKVLSPKYFKNRTH-------EYLFIISCMVSQFMSQAGLTQALSIMNILAEELNAEK 134
           S N++LS    K   H       E + ++     QF+S  G  Q +  M  +A   +   
Sbjct: 29  SHNEILS----KTDEHPLNMQFKEIIIVLLISSGQFISLLGAVQGIPQMASIASTFSLRP 84

Query: 135 SRQ---AWLMASFTLSMGSFILVSGRLGDIYGLKKVLLGGYAILTIWSLICGFSSYSH-N 190
            +     W  A++  +  +F++++G+LGDI G K + + GYA LT+WSL+ GFS Y+  N
Sbjct: 85  DQNLELGWCNAAYATTATTFVIIAGKLGDINGHKNMFIFGYAWLTLWSLLTGFSKYAKAN 144

Query: 191 DAFFITSRAFQGLGLAFVLPNSLGLIGVIYEPGSMKKNMIIGTLGAMSPIGATLGGLFAG 250
             FF   R  QG+G AF+ P  L L+G  Y P   +KN +    GA  P G   G +F+ 
Sbjct: 145 AVFFYFCRGAQGIGSAFLTPTGLALLGKHYPP-CKRKNYVFSFYGACGPFGIVAGSVFSA 203

Query: 251 IIGTKDPKQWPWSFYSFGIVSFCNMILSWYSIP-NNIPTNIYN--LSMDWXXXXXXXXXX 307
           +        W W+++S  +      ILS+  IP +N P    +   S D+          
Sbjct: 204 LF--TQLTTWAWTYWSMAVTCLIITILSYIFIPKDNTPKRERSAFYSFDYVGGFCGITGM 261

Query: 308 XXXNFVFNQAPIVGWQSAYIIVLLVLSFCALVIFVVYEVKYAKTPLIP-KAISSNRGMLM 366
              + V+NQAP+  +++ Y+  LL++S   + + ++ + +  K PLIP K++ SN  ++ 
Sbjct: 262 ILFSVVWNQAPLSHFKAPYVYSLLIVSVVFMTMALIIDSR-VKDPLIPWKSMCSN--VIK 318

Query: 367 ILFALFCGWGAFGTWTFYYFSFVLNVRGYTAAWAGGSYFIFIVSGCAIATLCGFMM-KKV 425
            L  +F G+  F  W FY + F L  +  +   A   +    +SG   A     ++ KKV
Sbjct: 319 ALIVVFFGFLGFTIWLFYSWRFYLVAKNDSLLLAAAKFIPLGISGIFAACFSVLLLNKKV 378

Query: 426 PPSVILYISMIGFMGGCVMLTVTPIHQSYFQNILGIMFVLPIGIDLSFPAASIILSDALP 485
           P  + L  ++  F+   ++++   + ++Y+ N      ++ IG+D++FP+A+++LS+ + 
Sbjct: 379 PVQLRLLTAVCAFLICAILISTMTLQETYWGNAFVATVIIAIGLDVAFPSATLLLSNGVL 438

Query: 486 IQYQGMAGSLVYTITNYSTSICLGMAGSVEAYHNDN 521
            + QG+A +L  T  NY T++  G+A  +  Y  D+
Sbjct: 439 NEQQGLAAALAATALNYGTALGPGVATLIITYQCDD 474

>NCAS0A05720 Chr1 (1117491..1119182) [1692 bp, 563 aa] {ON} 
          Length = 563

 Score =  167 bits (422), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 148/519 (28%), Positives = 251/519 (48%), Gaps = 31/519 (5%)

Query: 81  QSENKVLSPKYFKNRTHEYLFIISCMVSQFMSQAGLTQALSIMNILAE--ELNAEKSRQA 138
           Q + + ++P    +R  E +FI+    SQF+S A  +QA+  M+ +    +L A++S +A
Sbjct: 54  QDQLESMNPPPGPSRLRECMFIVIIASSQFISLAAASQAILQMDAITAWFQLPADRSLEA 113

Query: 139 -WLMASFTLSMGSFILVSGRLGDIYGLKKVLLGGYAILTIWSLICGFSSYSHND--AFFI 195
            W  A+F ++ G+FI+ +G+L D+ G K V + GYA  T+WSL+ G S Y+      FF 
Sbjct: 114 GWANAAFAITCGTFIIPAGKLCDLIGSKTVFIFGYAWYTLWSLLVGISRYAPKGQATFFF 173

Query: 196 TSRAFQGLGLAFVLPNSLGLIGVIYEPGSMKKNMIIGTLGAMSPIGATLGGLFAGIIGTK 255
             R  QG+G A + P+SL L+G  Y P S KKN++    G   P+G  +GG+F+ I    
Sbjct: 174 FGRGCQGIGAAALFPSSLALLGKYYPP-SCKKNIVFSLYGFCVPLGVVVGGVFSAIF--T 230

Query: 256 DPKQWPWSFYSFGIVS-FCNMILSWYSIPNNIPTN---------IYNLSMDWXXXXXXXX 305
               W W+++S  IVS F  +I  +Y  P+ I  +          +    D+        
Sbjct: 231 QLAHWSWNYWSMAIVSAFFTLISCFYIPPDEIIKSEEQKKKRAWFHLPKFDYLGTFLYVA 290

Query: 306 XXXXXNFVFNQAPIVGWQSAYIIVLLVLSFCALVIFVVYEVKYAKTPLIPKAISSNRGML 365
                   +NQA    ++S  + V L++S    V  V+ E  Y   P+IP A   +   +
Sbjct: 291 SLLLFAVCWNQATGFKFKSVQVYVTLIVSLVCFVAMVIVEF-YVDDPIIP-ARKIHPQTI 348

Query: 366 MILFALFCGWGAFGTWTFYYFSFVLNVRGYTAAWAGGSYFIFIVSGCAIATLCGFMM--K 423
             L  +F  + +F  W FY + +   VR  T       +    ++G  IA L   ++   
Sbjct: 349 KALLVVFFSYLSFTIWLFYLWKYFTVVRNDTVLLGAAKFVPLSIAG-FIAALFSILLIST 407

Query: 424 KVPPSVILYISMIGFMGGCVMLTVTPIHQSYFQNILGIMFVLPIGIDLSFPAASIILSDA 483
            VP  + L      F+   ++       +SY+      + ++ IG+D+SFP+A+++LS+ 
Sbjct: 408 AVPVQIRLLAGACSFLLAHILFITLSRTESYWARPFLTIIIISIGLDISFPSATLLLSNG 467

Query: 484 LPIQYQGMAGSLVYTITNYSTSICLGMAGSVEAYHNDN--GQNILKGYRNAMIFADALAG 541
           +P + +G++ +LV T  NY T I   +A ++  Y  D       +  +  A+  A   A 
Sbjct: 468 VPQELRGISAALVGTALNYGTGIGPPIAQTIIGYQCDKCMASGDMDQFVKAIHIA---AA 524

Query: 542 LGIIVSGIYMVINLI-TIRENSKSTN--KPKHLETYSTD 577
           +GI  SGI +V+ L  T+ E S  T+    + +E Y  +
Sbjct: 525 VGIGASGIAVVVGLYGTVTEYSWETHSYSKRCVEPYDDE 563

>SAKL0C06116g Chr3 complement(571813..572370) [558 bp, 185 aa] {ON}
           some similarities with uniprot|P13090 Saccharomyces
           cerevisiae YML116W ATR1 Multidrug efflux pump of the
           major facilitator superfamily required for resistance to
           aminotriazole and 4-nitroquinoline-N-oxide
          Length = 185

 Score =  140 bits (353), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 75/190 (39%), Positives = 108/190 (56%), Gaps = 34/190 (17%)

Query: 106 MVSQFMSQAGLTQALSIMNILAEELNAEKSRQAWLMASFTLSMGSFILVSGRLGDIYGLK 165
           M+SQ ++Q G TQ L ++N+L+    +  + Q  L+AS  L  GSFILVSG++GDIYGLK
Sbjct: 1   MMSQLLNQVGTTQTLPLINVLSRGFESSTAEQTRLVASIPLVSGSFILVSGKVGDIYGLK 60

Query: 166 KVLLGGYAILTIWSLICGFSSYSHNDAFFITSRAFQGLGLAFVLPNSLGLIGVIYEPGSM 225
             LL GYA + +WS ICG + Y+ +  FF+ +RAFQGLGLAFVLPN +G +  +Y  GS+
Sbjct: 61  NTLLFGYATVIVWSFICGLTRYAGSVQFFVIARAFQGLGLAFVLPNVMGTVSNVYIAGSI 120

Query: 226 KKNMIIGTLGAMSPIGATLGGLFAGIIGTKDPKQWPWSFYSFGIVSFCNMILSWYSIPNN 285
           +KNM+                                  Y++ +    NM L  +++P N
Sbjct: 121 RKNMV----------------------------------YAYTVAVSLNMALCVWALPWN 146

Query: 286 IPTNIYNLSM 295
           IPTN+   +M
Sbjct: 147 IPTNVRGQAM 156

>CAGL0L02519g Chr12 complement(297555..299144) [1590 bp, 529 aa]
           {ON} similar to uniprot|Q08902 Saccharomyces cerevisiae
           YOR378w
          Length = 529

 Score =  148 bits (373), Expect = 9e-38,   Method: Compositional matrix adjust.
 Identities = 131/499 (26%), Positives = 230/499 (46%), Gaps = 35/499 (7%)

Query: 93  KNRTHEYLFIISCMVSQFMSQAGLTQALSIMNILAEELNAEKSRQA---WLMASFTLSMG 149
           K    E   +I  + SQ ++  G  Q + I   L E    E ++     W  AS+ L   
Sbjct: 33  KTWIREIFLVIILISSQLVTLIGAVQGVPIAAYLRERYRIEPAKGGLVGWANASYMLGSA 92

Query: 150 SFILVSGRLGDIYGLKKVLLGGYAILTIWSLICGFSSYSH-NDAFFITSRAFQGLGLAFV 208
             +L++G+LGD+ G K++++ G+  LTIWSLI GFS Y   N AF+ T+RA QG+G  F+
Sbjct: 93  VMVLIAGKLGDLNGHKRMVVFGWIWLTIWSLITGFSYYDRGNQAFYYTARALQGIGSGFI 152

Query: 209 LPNSLGLIGVIY-EPGSMKKNMIIGTLGAMSPIGATLGGLFAGIIGTKDPKQWPWSFYSF 267
           +PNSL ++G  Y EPG +KK +I    G M+  G  +G  F+ +       +W W++++ 
Sbjct: 153 VPNSLAIMGRTYFEPG-LKKTIIFSIFGMMTSTGFVIGTTFSSLFAQL--TKWAWNYWAL 209

Query: 268 GIVSFCNMILSWYSIPNNIPTNIYN--------LSMDWXXXXXXXXXXXXXNFVFNQAPI 319
             V     + +   IP   P NI +           D+             +  F QA  
Sbjct: 210 ACVCVLYTVGAILFIP---PDNIVHKPNSKPLYKRFDYLGAITGVSGLVLFDVAFTQASA 266

Query: 320 VGWQS--AYIIVLLVLSFCALVIFVVYEVKYAKTPLIPKAISSNRGMLMILFALFCGWGA 377
           +GW     YI +++ +    + +FV + V     PL+P        +++IL  ++ G+ +
Sbjct: 267 LGWSPPHTYITLIIGVILILIAMFVDWRV---DDPLVPLQ-HLRADVVVILICVYFGFLS 322

Query: 378 FGTWTFYYFSFVLNVRGYTAAWAGGSYFIFIVSG--CAIATLCGFMMKKVPPSVILYISM 435
           F  W  +++ F   V   +            +     AI T+    +    P++++ ISM
Sbjct: 323 FVIWANWFWQFYELVHNDSPLRIAAKLVPLAIGSIPAAIFTVTCLQLNIKAPTMMV-ISM 381

Query: 436 IGFM-GGCVMLTVTPIHQSYFQNILGIMFVLPIGIDLSFPAASIILSDALPIQYQGMAGS 494
           + F+    +M TVTP + +Y+        + P  +D++ P A+++ SD++  + QG+A S
Sbjct: 382 VCFLVPNILMATVTP-NTTYWAQPFVSSIIAPFAVDITVPTATLLFSDSVRKESQGIAAS 440

Query: 495 LVYTITNYSTSICLGMAGSVEAYHNDNGQNILKG-----YRNAMIFADALAGLGIIVSGI 549
           L+ T+ +Y+ SI       V  Y    G +   G       +  I    L+G+G++ + I
Sbjct: 441 LIITVISYAISIGPSYTAMVMWYVAPLGNDSTPGGFTHSLHSNFICGIVLSGIGLVTAVI 500

Query: 550 YMVINLITIRENSKSTNKP 568
             +I+    R +      P
Sbjct: 501 AGLIDYKITRTHCGDIPPP 519

>NDAI0K02730 Chr11 complement(612590..614404) [1815 bp, 604 aa] {ON}
           
          Length = 604

 Score =  136 bits (343), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 126/544 (23%), Positives = 243/544 (44%), Gaps = 76/544 (13%)

Query: 82  SENKVLSPKYFKNRTHEYL----FIISCMVSQFMSQAGLTQALSIMNILAEELNAEKS-- 135
           + + ++  +  ++ T+ YL    FI     SQF++ A  +QA+  M+ L+       +  
Sbjct: 51  THSSLIRLQKLQSPTNSYLNDIIFIFLICSSQFITLASASQAILQMDSLSVWFKIPPTST 110

Query: 136 -RQAWLMASFTLSMGSFILVSGRLGDIYGLKKVLLGGYAILTIWSLICGFSSY-SHNDAF 193
            +  W+ ASF ++ G+FI+++G+L DI   + + + GY   ++W+LI GF+SY   N  F
Sbjct: 111 LQLGWVNASFAMTCGAFIILAGKLCDILNPRIIFISGYVWFSLWTLITGFASYVPKNMIF 170

Query: 194 FITSRAFQGLGLAFVLPNSLGLIGVIY---------------------EPGSMKKNM--- 229
               R  QG+G A + P++L L+   Y                         ++KN+   
Sbjct: 171 LYICRGCQGIGGALLFPSALILLNQYYTVPEPSPSQSQSKSPTTSAPSPSHDIEKNLSSD 230

Query: 230 --------------IIGT--------LGAMSPIGATLGGLFAGIIGTKDPKQWPWSFYSF 267
                         II T         GA +P+G  +GG+F+ I        WPW+++S 
Sbjct: 231 DDNDGDSSIADDSDIICTSKSIAFSLYGACAPLGIVIGGIFSAIF--TQLATWPWNYWSM 288

Query: 268 GIVSFCNMILSWYSIPNNIPTNIYN---------LSMDWXXXXXXXXXXXXXNFVFNQAP 318
            IV+    ILS++ +   IP    +          + D+                ++QA 
Sbjct: 289 SIVTTLLSILSYFYVVVPIPVEKLDSNPNSLKNWKNFDFLGVILGISALILFGVSWDQAT 348

Query: 319 IVGWQSAYIIVLLVLSFCALVIFVVYEVKYAKTPLIPKAISSNRGMLMILFALFCGWGAF 378
           +  +++ ++ + L+ S  + +  +++E  Y   P+IP     + G +  L  +F  + +F
Sbjct: 349 MYKFKTIHVYLTLLFSLVSFIAMIIWEY-YFNNPIIPIR-QIHPGTIKALLVVFFSYISF 406

Query: 379 GTWTFYYFSFVLNVRGYTAAWAGGSYFIFIVSGCAIATLCGFMM-KKVPPSVILYISMIG 437
             W FY +     V+  +       +    V+G   AT    ++ K+VP  + L      
Sbjct: 407 TQWLFYTWKLFTEVKDNSPILGSVKFIPLSVAGIISATFSILLIVKRVPVQIRLLAGASS 466

Query: 438 FMGGCVMLTVTPIHQSYFQNILGIMFVLPIGIDLSFPAASIILSDALPIQYQGMAGSLVY 497
           F+   ++L    +  SY+      +  + IG+D+SFP+A+++L++ +P + QG+  +LV 
Sbjct: 467 FLLSHILLLTCKLDSSYWTYQFFSIISISIGLDISFPSATLLLTNGIPPEIQGICAALVG 526

Query: 498 TITNYSTSICLGMAGSVEAYHND-------NGQNILKGYRNAMIFADALAGLGIIVSGIY 550
           ++ NY T+I   +A ++  Y  +       + +  LKG   A       +G+ +++ GIY
Sbjct: 527 SVLNYGTAIGPPIAQTIIQYQCESCMSDPHDKKAFLKGIHIAGAVGVGCSGIAVLI-GIY 585

Query: 551 MVIN 554
             I 
Sbjct: 586 GTIT 589

>KLLA0C18931g Chr3 (1680133..1681794) [1662 bp, 553 aa] {ON}
           uniprot|Q874B4 Kluyveromyces lactis KLLA0C18931g Drug
           efflux permease KNQ1
          Length = 553

 Score = 60.5 bits (145), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 101/506 (19%), Positives = 200/506 (39%), Gaps = 80/506 (15%)

Query: 80  LQSENKVLSPK--YFKNRTHEYLFIISCMVSQFMSQAGLTQALSIMNILAEELNAEKSRQ 137
           + SE  V  PK   F   T ++L  I  +++  +  A +   + ++  +    N   ++ 
Sbjct: 1   MPSEKSVTFPKGSLFHQDTLKHLKFICILIACGLDLASVGAMIVLVTDIETRFNVSHTQS 60

Query: 138 AWLMASFTLSMGSFILVSGRLGDIYGLKKVLLGGYAILTIWSLICGFSSYSHNDAFFITS 197
            W + S+ ++   FI   GR+GDI G   ++     I  I+SL+C   +   N   F   
Sbjct: 61  GWALTSYVITFAGFIAFFGRVGDIVGNGIMMCVFSVIFGIFSLLC---AVVPNFIAFTVF 117

Query: 198 RAFQGLGLAFVLPNSLGLIGVIYEPGSMKK--NMIIGTLGAMSPIGATLGGLFAGI-IGT 254
           RAFQG+  A ++P +  L+  +++  ++++  +++   + AM+ +G  +GG F    +G 
Sbjct: 118 RAFQGMAGAGIVPCAYALVNKMFQGPNLQRYFSILSSVISAMAGVGFIIGGAFGETALGY 177

Query: 255 KDPKQWPWSFYSF-------------GIVSFCNMILSWYSIPNNIPTNIYNLSMDWXXXX 301
           K       SF+ F              ++ +  ++L+ +S        +Y L +      
Sbjct: 178 K-------SFFYFLFAASLATAAVICVLIGYPELLLNRHSYKEKF-QRVYKLDVIGCLLF 229

Query: 302 XXXXXXXXXNFVFNQAPIVGWQSAYIIVLLVLSFCALVIFVVYEVKYAKTPLIPKAISSN 361
                               W      V L +S   L+IF ++ + YA    + K IS++
Sbjct: 230 ISGSILLVVGLTQGGE---SWNDPTAYVPLAVSIVLLIIFFMWNLGYAVVLKLIKPISTH 286

Query: 362 RG-----------------------MLMILFALFCGWGAFGTWTFYYFSFVLNVRGYTAA 398
           +G                       +L+  F LFCG          +   +  +  Y+A 
Sbjct: 287 KGYAYMESVNLLIPKNLMFSHNFIPVLLATFFLFCG----------FMVVMYVIANYSAT 336

Query: 399 WAGGSYFIF------IVSGCAIATLCGFMMKK----VPPSVILYISMIGFMGGCVMLTVT 448
             G S  +       ++SG  +A   G +  K     P + ++  S I  +GG   + + 
Sbjct: 337 VEGNSMIVASIKIIPMISGLVLAN--GTVAYKQDLFKPKNALVVGSFISILGGAFFVPIK 394

Query: 449 PIHQSYFQNI--LGIMFVLPIGIDLSFPAASIILSDALPIQYQGMAGSLVYTITNYSTSI 506
            +  + F  +  +G  F    G        ++ + DA P QY+ +AG +V T   +   +
Sbjct: 395 YVDDNLFWKLFFMGGFFTGLGGAFFFCYMITMAIGDA-PDQYKALAGGIVQTSGQFGNEV 453

Query: 507 CLGMAGSVEAYHNDNGQNILKGYRNA 532
            L +  S+      +  ++   ++NA
Sbjct: 454 SLSIVISLLGNQTTDKADLRDRFQNA 479

>Smik_13.272 Chr13 complement(427283..428968) [1686 bp, 561 aa] {ON}
           YMR088C (REAL)
          Length = 561

 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 55/175 (31%), Positives = 84/175 (48%), Gaps = 23/175 (13%)

Query: 93  KNRTHEY-------LFIISCMVSQFMSQAGLTQALSIMNILAEELNAEKSRQAWLMASFT 145
           + + HEY         + S  +  F+S    T   +IMN +AEE  +E SR+ W+  SF 
Sbjct: 23  EQKFHEYNLALPKFPILFSLWLGSFLSSLDGTIVANIMNRVAEEF-SESSRKQWIATSFL 81

Query: 146 LSMGSFILVSGRLGDIYGLKKVLLGGYAILTIWSLICGFSSYSHNDAFFITSRAFQGLGL 205
           L+  +F  + G+L DI G K  LL  +    I    C  + ++ N   F  +RA  G+G 
Sbjct: 82  LTNTAFQPLYGKLSDITGRKSALLTAHFFFGIG---CLLTCFARNVTEFSIARAICGIGA 138

Query: 206 AFVLPNSLGLIGV-----IYEPGSMK--KNMIIGTLGAMSPIGATLGGLFAGIIG 253
             +  N++G I V       E G  +   N++ G LG +  +GA LGG+F   IG
Sbjct: 139 GGL--NAIGSIAVSDICTARERGVYQGYANIVFG-LGQL--LGAPLGGVFIETIG 188

>Kwal_34.15746 s34 (37757..39313) [1557 bp, 518 aa] {ON} YGR224W
           (AZR1) - MFS-MDR [contig 274] FULL
          Length = 518

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 40/132 (30%), Positives = 64/132 (48%), Gaps = 5/132 (3%)

Query: 120 LSIMNILAEELNAEKSRQAWLMASFTLSMGSFILVSGRLGDIYGLKKVLLGGYAILTIWS 179
           +S++  L E      +  +W + S+ ++   FI   GRLGDI G   +      + T++S
Sbjct: 48  ISVIEDLGETYKLGYTGASWALTSYAITFAGFIAFMGRLGDIVGNSVLFTISCFLFTLFS 107

Query: 180 LICGFSSYSHNDAFFITSRAFQGLGLAFVLPNSLGLIGVIYEPGSMKKNMIIGTLGAMSP 239
           L+C   +   +   F   RA QG+  A ++P    LI ++ EP  ++K   I + G  S 
Sbjct: 108 LLC---AVVRDFPTFAVFRALQGISAAGIVPCGYALIPLLAEPQDIQKFFSIVSCGFSST 164

Query: 240 IGATL--GGLFA 249
           IG  L  GG FA
Sbjct: 165 IGIGLIVGGAFA 176

>SAKL0F00440g Chr6 complement(36452..38086) [1635 bp, 544 aa] {ON}
           conserved hypothetical protein
          Length = 544

 Score = 55.1 bits (131), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 40/154 (25%), Positives = 70/154 (45%), Gaps = 5/154 (3%)

Query: 97  HEYLFIISCMVSQFMSQAGLTQALSIMNILAEELNAEKSRQAWLMASFTLSMGSFILVSG 156
           H Y+ ++  MVS       +T  LS    +      E +  +W + ++ ++   FI   G
Sbjct: 22  HRYINLVLIMVSCAFDLINVTAVLSATRDIENTYQIEFTTASWALTAYAITFAGFIAFLG 81

Query: 157 RLGDIYGLKKVLLGGYAILTIWSLICGFSSYSHNDAFFITSRAFQGLGLAFVLPNSLGLI 216
           R+GDI G   + +    + +I SLIC   +  +N   F   RA QG+  A ++P+   LI
Sbjct: 82  RVGDIIGNSVLFVSSCFLFSILSLIC---AVVNNFGTFAVFRALQGIAAAGIVPSGYALI 138

Query: 217 GVIYEPGSMKKNMIIGTLGAMSP--IGATLGGLF 248
             + +   ++    I + G  +   IG  +GG F
Sbjct: 139 PTLSDEHEVQSFFAIVSCGFSTSFGIGFIIGGAF 172

>NCAS0C03460 Chr3 complement(690089..691981) [1893 bp, 630 aa] {ON} 
          Length = 630

 Score = 53.5 bits (127), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 98/400 (24%), Positives = 149/400 (37%), Gaps = 97/400 (24%)

Query: 90  KYFKNRTHEYL----FIISCMVSQFMSQAGLTQALSIMNILAEELNAEK----SRQAWLM 141
           KY KN   E L     + +C  S  ++       + I++ + E++ A+K    S+  W+ 
Sbjct: 61  KYGKNAMGEDLPSGIVLYTCAFSLALAIFLAALDIMIVSTIIEDV-AKKFGAYSKTGWIF 119

Query: 142 ASFTLSMGSFILVSGRLGDIYGLKKVLLGGYAILTIWSLICGFSSYSHNDAFFITSRAFQ 201
           A ++L      L+ GR+  I G K  +L    I  I SLI G ++ S N    I  R   
Sbjct: 120 AGYSLPNALLALLWGRIASIIGFKSCMLAAIIIFEIGSLISGVAN-SMN--MLIGGRVIA 176

Query: 202 GLG------LAFVLPNSLGLIGVIYEPGSMKKNMIIGTLGAMSPIGATLGGLFAGIIGTK 255
           G+G      LAFV+ ++L            ++ +II  + +   + + +G    G   T 
Sbjct: 177 GVGGSGIQSLAFVIGSNL--------VDERRRGLIIACMSSAFAVASVIGPFLGGAFTTH 228

Query: 256 DPKQWPWSFY--------SFGIV---------------------SFCNMILSWYSIPN-- 284
               W W FY        +F +                       FCN +     I N  
Sbjct: 229 --ATWRWCFYINLPVGGVAFALFVVFYNPQRKSLEGISILSSLKEFCNTLRQITVIKNLK 286

Query: 285 NIPT---NIYNLSMDWXXXXXXXXXXXXXNFVFNQAPIV-------------GWQSAYII 328
           N PT    +Y+L   +              F+F  A  V              W SA II
Sbjct: 287 NWPTWKSIVYSLVFRF----------DIIEFIFCSAGFVLVLLAFTFGGNQYNWSSASII 336

Query: 329 VLLVLSFCALVIFVVYE------VKYAKT-----PLIPKAISSNRGMLMILFALFCGWGA 377
           V+ V+    L++ ++Y+       K  K      PLI  +I S+ G+     ALF    A
Sbjct: 337 VMFVIGIILLIVSLLYDFVIFPRFKAVKENSLYQPLIKWSIFSHPGIFTANAALFFECTA 396

Query: 378 FGTWTFYYFSFVLNVRGYTAAWAGGSYFIFIVSGCAIATL 417
           +   T Y   F   VRG T AW    + I  V    I T 
Sbjct: 397 YICQTVYIIQFFQLVRGNT-AWKAAVHLIATVVPTVITTF 435

>Smik_6.24 Chr6 (39520..41154) [1635 bp, 544 aa] {ON} YMR279C (REAL)
          Length = 544

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 40/133 (30%), Positives = 65/133 (48%), Gaps = 5/133 (3%)

Query: 120 LSIMNILAEELNAEKSRQAWLMASFTLSMGSFILVSGRLGDIYGLKKVLLGGYAILTIWS 179
           +S+++ LA++ N   +  +W + S+ ++   FI   GRLGDI G   +     +   I S
Sbjct: 49  ISLIDDLAKKYNISYTTASWSLTSYAVTFAGFIACMGRLGDIVGNSVLFTISCSCFAILS 108

Query: 180 LICGFSSYSHNDAFFITSRAFQGLGLAFVLPNSLGLIGVIYEPGSMKKNMIIGTLGAMSP 239
           L+C   +   N   F   RA QG+  A ++P +  LI ++     ++K   I + G  S 
Sbjct: 109 LLC---AVMPNFPAFAVFRAIQGICAAGLVPCAYALIPILAPKEKVQKYFSIVSCGFSST 165

Query: 240 IGATL--GGLFAG 250
           IG  L  GG FA 
Sbjct: 166 IGLGLIIGGAFAA 178

>Skud_6.16 Chr6 (26284..27933) [1650 bp, 549 aa] {ON} YOR378W (REAL)
          Length = 549

 Score = 50.8 bits (120), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 39/132 (29%), Positives = 64/132 (48%), Gaps = 5/132 (3%)

Query: 120 LSIMNILAEELNAEKSRQAWLMASFTLSMGSFILVSGRLGDIYGLKKVLLGGYAILTIWS 179
           +S+++ LA+  N   +  +W + S+ ++   FI   GRLGDI G   +     +   + S
Sbjct: 49  ISLIDDLAKTYNISYTTASWSLTSYAVTFAGFIACMGRLGDIIGNSVLFTISCSCFAVLS 108

Query: 180 LICGFSSYSHNDAFFITSRAFQGLGLAFVLPNSLGLIGVIYEPGSMKKNMIIGTLGAMSP 239
           L+C   +   N   F   RA QG+  A ++P +  LI ++     ++K   I + G  S 
Sbjct: 109 LLC---AVMPNFPAFAVFRAIQGICAAGLVPCAYALIPILAPKEKVQKYFSIVSCGFSST 165

Query: 240 IGATL--GGLFA 249
           IG  L  GG FA
Sbjct: 166 IGLGLIIGGAFA 177

>NCAS0A07810 Chr1 complement(1554541..1556247) [1707 bp, 568 aa]
           {ON} Anc_2.473
          Length = 568

 Score = 50.8 bits (120), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 50/178 (28%), Positives = 82/178 (46%), Gaps = 23/178 (12%)

Query: 92  FKNRTHEY-------LFIISCMVSQFMSQAGLTQALSIMNILAEELNAEKSRQAWLMASF 144
            + + HEY         ++S  +  F+S    T   +IMN +AEE   E  ++ W+  SF
Sbjct: 26  LEEQYHEYNLSLPKFPILLSLWLGSFLSSLDSTIVANIMNKVAEEFE-ESDKKQWIATSF 84

Query: 145 TLSMGSFILVSGRLGDIYGLKKVLLGGYAILT---IWSLICGFSSYSHNDAFFITSRAFQ 201
            L+  +F  + G+L DI G K      +A+LT    + L C  + ++ N   F  +RA  
Sbjct: 85  LLTNTAFQPLYGKLSDITGRK------FAVLTSHFFFGLGCFLTCFAQNITQFSIARAIC 138

Query: 202 GLGLAFVLPNSLGLIGVIYEPGSMKKNMIIG----TLGAMSPIGATLGGLFAGIIGTK 255
           G+G   V  N++  I V     + ++ +  G      G    +GA LGGLF   +G +
Sbjct: 139 GIGAGGV--NAMSSITVSDICSTRERGIYQGYANIVFGLGQLLGAPLGGLFIDSVGWR 194

>YMR088C Chr13 complement(443414..445102) [1689 bp, 562 aa] {ON}
           VBA1Permease of basic amino acids in the vacuolar
           membrane
          Length = 562

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 48/157 (30%), Positives = 76/157 (48%), Gaps = 12/157 (7%)

Query: 102 IISCMVSQFMSQAGLTQALSIMNILAEELNAEKSRQAWLMASFTLSMGSFILVSGRLGDI 161
           + S  +  F+S    T   +IMN +AEE  +E S++ W+  SF L+  +F  + G+L DI
Sbjct: 39  LFSLWLGSFLSSLDSTIVANIMNRVAEEF-SESSKKQWIATSFLLTNTAFQPLYGKLSDI 97

Query: 162 YGLKKVLLGGYAILTIWSLICGFSSYSHNDAFFITSRAFQGL---GLAFVLPNSLGLIGV 218
            G K  LL        + L C  + ++ N   F  +RA  G+   GL  +   ++  I  
Sbjct: 98  TGRKSALLTAQF---FFGLGCLLTCFARNVTEFSIARAICGIGAGGLNAISSIAVSDICT 154

Query: 219 IYEPGSMK--KNMIIGTLGAMSPIGATLGGLFAGIIG 253
             E G  +   N++ G  G +  +GA LGG+F   IG
Sbjct: 155 ARERGVYQGYANIVFG-FGQL--LGAPLGGVFIETIG 188

>Suva_10.11 Chr10 (18934..20556) [1623 bp, 540 aa] {ON} YOR378W
           (REAL)
          Length = 540

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 39/133 (29%), Positives = 64/133 (48%), Gaps = 5/133 (3%)

Query: 120 LSIMNILAEELNAEKSRQAWLMASFTLSMGSFILVSGRLGDIYGLKKVLLGGYAILTIWS 179
           +S+++ LA++ +   +  +W + S+ ++   FI   GRLGDI G   +         I S
Sbjct: 49  ISLIDDLAQKYDISYTTASWSLTSYAVTFAGFIAFMGRLGDIVGNSILFTVSCFFFAILS 108

Query: 180 LICGFSSYSHNDAFFITSRAFQGLGLAFVLPNSLGLIGVIYEPGSMKKNMIIGTLGAMSP 239
           L+C   +   N   F   RA QG+  A ++P +  LI ++     ++K   I + G  S 
Sbjct: 109 LLC---AVMPNFPAFAVFRAIQGISAAGLVPCAYALIPMLAPEEEVQKYFSIVSCGFSST 165

Query: 240 IGATL--GGLFAG 250
           IG  L  GG FA 
Sbjct: 166 IGLGLIIGGAFAA 178

 Score = 32.0 bits (71), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 34/165 (20%), Positives = 69/165 (41%), Gaps = 15/165 (9%)

Query: 417 LCGFMMKKVPPSVILYISMIGFMGGCVMLT-VTPIHQSYFQNI-LGIMFVLPIGIDLSFP 474
           LC F   K+ P V + +     + G ++LT +  I +  F  I      ++  G+ + +P
Sbjct: 367 LCAFESTKLKPKVGVVLGFSLALAGSIILTQLHLIKEDMFWKIFFSSQALVGFGVAIFYP 426

Query: 475 AASIILSDALPIQYQGMAGSLVYTI----TNYSTSICLGMAGSVEAYHNDNG--QNILKG 528
            A  I     P + +G+A  +  T        + S+   + G+++     +G  Q    G
Sbjct: 427 YALQIAVGGAPDRSKGIASGVAQTFGQLGIEITFSVMASVLGNIDGIRGKSGASQKFRTG 486

Query: 529 YRNAMIFADALAGLGIIVSGIYMVINLITIRENSKSTNKPKHLET 573
           ++N   F  A+  LG +V+       L  +++    T+    +E+
Sbjct: 487 FQNCTYFTVAVGALGFLVT-------LFGLKDTRPPTDDISDVES 524

>Suva_13.265 Chr13 complement(424929..426614) [1686 bp, 561 aa] {ON}
           YMR088C (REAL)
          Length = 561

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 48/174 (27%), Positives = 80/174 (45%), Gaps = 17/174 (9%)

Query: 93  KNRTHEY-------LFIISCMVSQFMSQAGLTQALSIMNILAEELNAEKSRQAWLMASFT 145
           + + HEY         + S  +  F+S    T   +IMN +AEE  +E S++ W+  SF 
Sbjct: 23  EQKYHEYNLALPKFPILFSLWLGSFLSSLDSTIVANIMNRVAEEF-SESSKKQWIATSFL 81

Query: 146 LSMGSFILVSGRLGDIYGLKKVLLGGYAILTIWSLICGFSSYSHNDAFFITSRAFQGLGL 205
           L+  +F  + G+L DI G +  LL        + L C  + ++ N   F  +RA  G+G 
Sbjct: 82  LTNTAFQPLYGKLSDIIGRRPALLTAQF---FFGLGCLMTCFARNVTEFSIARAVCGIGA 138

Query: 206 AFVLPNSLGLIGVIYEPGSMKKNMIIG----TLGAMSPIGATLGGLFAGIIGTK 255
             +  N++  I V     + ++ +  G      G    +GA LGG+F   IG +
Sbjct: 139 GGL--NAISSIAVSDICTARERGVYQGYANIVFGFGQLLGAPLGGIFIETIGWR 190

>Skud_13.244 Chr13 complement(417271..418959) [1689 bp, 562 aa] {ON}
           YMR088C (REAL)
          Length = 562

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 49/173 (28%), Positives = 79/173 (45%), Gaps = 17/173 (9%)

Query: 94  NRTHEYLF-------IISCMVSQFMSQAGLTQALSIMNILAEELNAEKSRQAWLMASFTL 146
            + HEY         + S  +  F+S    T   +IMN +AE+  +E SR+ W+  SF L
Sbjct: 24  QKYHEYNLALPKFPILFSLWLGSFLSSLDSTIVANIMNRVAEDF-SESSRKQWIATSFLL 82

Query: 147 SMGSFILVSGRLGDIYGLKKVLLGGYAILTIWSLICGFSSYSHNDAFFITSRAFQGLGLA 206
           +  +F  + G+L DI G K  LL        + L C  + ++ N   F  +RA  G+G  
Sbjct: 83  TNTAFQPLYGKLSDITGRKSALLIAQF---FFGLGCLLTCFARNVTEFSIARAICGIGAG 139

Query: 207 FVLPNSLGLIGVIYEPGSMKKNMIIG----TLGAMSPIGATLGGLFAGIIGTK 255
            +  N++  I V     + ++ +  G      G    +GA LGG+F   IG +
Sbjct: 140 GL--NAISSIAVSDICTARERGVYQGYANIVFGFGQLLGAPLGGVFIETIGWR 190

>NDAI0H02200 Chr8 complement(536385..538100) [1716 bp, 571 aa] {ON} 
           YGR224W
          Length = 571

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 47/159 (29%), Positives = 74/159 (46%), Gaps = 16/159 (10%)

Query: 104 SCMVSQFMSQAGLTQALSIMNILAEELNAEKSRQAWLMASFTLSMGSFILVSGRLGDIYG 163
           S  +  F S    T   +IMN +AEE  AE  ++ W+  SF L+  +F  + G+L DI G
Sbjct: 48  SLWLGSFFSSLDSTIVANIMNRVAEEF-AESDKKQWIATSFLLTNTAFQPLYGKLSDITG 106

Query: 164 LKKVLLGGYAILT---IWSLICGFSSYSHNDAFFITSRAFQGLGLAFVLPNSLGLIGVIY 220
            K      +A+LT    + L C  + ++ N   F  +RA  G+G   +  N++  I    
Sbjct: 107 RK------FAVLTAHFFFGLGCLLTCFAQNVTQFSIARAICGMGAGGI--NAMSSITTSD 158

Query: 221 EPGSMKKNMIIG----TLGAMSPIGATLGGLFAGIIGTK 255
              + ++ +  G      G    +GA LGGLF   IG +
Sbjct: 159 ICTTRERGIFQGYANIVFGMGQVLGAPLGGLFLDHIGWR 197

>NDAI0D01020 Chr4 complement(229357..231135) [1779 bp, 592 aa] {ON} 
          Length = 592

 Score = 47.8 bits (112), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 53/225 (23%), Positives = 102/225 (45%), Gaps = 21/225 (9%)

Query: 78  ENLQSENKVLSPKYFKNRTHEYLFIISCMVSQFMSQAGLTQALSIMNILAEELNAEKSRQ 137
           E L+  ++  +P    +   ++  +   ++  F S  G       +  L +E N ++++ 
Sbjct: 80  EKLEQTSESTAPYTLLSYKQKWGMVFLLVMCGFWSSLGSPIYYPALRQLEKEFNMDENKV 139

Query: 138 AWLMASFTLSMGSFILVSGRLGDIYGLKKVLLGGYAILTIWS--LICGFSSYSHNDAFFI 195
              +  + L  G    VSG L D++G + ++LGG  I  + S  L C   + S+    F+
Sbjct: 140 NVTVVVYLLFQGIAPTVSGGLADVFGRRPIILGGMVIYVVASIGLAC---APSYGVICFL 196

Query: 196 TSRAFQGLGLAFVLPNSLGLIG---VIYEPGSMKKNMIIGTLGAMSPIGATLGGLFAGII 252
             R  Q +G++  +  S G++G   + +E G+         +GA S +   LG  F  +I
Sbjct: 197 --RCIQSIGISPTIAISSGVVGDFTLKHERGTF--------VGATSGL-VLLGQCFGSLI 245

Query: 253 GTKDPKQWPWS--FYSFGIVSFCNMILSWYSIPNNIPTNIYNLSM 295
           G     +W W   F+   I S   +I++ +++P    T + NLS+
Sbjct: 246 GAVLTARWDWRAIFWFLAIGSGVALIVAAFTLPETKRTIVGNLSI 290

>TPHA0M00120 Chr13 (23458..25317) [1860 bp, 619 aa] {ON} 
          Length = 619

 Score = 47.8 bits (112), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 38/52 (73%), Gaps = 1/52 (1%)

Query: 322 WQSAYIIVLLVLSFC-ALVIFVVYEVKYAKTPLIPKAISSNRGMLMILFALF 372
           WQ+A+IIV  V+ +C AL +F+++E+K+++ PL P A+  +RG++  +F  F
Sbjct: 312 WQTAHIIVPEVIGWCLALPLFLLWEIKFSRHPLTPWALIKDRGIIFAIFIAF 363

>Kpol_467.24 s467 (55523..56632) [1110 bp, 370 aa] {ON}
           (55523..56632) [1110 nt, 370 aa]
          Length = 370

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 49/161 (30%), Positives = 80/161 (49%), Gaps = 12/161 (7%)

Query: 98  EYLFIISCMVSQFMSQAGLTQALSIMNILAEELNAEKSRQAWLMASFTLSMGSFILVSGR 157
           ++  ++S  +  F+S    T   +IMN +AEE    + +Q W+  SF L+  +F  + G+
Sbjct: 33  KFPILVSLWLGSFLSSIDSTIVANIMNKVAEEFQESQEKQ-WIATSFLLTNTAFQPLYGK 91

Query: 158 LGDIYGLKKVLLGGYAILTIWSLICGFSSYSHNDAFFITSRAFQGLGLAF---VLPNSLG 214
           L DI G K  LL     L+ + L C  +S S N   F  +RA  G+G      +   ++G
Sbjct: 92  LSDITGRKFALLTA---LSFFGLGCFLTSLSTNIKQFAIARAICGIGGGGINAISSITVG 148

Query: 215 LIGVIYEPGSMK--KNMIIGTLGAMSPIGATLGGLFAGIIG 253
            I    + G  +   N++ G +G +  +GA +GGLF   IG
Sbjct: 149 DICTAKDRGIYQGYANIVFG-MGQL--LGAPVGGLFIATIG 186

>Smik_16.81 Chr16 complement(152022..153515,153516..153899) [1878
           bp, 625 aa] {ON} YGR224W (REAL)
          Length = 625

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 54/237 (22%), Positives = 97/237 (40%), Gaps = 34/237 (14%)

Query: 35  ESKERKDYFQLKKNYSQDSQTNTSMNEVIGXXXXXXXXXXXXXENLQSENKVLSPKYFKN 94
            SKE K   + K+ ++ D +   + +E                E    E+ V        
Sbjct: 11  HSKEAKQQHEQKRQFAVDQKFAHTSSE--------------HDETSIPEDNVKKNVELSK 56

Query: 95  RTHEYLFIISCMVSQFMSQAGLTQALSIMNILAEELNAEKSRQAWLMASFTLSMGSFILV 154
            +  Y+ +++  +S F++   +    +I+  +A++L +  S   WL   ++L     +L+
Sbjct: 57  GSILYVSLVAVALSLFLAALDVMIVSTIIEEVAKQLGSY-SEIGWLFTGYSLPNALLVLI 115

Query: 155 SGRLGDIYGLKKVLLGGYAILTIWSLICGFSSYSHNDAFFITSRAFQGLG------LAFV 208
            GR+    G K  +L    I  I SLI   +S S N    I  R   G+G      L+FV
Sbjct: 116 WGRIATPIGFKATMLFAIVIFEIGSLISALAS-SMN--MLIGGRVIAGIGGCGIQSLSFV 172

Query: 209 LPNSLGLIGVIYEPGSMKKNMIIGTLGAMSPIGATLGGLFAGIIGTKDPKQWPWSFY 265
           + ++L     + E    K+ M+I  L +   I + +G    G+  +     W W FY
Sbjct: 173 IGSTL-----VEES---KRGMLIAILSSSFAIASVVGPFLGGVFTSS--VTWRWCFY 219

>Kpol_358.4 s358 complement(9458..11311) [1854 bp, 617 aa] {ON}
           complement(9458..11311) [1854 nt, 618 aa]
          Length = 617

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 36/52 (69%), Gaps = 1/52 (1%)

Query: 322 WQSAYIIVLLVLSFC-ALVIFVVYEVKYAKTPLIPKAISSNRGMLMILFALF 372
           W++A+IIV  V+ +C AL IF+++E+K++K PL P A+  +RG+   L   F
Sbjct: 316 WKTAHIIVPEVIGWCVALPIFLLWEIKFSKVPLTPWALIKDRGIFFALVIAF 367

>NDAI0B03770 Chr2 complement(947945..949660) [1716 bp, 571 aa] {ON} 
          Length = 571

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 58/273 (21%), Positives = 105/273 (38%), Gaps = 18/273 (6%)

Query: 26  ETLDIDATPESKERKDYFQLKKNYSQDSQTNTSMNEVIGXXXXXXXXXXXXXENLQSENK 85
           E   +D TP S +   Y    ++Y  D    +    VI              ++ Q+E  
Sbjct: 10  EQEKVDITPRSSD--GYTHKVRSYHNDDDDES----VINISDINPKNQLCQTKSNQNEPD 63

Query: 86  VLSPKYFK-NRTHEYLFIISCMVSQFMSQAGLTQALSIMNILAEELNAEKSRQAWLMASF 144
           + SP Y +   T + + +I C  + F S         +++++  E N  +      +  +
Sbjct: 64  IASPPYSRFGTTEKMILVIQCAFTGFFSSIAGAIYYPVLSVIENEFNITEEMVNITVVVY 123

Query: 145 TLSMGSFILVSGRLGDIYGLKKVLLGGYAILTIWSLICGFSSYSHNDAFFITSRAFQGLG 204
            +  G    + G L D  G + V+L     + ++   C   + SH  A  I  R  Q  G
Sbjct: 124 FIFQGIAPSIMGGLADSMGRRPVVLSS---VLVYCCACIGLACSHTYAQIIVLRCLQAAG 180

Query: 205 LAFVLPNSLGLIGVIYEPGSMKKNMIIGTLGAMSPIGATLGGLFAGIIGTKDPKQWPWS- 263
           ++ V+  + G++G I      ++   +G +     IG+  G L    IG      W W  
Sbjct: 181 ISPVIAINSGIMGDITT--RAERGGYVGYVSGFQVIGSAFGAL----IGAGLSATWSWRS 234

Query: 264 -FYSFGIVSFCNMILSWYSIPNNIPTNIYNLSM 295
            F+   I S   ++ S   +P    T + N S+
Sbjct: 235 IFWFLAIGSGVCLVASIIILPETKRTVVGNGSI 267

>TDEL0G03260 Chr7 (605429..607267) [1839 bp, 612 aa] {ON} 
          Length = 612

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 38/167 (22%), Positives = 75/167 (44%), Gaps = 8/167 (4%)

Query: 99  YLFIISCMVSQFMSQAGLTQALSIMNILAEELNAEKSRQAWLMASFTLSMGSFILVSGRL 158
           Y  +IS ++S F++   +    +I+  +A E   + S+  W+ A ++L      L+ GR+
Sbjct: 55  YACVISLILSIFLAALDIMIVSTIIENVAREF-GDYSKTGWIYAGYSLPSALLTLIWGRI 113

Query: 159 GDIYGLKKVLLGGYAILTIWSLICGFSSYSHNDAFFITSRAFQGLGLAFVLPNSLGLIGV 218
             + G K  +L    I  + SL+   ++ +++    I  R   GLG + +      +I  
Sbjct: 114 AAVCGFKSSMLTAIIIFEVGSLV---AALANSMDMLIGGRVIAGLGGSGIQTLCFVIIST 170

Query: 219 IYEPGSMKKNMIIGTLGAMSPIGATLGGLFAGIIGTKDPKQWPWSFY 265
           + E    K+ ++I  +G+   I + +G    G   T     W W F+
Sbjct: 171 LVEES--KRGLLIACMGSAFGIASVVGPFLGGAFTTH--VTWRWCFW 213

>ZYRO0C01430g Chr3 complement(101140..102912) [1773 bp, 590 aa] {ON}
           weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 590

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 77/296 (26%), Positives = 129/296 (43%), Gaps = 20/296 (6%)

Query: 110 FMSQAGLTQALSIMNILAEELNAEKSRQAWLMASFTLSMGSFILVSGRLGDIYGLKKVLL 169
           F++ A  T   +IM  +A E N E  R +W+  ++ LS  +F  + G+L DI+G K +L+
Sbjct: 90  FLAAADGTLVSTIMAHIASEFN-ELPRISWIATAYLLSSATFQPLYGKLSDIFGRKPLLM 148

Query: 170 GGYAILTIWSLICGF--SSYSHNDAFFITSRAFQGLGLAFVLPNSLGLIGVIYEPGSMKK 227
               +  +  L+CG   S +    A FI+     G G+  +   ++  I V     ++ +
Sbjct: 149 LNNIVFLVGCLMCGLTPSFWGLVGARFIS--GIGGGGVTSMCSITISDI-VPLRDRALYQ 205

Query: 228 NMIIGTLGAMSPIGATLGGLFAGIIGTKDPK---QWPWSFYSFGIVSFCNMILSWYSIPN 284
            M     G  +  G  +GG F+   G        Q P S  S  +++   M L   S   
Sbjct: 206 GMCNFFFGLGTACGGVVGGWFSDHGGGWRMAFLIQVPLSALSSLLIAVF-MKLPPRSKRV 264

Query: 285 NIPTNIYN--LSMDWXXXXXXXXXXXXXNFVFNQA---PIVGWQSAYIIVLLVLSFCALV 339
           N P +I N  LS+DW              F+   +     + + S   + L + S  A  
Sbjct: 265 NSPASIKNKLLSVDWIGASALVVFLSL--FLVTASLGGKEIAFNSKTFVALCIGSSLACA 322

Query: 340 IFVVYEVKYAKTPLIPKAISSNRGMLMILFALFCGWGAFGTWTFY---YFSFVLNV 392
            F+  E+  AK P++P +   NR +L   F+ +    A  T ++Y   Y+S VLN+
Sbjct: 323 FFIGVELYGAKDPILPLSFLRNRSVLGSSFSNWFCMMAMMTTSYYLPIYYSGVLNM 378

 Score = 39.7 bits (91), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 39/147 (26%), Positives = 68/147 (46%), Gaps = 20/147 (13%)

Query: 430 ILYISMIGFMGGCVMLTVTPIHQSYFQNILGIMFVLPIGIDLSFPAASIILSDALPIQ-- 487
           +L ++ I F+ GC+M  +TP     F  ++G  F+  IG        SI +SD +P++  
Sbjct: 146 LLMLNNIVFLVGCLMCGLTP----SFWGLVGARFISGIGGGGVTSMCSITISDIVPLRDR 201

Query: 488 --YQGMAGSLVYTITNYSTSICLGMAGSVEAYHNDNGQNILKGYRNAMIFADALAGLGII 545
             YQGM         N+   +     G V  + +D+G     G+R A +    L+ L  +
Sbjct: 202 ALYQGMC--------NFFFGLGTACGGVVGGWFSDHGG----GWRMAFLIQVPLSALSSL 249

Query: 546 VSGIYMVINLITIRENSKSTNKPKHLE 572
           +  ++M +   + R NS ++ K K L 
Sbjct: 250 LIAVFMKLPPRSKRVNSPASIKNKLLS 276

>KLLA0F13684g Chr6 complement(1267367..1269082) [1716 bp, 571 aa]
           {ON} similar to uniprot|Q04301 Saccharomyces cerevisiae
           YMR088C VBA1 Permease of basic amino acids in the
           vacuolar membrane
          Length = 571

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 30/101 (29%), Positives = 51/101 (50%), Gaps = 4/101 (3%)

Query: 104 SCMVSQFMSQAGLTQALSIMNILAEELNAEKSRQAWLMASFTLSMGSFILVSGRLGDIYG 163
           S  +  F+     T   +IMN +AEE   E  ++ W++ SF L+  +F  + G+L D+ G
Sbjct: 45  SLWMGSFLGSLDSTIVANIMNKVAEEFE-ESDKKQWIVTSFLLTNTAFQPLYGKLSDLAG 103

Query: 164 LKKVLLGGYAILTIWSLICGFSSYSHNDAFFITSRAFQGLG 204
            K  L+  ++   +    C F++ S N   F  +RA  G+G
Sbjct: 104 RKTALMVAHSFFLVG---CLFTALSRNLVEFSIARAVCGMG 141

>YPR198W Chr16 (934034..935665) [1632 bp, 543 aa] {ON}  SGE1Plasma
           membrane multidrug transporter of the major facilitator
           superfamily, acts as an extrusion permease; partial
           multicopy suppressor of gal11 mutations
          Length = 543

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 47/153 (30%), Positives = 70/153 (45%), Gaps = 31/153 (20%)

Query: 138 AWLMASFTLSMGSFILVSGRLGDIYGLKKVLLGGYAILTIWSLICGFSSYSHNDAFFITS 197
            WL+  + LS   F+L+ GRL +I G K+ L+    +  I SLI   S+ S++ A  I+ 
Sbjct: 46  GWLVTGYALSNAVFMLLWGRLAEILGTKECLMISVIVFEIGSLI---SALSNSMATLISG 102

Query: 198 RAFQGLG------LAFVLPNSLGLIGVIYE--PGSMKKNMIIGTLGAMSPIGATLGGLFA 249
           R   G G      LAFV+  S     ++ E   G M   + I  + A   +G  +GG F 
Sbjct: 103 RVVAGFGGSGIESLAFVVGTS-----IVRENHRGIMITALAISYVIA-EGVGPFIGGAF- 155

Query: 250 GIIGTKDPKQWPWSFY--------SFGIVSFCN 274
                 +   W W FY        +F I++FCN
Sbjct: 156 -----NEHLSWRWCFYINLPIGAFAFIILAFCN 183

>TDEL0F03990 Chr6 (740471..742366) [1896 bp, 631 aa] {ON} Anc_8.272
           YDR119W
          Length = 631

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 88/409 (21%), Positives = 166/409 (40%), Gaps = 37/409 (9%)

Query: 126 LAEELNAEKSRQAWLMASFTLSMGSFILVSGRLGDIYGLKKVLLGGYAILTIWSLICGFS 185
           +A E N + S+ +W+  S+ LS  +F  + G++ DI+G K +L+       I  L+CG S
Sbjct: 138 VASEFN-QLSKVSWIATSYLLSSATFQPLYGKVSDIFGRKCLLVFTNVAFLIGCLMCGLS 196

Query: 186 SYSHNDAFFITSRAFQGLGLAFVLPNSLGLIGVIYEPGSMKKNMIIGTLGAMSPIGATLG 245
               +  + + +R   G+G   +   S+  I +       ++ M  G       +G   G
Sbjct: 197 ---KSFWWLVIARFVAGVGGGGL--TSMSSITITDLVPLRERAMYQGICNVFYGLGTACG 251

Query: 246 GLFAGIIGTKDPKQWPWSFY---SFGIVSFCNMILSWYSIPNNIPTNIYN-------LSM 295
           G+  G   + +   W  +F        +S   +IL    +P+   T   +       L++
Sbjct: 252 GIVGGWF-SDNKGGWRMAFLIQVPLSAISLLVIILH-LKLPSKRATRNQDNSIKRKLLAI 309

Query: 296 DWXXXXXXXXXXXXXNFVFNQAPIVGWQSAY----IIVLLVLSFCALVIFVVYEVKYAKT 351
           DW                   A + G + AY      ++L+ S  + ++F+  E++ A  
Sbjct: 310 DWLGASTLVIFLVLFLLT---ASLGGKEIAYGSRTFALMLISSLLSCLVFIYVELRVAAD 366

Query: 352 PLIPKAISSNRGML-MILFALFCGWGAFGTWTFY---YFSFVLNVRGYTAAWAGGSYFIF 407
           P++P    + R +L   L   FC      T ++Y   YFS VLN+            F  
Sbjct: 367 PILPLRFLAIRSVLGSSLSNWFCMMATMTT-SYYLPIYFSGVLNMSPTDVGKRLMPNFFS 425

Query: 408 IVSGCAIATLCGFMMKKVPPS--VILYISMIGFMGGCVMLTVTPIHQSYFQNILGIMFVL 465
           +  G   A   G+ MKK        L    +  +G   +L + P   ++ Q IL  + V 
Sbjct: 426 VAFGSLGA---GYYMKKTRKYYWFSLIFCAVAVLGQLQILLIDPKIPTWRQYIL--LLVP 480

Query: 466 PIGIDLSFPAASIILSDALPIQYQGMAGSLVYTITNYSTSICLGMAGSV 514
            +G  +    A + +  A+P ++Q    S+ Y   +   ++ + + G++
Sbjct: 481 GVGTSVLITVALLAMIAAVPHEHQAATTSISYAFRSAGCTLGVSIGGAI 529

>Suva_9.71 Chr9 (129275..130960) [1686 bp, 561 aa] {ON} YIL121W
           (REAL)
          Length = 561

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 46/211 (21%), Positives = 91/211 (43%), Gaps = 11/211 (5%)

Query: 87  LSPKYFKNRTHEYLFIISCMVSQFMSQAGLTQALSIMNILAEELNAEKSRQAWLMASFTL 146
           L P    + T + L ++ C  + F S    +    ++ ++ ++ N  +      +  + +
Sbjct: 53  LEPYSRFSHTQKMLLVVQCAFTGFFSTVAGSIYYPVLTVIEKKFNITEELANVTIVVYFV 112

Query: 147 SMGSFILVSGRLGDIYGLKKVLLGGYAILTIWSLICGFSSYSHNDAFFITSRAFQGLGLA 206
             G    + G L D +G + V+L  +A+LT      G +S SHN A  +  R  Q  G++
Sbjct: 113 FQGLAPSIMGGLADTFGRRPVVL--WAVLTYCCACIGLAS-SHNYAQILALRCLQAAGIS 169

Query: 207 FVLPNSLGLIGVIYEPGSMKKNMIIGTLGAMSPIGATLGGLFAGIIGTKDPKQWPWS--F 264
            V+  + G++G +     +++   +G +     +G   G L    IG     +W W   F
Sbjct: 170 PVIAINSGIMGDVTT--KVERGGYVGLVSGFQVVGTAFGAL----IGAGLSSRWGWRAIF 223

Query: 265 YSFGIVSFCNMILSWYSIPNNIPTNIYNLSM 295
           +   I S   +++S   +P    T + N S+
Sbjct: 224 WFLAIGSGICLVVSALLLPETKRTLVGNGSI 254

>KLTH0G09504g Chr7 complement(792202..794076) [1875 bp, 624 aa] {ON}
           similar to uniprot|P39980 Saccharomyces cerevisiae
           YEL065W SIT1 Ferrioxamine B transporter member of the
           ARN family of transporters that specifically recognize
           siderophore-iron chelates transcription is induced
           during iron deprivation and diauxic shift potentially
           phosphorylated by Cdc28p
          Length = 624

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 36/52 (69%), Gaps = 1/52 (1%)

Query: 322 WQSAYIIVLLVLSFC-ALVIFVVYEVKYAKTPLIPKAISSNRGMLMILFALF 372
           W++A IIV  V+ +C AL +FV++E K+A+ PL P+++  +RG++  L   F
Sbjct: 297 WRTAQIIVPEVIGWCVALPLFVLWEAKFARFPLTPRSVLKDRGVIAALVIAF 348

>Ecym_7399 Chr7 complement(820280..821971) [1692 bp, 563 aa] {ON}
           similar to Ashbya gossypii ABL040W
          Length = 563

 Score = 44.7 bits (104), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 43/161 (26%), Positives = 78/161 (48%), Gaps = 16/161 (9%)

Query: 102 IISCMVSQFMSQAGLTQALSIMNILAEELNAEKSRQAWLMASFTLSMGSFILVSGRLGDI 161
           ++S  ++ F++    T   +IMN + EE   E  R  W+  SF L+   F  + G+L D+
Sbjct: 50  LLSLWMANFLASMDRTIIANIMNSVTEEFK-ESHRIQWVATSFLLTSTVFQPIYGKLSDV 108

Query: 162 YGLKKVLLGGYAILTIWSLICGFSSYSHNDAFFITSRAFQGLGLAFVLPNSLGLIGVIYE 221
            G + VL+  Y++     L C  ++Y+ N   F   RA  G+G   +    +  +G ++ 
Sbjct: 109 TGRRFVLVLAYSLFL---LGCLVTAYARNIWEFAFGRAICGIGAGGIPTMCVITMGDMF- 164

Query: 222 PGSMKKN-------MIIGTLGAMSPIGATLGGLFAGIIGTK 255
             S+K+         II T+G +  +GA +GG+    +G +
Sbjct: 165 --SVKEQSIYQSYAHIIYTIGEV--LGAPIGGIALETVGWR 201

>KLTH0H16214g Chr8 complement(1398230..1399885) [1656 bp, 551 aa]
           {ON} conserved hypothetical protein
          Length = 551

 Score = 44.3 bits (103), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 30/111 (27%), Positives = 50/111 (45%), Gaps = 11/111 (9%)

Query: 120 LSIMNILAEELNAEKSRQAWLMASFTLSMGSFILVSGRLGDIYGLKKVLLGGYAILTI-- 177
           +S++  L E    E +  +W + S+ ++    I   GRLGDI       +G   + TI  
Sbjct: 52  ISVIEDLGETYGLEYTTASWALTSYAITFAGLIAFMGRLGDI-------IGNSVLFTISG 104

Query: 178 --WSLICGFSSYSHNDAFFITSRAFQGLGLAFVLPNSLGLIGVIYEPGSMK 226
             +SL C   +   N   F   RA QG+  A ++P    LI  + +P  ++
Sbjct: 105 FFFSLFCLLCAVVTNFPAFAVLRALQGIAAAGLVPCGYALIPTLADPEDVQ 155

>Suva_5.2 Chr5 (3340..5223) [1884 bp, 627 aa] {ON} YEL065W (REAL)
          Length = 627

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 36/52 (69%), Gaps = 1/52 (1%)

Query: 322 WQSAYIIVLLVLSFC-ALVIFVVYEVKYAKTPLIPKAISSNRGMLMILFALF 372
           W++A+IIV  V+ +  AL +++V+EVKY++ PL P  +  +RG+L  LF  F
Sbjct: 312 WKAAHIIVPEVIGWVVALPLYMVWEVKYSRHPLTPWDLIKDRGVLFALFIAF 363

>TDEL0A02490 Chr1 (446429..448093) [1665 bp, 554 aa] {ON} Anc_2.473
           YMR088C
          Length = 554

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 49/149 (32%), Positives = 72/149 (48%), Gaps = 12/149 (8%)

Query: 110 FMSQAGLTQALSIMNILAEELNAEKSRQAWLMASFTLSMGSFILVSGRLGDIYGLKKVLL 169
           F+S    T   +IMN +AEE  +E  ++ W+  SF L+  +F  + G+L D+ G K  LL
Sbjct: 46  FVSSLDGTIVANIMNRVAEEF-SESDKKQWIATSFLLTNTAFQPLYGKLSDVTGRKFALL 104

Query: 170 GGYAILTIWSLICGFSSYSHNDAFFITSRAFQGLGLAFVLPNS---LGLIGVIYEPGSMK 226
             Y  L I    C  +  + N   F  +RA  G+G   +   S   +  I    E G  +
Sbjct: 105 MAYFFLVIG---CLLTCLARNVTEFAVARAICGIGGGGINACSSITVSDICTAKERGIYQ 161

Query: 227 --KNMIIGTLGAMSPIGATLGGLFAGIIG 253
              N++ G +G M  +GA LGGLF   IG
Sbjct: 162 GYANIVFG-MGQM--LGAPLGGLFIDTIG 187

>SAKL0E02992g Chr5 complement(243652..245364) [1713 bp, 570 aa] {ON}
           similar to uniprot|Q04301 Saccharomyces cerevisiae
           YMR088C VBA1 Permease of basic amino acids in the
           vacuolar membrane
          Length = 570

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 34/124 (27%), Positives = 57/124 (45%), Gaps = 6/124 (4%)

Query: 78  ENLQSENKVLSPKYFKNRTH--EYLFIISCMVSQFMSQAGLTQALSIMNILAEELNAEKS 135
           +    +N  L  +Y K+     +   + S  +  F+     T   +IMN +AEE   E  
Sbjct: 28  DEFNRKNSSLEEEYHKHNLDLPKLPIVFSLWMGSFLGALDGTIVANIMNRVAEEFQ-ESD 86

Query: 136 RQAWLMASFTLSMGSFILVSGRLGDIYGLKKVLLGGYAILTIWSLICGFSSYSHNDAFFI 195
           ++ W+  SF L+  +F  + G+L DI G K  LL  +   T + L C  + ++ N   F 
Sbjct: 87  KKQWIATSFLLTNTAFQPLYGKLSDITGRKFALLVAH---TFFCLGCLLTCFARNVTEFS 143

Query: 196 TSRA 199
            +RA
Sbjct: 144 IARA 147

>Kpol_416.5 s416 (23208..25031) [1824 bp, 607 aa] {ON}
           (23208..25031) [1824 nt, 608 aa]
          Length = 607

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 54/201 (26%), Positives = 93/201 (46%), Gaps = 13/201 (6%)

Query: 322 WQSAYIIVLLVLSFC-ALVIFVVYEVKYAKTPLIPKAISSNRG----MLMILFALFCGWG 376
           W +A IIV  VL +  AL +F+V+E+K+A+ PL PK    NRG    ++++LF  F    
Sbjct: 301 WSTARIIVPEVLGWAFALPLFLVWEIKFARYPLTPKDALKNRGIVSALVLVLFLQF---- 356

Query: 377 AFGTWTFYYFSFVLNVRGYTAAWAGGSYFIFIVSGCAIATLCGFMMKKVPPSVILYISMI 436
           A+   + Y ++ +L     +   A     +F         L GF++ KV  +       I
Sbjct: 357 AYQMQSTYLYTVLLVAVDESKKSATRINKLFSFVSVITGFLSGFVVAKVRRTKEFIFFGI 416

Query: 437 G--FMGGCVMLTVTPIHQSYFQNILGIMFVLPIGID-LSFPAASIILSDALPIQYQGMAG 493
           G  F+   +M+  T    S+   I+    +L  G   L FPA + I + A   +   +  
Sbjct: 417 GVWFISFGLMIRYTGGLDSHV-GIIVARCILGFGNGFLKFPARASIQASAYSHEMMAVMT 475

Query: 494 SLVYTITNYSTSICLGMAGSV 514
           SL   +++  ++    +AGS+
Sbjct: 476 SLFLAVSSIGSAFGDAVAGSI 496

>Kwal_23.5241 s23 (1071768..1073543) [1776 bp, 591 aa] {ON} YEL065W
           (SIT1) - Ferrioxamine B permease [contig 8] FULL
          Length = 591

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/44 (45%), Positives = 33/44 (75%), Gaps = 1/44 (2%)

Query: 322 WQSAYIIVLLVLSFC-ALVIFVVYEVKYAKTPLIPKAISSNRGM 364
           WQ+A IIV  V+ +C AL +F+++E+K+AK PL+P  +  +RG+
Sbjct: 285 WQTAEIIVPEVIGWCVALPLFLLWEMKFAKHPLVPWNVIKDRGI 328

>CAGL0J01375g Chr10 (127843..129537) [1695 bp, 564 aa] {ON} similar
           to uniprot|Q04301 Saccharomyces cerevisiae YMR088c
          Length = 564

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 45/183 (24%), Positives = 85/183 (46%), Gaps = 18/183 (9%)

Query: 82  SENKVLSPKYFKNRTH--EYLFIISCMVSQFMSQAGLTQALSIMNILAEELNAEKSRQAW 139
           +E   L  +Y ++     +   ++S  +  F+S    T   +IMN +AEE   E  ++ W
Sbjct: 18  TEQDALEQEYHEHNLSLPKLPIVLSLWLGSFLSSLDGTIVANIMNRVAEEFQ-ESDKKQW 76

Query: 140 LMASFTLSMGSFILVSGRLGDIYGLKKVLLGGYAILT---IWSLICGFSSYSHNDAFFIT 196
           +  S+ L+  +F  + G+L D+ G K      +A+LT    + L C  + ++++   F  
Sbjct: 77  IATSYLLTNTAFQPLYGKLSDLTGRK------FAVLTAHFFFGLGCLLTCFANSVTQFAI 130

Query: 197 SRAFQGLGLAFVLPNSLGLIGVIYEPGSMKKNMIIG----TLGAMSPIGATLGGLFAGII 252
           +RA  G+G   +  N++  I V       ++ +  G      G    +GA +GGLF   +
Sbjct: 131 ARAICGVGGGGI--NAMSSITVSDICTQRERGIYQGYANIVFGLGQILGAPIGGLFIDTL 188

Query: 253 GTK 255
           G +
Sbjct: 189 GWR 191

>Kwal_23.4853 s23 complement(895045..896856) [1812 bp, 603 aa] {ON}
           YEL065W (SIT1) - Ferrioxamine B permease [contig 5] FULL
          Length = 603

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 32/45 (71%), Gaps = 1/45 (2%)

Query: 322 WQSAYIIVLLVLSFC-ALVIFVVYEVKYAKTPLIPKAISSNRGML 365
           W+SA+IIV  V+ +C A  +FV++E KYA+ PL P  +  +RG++
Sbjct: 288 WKSAHIIVPEVIGWCVAFPLFVLWEKKYARHPLTPWRLLKDRGVI 332

>KAFR0J00930 Chr10 (168674..170374) [1701 bp, 566 aa] {ON} Anc_2.242
           YNL065W
          Length = 566

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 54/273 (19%), Positives = 104/273 (38%), Gaps = 14/273 (5%)

Query: 24  TAETLDIDATPESKERKDYFQLKKNYSQDSQTNTSMNEVIGXXXXXXXXXXXXXENLQSE 83
           T +   +   P   + +DY +L    S+     T+ NE+               +    E
Sbjct: 20  TDQIKKLHDDPTITKWRDYQKLHGTISR-----TTTNELGDDDTSSECSHDEQEQQHIVE 74

Query: 84  NKVLSPKYFKNRTHEYLFIISCMVSQFMSQAGLTQALSIMNILAEELNAEKSRQAWLMAS 143
            +   P        ++  +    ++ F S  G       +  L ++ N ++++    +  
Sbjct: 75  GEQNYPHTLLTYRQKWFMVFLMTITGFWSSLGSPIYYPALKELEQKFNIDENKVNVTVVV 134

Query: 144 FTLSMGSFILVSGRLGDIYGLKKVLLGGYAILTIWSL-ICGFSSYSHNDAFFITSRAFQG 202
           + L  G    +SG L D+YG + V+LGG  I  + S+ I    SY       +  R  Q 
Sbjct: 135 YLLFQGVAPAISGGLADVYGRRPVILGGMLIFVVASIGIAKAPSY----GVIVFLRCIQS 190

Query: 203 LGLAFVLPNSLGLIGVIYEPGSMKKNMIIGTLGAMSPIGATLGGLFAGIIGTKDPKQWPW 262
           +G++  +  S G++         ++   +G    +  IG  +G L   +I       W  
Sbjct: 191 IGISPTIAISSGVVSDFTV--KRERGTFVGATSGLVLIGQGIGPLLGAVITAA--LHWRA 246

Query: 263 SFYSFGIVSFCNMILSWYSIPNNIPTNIYNLSM 295
            F+   I     MI+ ++ +P    T + NLS+
Sbjct: 247 VFWFLTIGCGSCMIIGFFLLPETKRTIVGNLSI 279

>SAKL0C12122g Chr3 (1086281..1088116) [1836 bp, 611 aa] {ON} similar
           to uniprot|P39980 Saccharomyces cerevisiae YEL065W SIT1
           Ferrioxamine B transporter member of the ARN family of
           transporters that specifically recognize
           siderophore-iron chelates transcription is induced
           during iron deprivation and diauxic shift potentially
           phosphorylated by Cdc28p
          Length = 611

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 33/52 (63%), Gaps = 1/52 (1%)

Query: 322 WQSAYIIVLLVLSFC-ALVIFVVYEVKYAKTPLIPKAISSNRGMLMILFALF 372
           W+SA IIV  VL +C AL +F+++E KYA+ PL P  +  +RG+   L   F
Sbjct: 293 WKSASIIVPEVLGWCLALPLFLLWEGKYARNPLTPWDLIKDRGIFSALIIAF 344

>KLTH0D16962g Chr4 (1399514..1401229) [1716 bp, 571 aa] {ON} similar
           to uniprot|P33335 Saccharomyces cerevisiae YPR198W SGE1
           Member of drug-resistance protein family multicopy
           suppressor of gal11 null mutation
          Length = 571

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 39/169 (23%), Positives = 70/169 (41%), Gaps = 18/169 (10%)

Query: 102 IISCMVSQFMSQAGLTQALSIMNILAEELNAEKSRQAWLMASFTLSMGSFILVSGRLGDI 161
           + S  V+ F+    +   +++ + + +E N + +   WLMA + L    F+L+ GR+  +
Sbjct: 10  VTSLCVTLFLGALDIVICITLYDTIGQEFN-DYANVGWLMAGYNLPNALFMLLWGRIASL 68

Query: 162 YGLKKVLLGGYAILTIWSLICGFSSYSHNDAFFITSRAFQGLGLAFVLPNSLGLIGVIYE 221
            GLK  L+    I    SL+ G    +++    I +R   G G         G+  ++Y 
Sbjct: 69  VGLKCSLMASIVIFEAGSLMAG---AANSMGMLIGARVISGFG-------GSGIESLVYG 118

Query: 222 PGS-----MKKNMIIGTLGAMSPIGATLGGLFAGIIGTKDPKQWPWSFY 265
            G+       +  +I  LG    +    G    G  G  +   W W FY
Sbjct: 119 VGTSIVEEKHRARVITVLGIAYMLAEGAGPFVGG--GLAEHVSWRWCFY 165

>SAKL0A00726g Chr1 (82164..83960) [1797 bp, 598 aa] {ON} similar to
           uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 598

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 50/211 (23%), Positives = 89/211 (42%), Gaps = 23/211 (10%)

Query: 78  ENLQSENKVLSPKYFKNRTHEYLFIISCMVSQFMSQAGLTQALSIMNILAEELNAEKSRQ 137
           E ++   KV+S          Y  + S  ++ F+S   +    +I+  ++ + N E S+ 
Sbjct: 22  EVVEQNKKVVSQDQVVKGFALYACLGSLTLALFLSALDILIVSTIIETVSRDFN-EYSKS 80

Query: 138 AWLMASFTLSMGSFILVSGRLGDIYGLKKVLLGGYAILTIWSLICGFSSYSHNDAFFITS 197
            WL+  ++L      LV GR   I G K  +L    I  + SL+   S+ +++    I  
Sbjct: 81  GWLVTGYSLPTALLSLVWGRAASIIGFKSSMLLSIIIFEVGSLV---SALANSMNMLIGG 137

Query: 198 RAFQGLG------LAFVLPNSLGLIGVIYEPGSMKKNMIIGTLGAMSPIGATLGGLFAGI 251
           R   G+G      L F++ ++L    V      M  +++  +    S +G  LGG F   
Sbjct: 138 RVISGVGGSGLQTLCFLIISTL----VNERSRGMAISVLSCSFAVASIVGPFLGGAFTTH 193

Query: 252 IGTKDPKQWPWSFY---SFGIVSFCNMILSW 279
           +       W W FY     G ++F   +LS+
Sbjct: 194 V------TWRWCFYINLPIGGLAFLVFVLSY 218

>Skud_2.423 Chr2 (756345..758027) [1683 bp, 560 aa] {ON} YBR293W
           (REAL)
          Length = 560

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 90/415 (21%), Positives = 162/415 (39%), Gaps = 48/415 (11%)

Query: 110 FMSQAGLTQALSIMNILAEELNAEKSRQAWLMASFTLSMGSFILVSGRLGDIYGLKKVLL 169
           F+S    T   S    +  E N + S   W+  ++ ++  SF  + G   D  G +  L 
Sbjct: 64  FLSGFDGTVTASTYQTIGNEFN-QMSISNWITTAYLITSTSFQPLYGSFSDALGRRNCLF 122

Query: 170 GGYAILTIWSLICGFSSYSHNDAFF--------ITSRAFQGLGLAFVLPNSLGLIGVIYE 221
              A  TI  L C  S+  +  +                  +  + V+P+S   I   ++
Sbjct: 123 FANAAFTIGCLACSLSTNIYTLSLMRALAGIGGGGLITLSTIVNSDVIPSSKRGIFQAFQ 182

Query: 222 PGSMKKNMIIGTLGAMSPIGATLGGLFAGIIGTKDPKQWPWSFYSFGIVSFCNMILSWYS 281
                 N+++G  GA+   GA+ GG  A  IG      W W F     +S  + +L  Y 
Sbjct: 183 ------NLLLG-FGAIC--GASFGGTIASTIG------WRWCFLIQVPISIISSVLMNYY 227

Query: 282 IPNNIPTNIYNLSMDWXXXXXXXXXXXXXNFVF--------------NQAPIVGWQSAYI 327
           +PN    N  N ++               + +                    + W S  +
Sbjct: 228 VPNQKEYNHENSNIFRNSKRILTDIDITGSILIITGLTLQLLYLSLGCSGSKLSWTSPSV 287

Query: 328 IVLLVLSFCALVIFVVYEVKYAKTPLIP-KAISSNRGMLMILFALFCGWGAFGTWTFYYF 386
           ++LLV S   L++F+ +E K     +IP + +SS+   +++L ++  G+ ++  + F   
Sbjct: 288 LLLLVGSIAILLLFISHEKKTTARAIIPMELVSSSYSFVVLLISILVGFASYA-YLFTLP 346

Query: 387 SFVLNVRGYTAAWAGGSYFIFIVSGCAIATLCGFMMKKVPP-SVILYISM-IGFMGGCVM 444
            F   V G + A AG    I  +     + + GF M K      +LY+ + + F+G  + 
Sbjct: 347 LFFQIVLGDSTAKAGLRLAIPSLFTPVGSLITGFSMSKYNCLRSLLYVGVSLMFLGNFLF 406

Query: 445 LTVTPIHQSYFQNILGIMFVLP--IGIDLSFPAASIILSDALPIQYQGMAGSLVY 497
           L +    +    N L  +F++P  +G  ++FP          P   Q  A S +Y
Sbjct: 407 LFI----EKTSPNWLISLFLIPANLGQGITFPTTLFTFIFLFPKSDQATATSTLY 457

>SAKL0E04246g Chr5 (336416..338113) [1698 bp, 565 aa] {ON} weakly
           similar to uniprot|Q04301 Saccharomyces cerevisiae
           YMR088C VBA1 Permease of basic amino acids in the
           vacuolar membrane
          Length = 565

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 47/90 (52%), Gaps = 1/90 (1%)

Query: 94  NRTHEYLFIISCMVSQFMSQAGLTQALSIMNILAEELNAEKSRQAWLMASFTLSMGSFIL 153
             T   + +I+  +  F+S    T   +++  +A +L+A  S+ +W+  S+ LS  +F  
Sbjct: 36  TETKTRIIVIALFLGSFLSALDTTIVSTLLPTIASDLDAS-SQMSWIATSYLLSCSAFQP 94

Query: 154 VSGRLGDIYGLKKVLLGGYAILTIWSLICG 183
           + G+L DI+G K +L+    +  I   +CG
Sbjct: 95  LYGKLSDIFGRKILLVWSNLVFAIGCALCG 124

>AGR076C Chr7 complement(871564..873624) [2061 bp, 686 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR119W
          Length = 686

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 24/91 (26%), Positives = 48/91 (52%), Gaps = 1/91 (1%)

Query: 96  THEYLFIISCMVSQFMSQAGLTQALSIMNILAEELNAEKSRQAWLMASFTLSMGSFILVS 155
           T   + + S  +  F++    T   ++++ +A E N E  R +W+  ++ LS  +F  + 
Sbjct: 137 TRRRVVMASMCLGVFLAALDGTIVTTLLDHIASEFN-ELPRISWIATAYLLSSATFQPLY 195

Query: 156 GRLGDIYGLKKVLLGGYAILTIWSLICGFSS 186
           G+L DI+G + +L+    +  + +LICG S 
Sbjct: 196 GKLSDIFGRRPLLVFSNLVFCLGALICGMSK 226

>TDEL0D06610 Chr4 complement(1195341..1196834) [1494 bp, 497 aa]
           {ON}  possible pseudogene; N added at two sites to avoid
           frameshifts
          Length = 497

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 44/91 (48%), Gaps = 3/91 (3%)

Query: 116 LTQALSIMNILAEELNAEKSRQAWLMASFTLSMGSFILVSGRLGDIYGLKKVLLGGYAIL 175
           ++  +S+++ L+ + +   +  +W + S+ ++   FI   GRLGDI G  ++        
Sbjct: 45  VSSMISLIDELSTKYSISYTTASWSLTSYAVTFAGFIAFMGRLGDIVGNSRLFTVSCGCF 104

Query: 176 TIWSLICGFSSYSHNDAFFITSRAFQGLGLA 206
            I SL+CG      N   F   RA QG+  A
Sbjct: 105 AILSLLCGLMP---NFEAFAVMRALQGIAAA 132

>SAKL0C02178g Chr3 complement(191542..193239) [1698 bp, 565 aa] {ON}
           weakly similar to uniprot|Q04301 Saccharomyces
           cerevisiae YMR088C VBA1 Permease of basic amino acids in
           the vacuolar membrane
          Length = 565

 Score = 41.6 bits (96), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 28/109 (25%), Positives = 57/109 (52%), Gaps = 2/109 (1%)

Query: 96  THEYLFIISCMVSQFMSQAGLTQALSIMNILAEELNAEKSRQAWLMASFTLSMGSFILVS 155
           T   + +++ ++  F+S    T   +++  +A +L+A  S+ +W+  ++ LS  +F  + 
Sbjct: 38  TKVRITVLALLMGSFLSALDTTIVATLLPTIASDLDAS-SQMSWIATAYLLSCSAFQPLY 96

Query: 156 GRLGDIYGLKKVLLGGYAILTIWSLICGFSSYSHNDAFFITSRAFQGLG 204
           G+L DI+G K +L+       +   ICG S +++N     T R   G+G
Sbjct: 97  GKLSDIFGRKILLILSNLTFALGCAICG-SPWTNNVWVLSTGRFVAGIG 144

>SAKL0A08228g Chr1 complement(732518..734227) [1710 bp, 569 aa] {ON}
           similar to uniprot|P33335 Saccharomyces cerevisiae
           YPR198W SGE1 Member of drug-resistance protein family
           multicopy suppressor of gal11 null mutation
          Length = 569

 Score = 41.2 bits (95), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 40/152 (26%), Positives = 64/152 (42%), Gaps = 20/152 (13%)

Query: 120 LSIMNILAEELNAEKSRQAWLMASFTLSMGSFILVSGRLGDIYGLKKVLLGGYAILTIWS 179
           ++I+N +A++ NA  S+  WL+  ++LS   F L+ GR   I+G K  L+    I  I S
Sbjct: 41  VTILNTIADKFNAY-SKIGWLITGYSLSNALFTLLWGRFAVIFGSKTTLMVSIIIFEIGS 99

Query: 180 LICGFSSYSHNDAFFITSRAFQGLG------LAFVLPNSLGLIGVIYEPGSMKKNMIIGT 233
           L+    + S++    I  R   G G      L F +  SL             +  I+  
Sbjct: 100 LVI---AVSNSMDMIIGGRVIAGCGASGIQTLVFAIATSL--------VDEHTRGTIVTL 148

Query: 234 LGAMSPIGATLGGLFAGIIGTKDPKQWPWSFY 265
           L     + + LG    G +   +   W W FY
Sbjct: 149 LSLSYAVASALGPYIGGAL--TEYVTWRWCFY 178

>Skud_18.6 Chr18 (14597..16429) [1833 bp, 610 aa] {ON} YCL073C
           (REAL)
          Length = 610

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 24/69 (34%), Positives = 32/69 (46%), Gaps = 10/69 (14%)

Query: 322 WQSAYIIVLLVLSFCALVIFVVYEVKYAKTPLIPKAISSNRGMLMILFALFCGWGAFGTW 381
           W S+ II  LV       IFV +E  YAK PL+P  +  +RG+          W   G  
Sbjct: 298 WHSSKIIGTLVFGGVLFCIFVFWETAYAKNPLLPFKLLGDRGI----------WAPLGVA 347

Query: 382 TFYYFSFVL 390
            F YF+F +
Sbjct: 348 FFNYFTFFI 356

>YKR106W Chr11 (661442..663289) [1848 bp, 615 aa] {ON}
           GEX2Proton:glutathione antiporter localized to the
           vacuolar and plasma membranes; expressed at a very low
           level; almost identical to paralog Gex1p; potential role
           in resistance to oxidative stress and modulation of the
           PKA pathway
          Length = 615

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 28/43 (65%)

Query: 322 WQSAYIIVLLVLSFCALVIFVVYEVKYAKTPLIPKAISSNRGM 364
           W ++ II  LV   C   IF+ +E K+AK+PL+P  + S+RG+
Sbjct: 303 WHNSKIIATLVSGGCLFFIFLYWEAKFAKSPLLPFKLLSDRGI 345

>YCL073C Chr3 complement(6479..8326) [1848 bp, 615 aa] {ON}
           GEX1Proton:glutathione antiporter localized to the
           vacuolar and plasma membranes; imports glutathione from
           the vacuole and exports it through the plasma membrane;
           has a role in resistance to oxidative stress and
           modulation of the PKA pathway
          Length = 615

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 28/43 (65%)

Query: 322 WQSAYIIVLLVLSFCALVIFVVYEVKYAKTPLIPKAISSNRGM 364
           W ++ II  LV   C   IF+ +E K+AK+PL+P  + S+RG+
Sbjct: 303 WHNSKIIATLVSGGCLFFIFLYWEAKFAKSPLLPFKLLSDRGI 345

>KLLA0D19941g Chr4 complement(1698889..1700724) [1836 bp, 611 aa]
           {ON} similar to uniprot|P36172 Saccharomyces cerevisiae
           YKR105C Hypothetical ORF
          Length = 611

 Score = 41.2 bits (95), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 37/135 (27%), Positives = 63/135 (46%), Gaps = 16/135 (11%)

Query: 322 WQSAYIIVLLVLSFCALVIFVVYEV-----------KYAKTPLIPKAISSNRGMLMILFA 370
           W+SA +I  L++ F   V+ VVY+              +  P++ K + +NR +L+    
Sbjct: 304 WKSAIVICFLIVGFLLSVLSVVYDFYIFDKINPEPSNLSFRPMLVKGLLNNRFILLPNLV 363

Query: 371 LFCGWGAFGTWTFYYFSFVLNVRGYTAAWAGGSYFI-FIVSGCAIATLCGFMMKK---VP 426
                 AF  +  Y   F   V G ++AW  G + I  +++    A +CG +MKK   V 
Sbjct: 364 TCASAIAFSGYMLYSVQFFQLVMG-SSAWNAGLHLIPLVIASIVSAIICGGIMKKTGQVK 422

Query: 427 PSVILYISMIGFMGG 441
           P +I  +S++   GG
Sbjct: 423 PLMISTVSILLIGGG 437

>SAKL0C05588g Chr3 (527748..529781) [2034 bp, 677 aa] {ON} similar
           to uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 677

 Score = 40.8 bits (94), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 72/332 (21%), Positives = 120/332 (36%), Gaps = 63/332 (18%)

Query: 123 MNILAEELNAEKSRQAWLMASFTLSMGSFILVSGRLGDIYGLKKVLLGGYAILTIWSLIC 182
           + ++AE+   + S+  W+++ ++L+     L+ GR   I G K  LL    I    SLI 
Sbjct: 142 IEVIAEQFK-DYSKSGWIVSGYSLTEALLTLLWGRFATIIGFKSSLLVSILIFEAGSLI- 199

Query: 183 GFSSYSHNDAFFITSRAFQGLG------LAFVLPNSLGLIGVIYEPGSMKKNMIIGTLGA 236
             S+ S++    I  R   G+G      L FV+ ++L             + +II  L  
Sbjct: 200 --SAISNSMNMLIGGRVVAGIGGSGIQSLCFVIASTL--------TPDRSRVIIISVLSC 249

Query: 237 MSPIGATLGGLFAGIIGTKDPKQWPWSFY---SFGIVSFCNMILSW-----YSIPNNIPT 288
              + A +G    G + T     W W FY     G ++F  + + +      SI +    
Sbjct: 250 SYAVAAVVGPFLGGALTTH--VTWRWCFYINLPIGGLAFVVLAMVYNPSGRKSIKDVFSV 307

Query: 289 NIYNLSMDWXXXXXXXXXXXXXNFVFNQAPIVG-----------------------WQSA 325
              N                  N++  Q   VG                       W S 
Sbjct: 308 TKANYRRGMGRLLTARFYSKIPNWLVFQIDFVGFVLCTAGFTLLLLGLTFGGSMYAWSSG 367

Query: 326 YIIVLLVLSFCALVIFVVYEV----KYAKT-------PLIPKAISSNRGMLMILFALFCG 374
            IIV LV+    +   +VY+     ++ +        PL+P  + S  G+     A+F G
Sbjct: 368 TIIVSLVVGVLLITASLVYDFALFPRFKQVRKDASCMPLLPWRVVSRPGIFTSNTAVFLG 427

Query: 375 WGAFGTWTFYYFSFVLNVRGYTAAWAGGSYFI 406
             A+     Y   F   VRG  +AW    + +
Sbjct: 428 CIAYSAQIVYAVQFFQLVRG-ASAWTASIHLL 458

>NCAS0D02350 Chr4 (439325..441229) [1905 bp, 634 aa] {ON} 
          Length = 634

 Score = 40.8 bits (94), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 40/57 (70%), Gaps = 5/57 (8%)

Query: 322 WQSAYIIVLLVLSFC-ALVIFVVYEVKYAKTPLIPKAISSNRGM---LMILFAL-FC 373
           W++A+IIV  V+ +C AL +++++E+K+++ PL P  +  +RG+   L+I F + FC
Sbjct: 308 WRTAHIIVPEVIGWCVALPLYILWEIKFSRHPLTPWELLKDRGVYSALIIAFLINFC 364

>Smik_2.434 Chr2 (773094..774518) [1425 bp, 474 aa] {ON} YBR293W
           (REAL)
          Length = 474

 Score = 40.4 bits (93), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 91/384 (23%), Positives = 160/384 (41%), Gaps = 43/384 (11%)

Query: 139 WLMASFTLSMGSFILVSGRLGDIYGLKKVLLGGYAILTIWSLICGFSSYSHNDAFFITSR 198
           W+  ++ ++  SF  + G   D  G +  L    A  TI  L CGFSS  +  +F    R
Sbjct: 6   WITTAYLITSTSFQPLYGSFSDALGRRNCLFFANATFTIGCLACGFSSNIYMLSFM---R 62

Query: 199 AFQGLGLAFVLPNSLGLIGVIYEPGSMK------KNMIIGTLGAMSPIGATLGGLFAGII 252
           A  G+G   ++  S  ++     P S +      +N+++G  GA+   GA+ GG  A  I
Sbjct: 63  ALTGIGGGGLITLS-TIVNSDVIPTSKRGIFQAFQNLLLG-FGAIC--GASFGGTIASTI 118

Query: 253 GTKDPKQWPWSFYSFGIVSFCNMILSWYSIP-----NNIPTNIYNLS---------MDWX 298
           G      W W F     +S  + IL  Y +P     N+  +NI+N           M   
Sbjct: 119 G------WRWCFLIQVPISMISSILMNYYVPNQKEYNDQNSNIFNDPKKILTGIDVMGSI 172

Query: 299 XXXXXXXXXXXXNFVFNQAPIVGWQSAYIIVLLVLSFCALVIFVVYEVKYAKTPLIP-KA 357
                         +      + W S  +++LL  S   L++F+++E K     +IP + 
Sbjct: 173 LIITGLTLQLLYLSLGCSTSNLSWTSPSVLLLLFGSVIILLLFILHERKTTARAIIPMEL 232

Query: 358 ISSNRGMLMILFALFCGWGAFGTWTFYYFSFVLNVRGYTAAWAGGSYFIFIVSGCAIATL 417
           +SS+   +++  ++  G+ ++  + F    F   V G + A AG    I  +     + +
Sbjct: 233 VSSSYSFVVLSISILVGFASYA-YLFTLPLFFQIVLGDSTAKAGLRLTIPSLFTPVGSLI 291

Query: 418 CGFMMKKVPP-SVILYISM-IGFMGGCVMLTVTPIHQSYFQNILGIMFVLP--IGIDLSF 473
            GF M K      +LY+ + + F+G  + L +    +    N L  +F++P  +G  ++F
Sbjct: 292 TGFSMSKYNCLRSLLYLGISLMFLGNFLFLFI----EETSPNWLISLFLIPANLGQGITF 347

Query: 474 PAASIILSDALPIQYQGMAGSLVY 497
           P          P   Q  A S +Y
Sbjct: 348 PTTLFTFIFMFPKSDQATATSTLY 371

>Smik_21.4 Chr21 (1261..3078) [1818 bp, 605 aa] {ON} YOL158C (REAL)
          Length = 605

 Score = 40.4 bits (93), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 25/35 (71%)

Query: 322 WQSAYIIVLLVLSFCALVIFVVYEVKYAKTPLIPK 356
           W+  YII ++V+  C   IF+++E+++AK P IP+
Sbjct: 306 WREGYIIAMIVVGGCLGFIFLIWELRFAKNPFIPR 340

>SAKL0B12716g Chr2 (1101141..1103039) [1899 bp, 632 aa] {ON} similar
           to uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 632

 Score = 40.0 bits (92), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 94/447 (21%), Positives = 166/447 (37%), Gaps = 71/447 (15%)

Query: 123 MNILAEELNAEKSRQAWLMASFTLSMGSFILVSGRLGDIYGLKKVLLGGYAILTIWSLIC 182
           + +++E+ N + S+  W+++ ++L      L+ GR   I+G K  LL    I    SLI 
Sbjct: 65  IEVISEQFN-DYSKSGWIVSGYSLPEALLTLLWGRFATIFGFKLSLLLSILIFETGSLI- 122

Query: 183 GFSSYSHNDAFFITSRAFQGLG------LAFVLPNSLGLIGVIYEPGSMKKNMIIGTLGA 236
             S+ S++    I  R   G+G      L FV+ ++L             + + I  L  
Sbjct: 123 --SAVSNSMNVLIGGRVVAGIGGSGIQSLCFVIASTL--------TTERSRGVAISVLSC 172

Query: 237 MSPIGATLGGLFAGIIGTKDPKQWPWSFY---SFGIVSFCNMILSWYSIPNNIPTNIYNL 293
              + A  G    G   T     W W FY     G ++F  ++L++     N   +I ++
Sbjct: 173 AYAVAAVAGPFMGGAFTTH--VTWRWCFYINLPIGSLAFAVLVLTYKPHEGNSARSIVSV 230

Query: 294 -------------SMDWXXXXXXXXXXXXXNFVFNQAPI---------------VGWQSA 325
                        S D                 F    +                 W S 
Sbjct: 231 LKSCCEFGTARLFSKDLYLKMFDELVFGFDFIGFIFCSVGFILFLLGLTFGGDKYAWSSG 290

Query: 326 YIIVLLVLSFCALVIFVVYEV----KYAKT-------PLIPKAISSNRGMLMILFALFCG 374
            IIV  ++     V F++Y+     K+ +        PL+P ++ S  G+   + A F  
Sbjct: 291 AIIVYFIVGVTISVAFLLYDFMIFPKFGRVRKNASFRPLVPWSVVSRPGIATAVAANFLM 350

Query: 375 WGAFGTWTFYYFSFVLNVRGYTAAWAGGSYFIFI----VSGCAIATLCGFMMKKVPPSVI 430
             A+     Y   F   VRG + AW    + + +    +   AI+     M   V P  I
Sbjct: 351 CVAYSAQVVYIIQFFQLVRG-SDAWRASIHVVALEIPDIITVAISGAISRMTGHVKP--I 407

Query: 431 LYISMIGFMGGCVMLTVTPIHQSYFQNILGIMFVLPIGIDLSFPAASIILSDALPIQYQG 490
           +++ +I  + G  +LT+        ++I G++ +  +        + +     +P     
Sbjct: 408 IFVGIIAGLVGAGLLTLLDNDSGSSKHI-GLLILPGVAFGAMLQGSLLSCQLQIPKDSAS 466

Query: 491 MAGSLVYTITNYSTSICLGMA-GSVEA 516
                V T T ++ SI LGM+ GSV A
Sbjct: 467 FMPDFVSTTTVHTFSISLGMSFGSVLA 493

>KLTH0C10142g Chr3 (842371..844092) [1722 bp, 573 aa] {ON} similar
           to uniprot|P33335 Saccharomyces cerevisiae YPR198W SGE1
           Member of drug-resistance protein family multicopy
           suppressor of gal11 null mutation
          Length = 573

 Score = 40.0 bits (92), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 40/139 (28%), Positives = 56/139 (40%), Gaps = 19/139 (13%)

Query: 133 EKSRQAWLMASFTLSMGSFILVSGRLGDIYGLKKVLLGGYAILTIWSLICGFSSYSHNDA 192
           + +R  WL+  + L    F L+ GRL  I GLK  L     I  I SLI    + S++  
Sbjct: 40  DYARIGWLVTGYALPNALFTLLWGRLASILGLKTSLTFSIVIFEIGSLIV---AVSNSMG 96

Query: 193 FFITSRAFQGLG------LAFVLPNSLGLIGVIYEPGSMKKNMIIGTLGAMSPIGATLGG 246
             I  R   G G      L FV+  SL     + E     + M+I  LG    +   +G 
Sbjct: 97  MIIGGRVVAGCGGSGIQSLVFVVGTSL-----VEER---NRGMVITVLGLAFAVAFAVGP 148

Query: 247 LFAGIIGTKDPKQWPWSFY 265
           +  G     +   W W FY
Sbjct: 149 VIGGAF--TENVSWRWCFY 165

>KLTH0A01562g Chr1 complement(138389..140236) [1848 bp, 615 aa] {ON}
           similar to uniprot|P39980 Saccharomyces cerevisiae
           YEL065W SIT1 Ferrioxamine B transporter member of the
           ARN family of transporters that specifically recognize
           siderophore-iron chelates transcription is induced
           during iron deprivation and diauxic shift potentially
           phosphorylated by Cdc28p
          Length = 615

 Score = 40.0 bits (92), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 32/44 (72%), Gaps = 1/44 (2%)

Query: 322 WQSAYIIVLLVLSFC-ALVIFVVYEVKYAKTPLIPKAISSNRGM 364
           W+ A IIV  V+ +C AL +F+++E KY++ PL+P ++  +RG+
Sbjct: 305 WKRAEIIVPEVIGWCVALPLFLLWEGKYSRHPLVPWSLVKDRGI 348

>Kpol_416.6 s416 (26742..28535) [1794 bp, 597 aa] {ON}
           (26742..28535) [1794 nt, 598 aa]
          Length = 597

 Score = 39.7 bits (91), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 53/217 (24%), Positives = 93/217 (42%), Gaps = 7/217 (3%)

Query: 322 WQSAYIIVLLVLSFC-ALVIFVVYEVKYAKTPLIPKAISSNRGMLMILFALFCGWGAFGT 380
           W++A IIV  VL +  A   F+ +E+K+AK PL P     +RG+   L        AF  
Sbjct: 305 WKTARIIVPEVLGWVVAFPAFLTWEIKFAKYPLTPWKTVKDRGVFSALIIAIFLQTAFYM 364

Query: 381 WTFYYFSFVLNVRGYTAAWAGGSYFIFIVSGCAIATLCGFMMKKVPPS--VILYISMIGF 438
              Y ++ +L     T   A     +F        TL G ++ KV  +   I +   + F
Sbjct: 365 QKTYMYTILLVAVNQTKKSATRINSLFTFVTALSGTLLGLVIVKVRRTKEFIFFGIAVWF 424

Query: 439 MGGCVMLTVTPIHQSYFQNILGIMFVLPIGID-LSFPAASIILSDALPIQYQGMAGSLVY 497
           +   ++   T    +Y   I+  + +L  G   + +P  + + + AL  +   +  SL  
Sbjct: 425 LSFGLLERYTGGTNAY-AGIIAALCLLGFGNGFIKYPTKASMQASALTHEMMAIITSLFM 483

Query: 498 TITNYSTSICLGMAGSVEAYHNDNGQNILKGYRNAMI 534
            I+   TS+   +AG++  + N     I KG  N+ +
Sbjct: 484 AISTIGTSVGSSVAGAI--WTNVLPDKIEKGLNNSTL 518

>KLTH0B10142g Chr2 complement(847376..849082) [1707 bp, 568 aa] {ON}
           similar to uniprot|P36172 Saccharomyces cerevisiae
           YKR105C Hypothetical ORF
          Length = 568

 Score = 39.7 bits (91), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 41/169 (24%), Positives = 77/169 (45%), Gaps = 16/169 (9%)

Query: 322 WQSAYIIVLLVLSFCALVIFVVYEVKYAK--------TPLIPKAISSNRGMLMILFALFC 373
           W S  +I  +++    + I +VY+ K  +         PL+   I SNR +L+  F  F 
Sbjct: 286 WNSGIVISFIIIGVLLIAISLVYDFKVFEQIKTQDSFRPLLSWEIMSNRSILLSNFTGFF 345

Query: 374 GWGAFGTWTFYYFSFVLNVRGYTAAWAGGSYFI-FIVSGCAIATLCGFMMKK---VPPSV 429
              A+     Y   F   V G++ AW  G + I  +VS    +   G + KK   + P +
Sbjct: 346 STVAYNVQMIYSVQFFQLVYGFS-AWKAGLHLIPILVSTVVFSIASGILTKKTGHIKP-L 403

Query: 430 ILYISMIGFMGGCVMLTVTPIHQSYFQNILGIMFVLPIGIDLSFPAASI 478
           +++ S +G +GG +M  +   ++S     +G++ +  + +    P+A I
Sbjct: 404 LVFGSAMGVLGGGLMTLLD--NKSTKHTQIGVLILPGVALGFVLPSALI 450

>CAGL0B02079g Chr2 complement(191736..193610) [1875 bp, 624 aa] {ON}
           similar to uniprot|P50080 Saccharomyces cerevisiae
           YGR224w AZR1 or uniprot|P36172 Saccharomyces cerevisiae
           YKR105c
          Length = 624

 Score = 39.7 bits (91), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 41/162 (25%), Positives = 70/162 (43%), Gaps = 32/162 (19%)

Query: 119 ALSIMNI--LAEELN---AEKSRQAWLMASFTLSMGSFILVSGRLGDIYGLKKVLLGGYA 173
           AL +M +  + EE++    + S+  WL   ++L     +L+ GR+  + G K   L    
Sbjct: 57  ALDVMTVSTIIEEVSQKFGDYSKVGWLFTGYSLPNALLVLIWGRIATLVGFKTSTLAAIV 116

Query: 174 ILTIWSLICGFSSYSHNDAFFITSRAFQGLG------LAFVLPNSLGLIGVIYEPGSMKK 227
           I  + SL+   S+ +++    I  R   G+G      L FV+ ++L     + E     +
Sbjct: 117 IFEVGSLV---SALANSMDMLIGGRVIAGIGGSGVQSLVFVISSTL-----VEE---RNR 165

Query: 228 NMIIGTL----GAMSPIGATLGGLFAGIIGTKDPKQWPWSFY 265
            +II  +    G  S +G  LGG F   +       W W FY
Sbjct: 166 GLIIAVMSSSFGIASVVGPFLGGAFTTHV------TWRWCFY 201

>KLLA0A04631g Chr1 complement(415070..416809) [1740 bp, 579 aa] {ON}
           weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 579

 Score = 39.3 bits (90), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 27/111 (24%), Positives = 54/111 (48%), Gaps = 4/111 (3%)

Query: 94  NRTHEYLFIISCMVSQFMSQAGLTQALSIMNILAEELNAEKSRQAWLMASFTLSMGSFIL 153
           +R   ++ I S  +  F++    T   ++++ +A E N E S  +W+  ++ LS  +F  
Sbjct: 56  SRARLHIIISSMCLGSFLAALDNTIVTTLLSHIASEFN-ELSHISWIATAYLLSSATFQP 114

Query: 154 VSGRLGDIYGLKKVLLGGYAILTIWSLICGFSSYSHNDAFFITSRAFQGLG 204
           + G++ DI+G + +++       +  LICG    S N    +  R   G+G
Sbjct: 115 LYGKISDIFGRRPLIIISNLFFILGCLICGL---SKNLWTLVAGRFIAGIG 162

>Kpol_543.44 s543 (96992..98923) [1932 bp, 643 aa] {ON}
           (96992..98923) [1932 nt, 644 aa]
          Length = 643

 Score = 39.3 bits (90), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 41/76 (53%), Gaps = 1/76 (1%)

Query: 110 FMSQAGLTQALSIMNILAEELNAEKSRQAWLMASFTLSMGSFILVSGRLGDIYGLKKVLL 169
           F++    T   +++  +A E N E  R +W+  ++ LS  +F  + G++ DI+G K VL+
Sbjct: 132 FLAALDNTIVSTLLAHIASEFN-ELPRISWVATAYLLSSATFQPIYGKISDIFGRKVVLI 190

Query: 170 GGYAILTIWSLICGFS 185
                  + SLICG S
Sbjct: 191 FCNITFFVGSLICGLS 206

 Score = 34.7 bits (78), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 49/227 (21%), Positives = 92/227 (40%), Gaps = 50/227 (22%)

Query: 320 VGWQSAYIIVLLVLSFCALVIFVVYEVKYAKTPLIPKAISSNRGML-MILFALFCGWGAF 378
           + + S   I L V++    +IF   E+K AK P++P     +R +L   L   FC   A 
Sbjct: 351 IPYTSHKFIGLCVVTVIGALIFGYTELKIAKDPILPLRFLKDRSVLGSSLSNWFCMM-AL 409

Query: 379 GTWTFY---YFSFVLNVR---------------GYTAAWAG------GSYFIFIVSGCAI 414
            T ++Y   YF+ VLN++                + +  AG      G Y+ F++S C +
Sbjct: 410 MTVSYYLPIYFAGVLNMKPTDIGKRIIPNFFSTAFGSLGAGYYMKKTGKYYWFVISFCVL 469

Query: 415 ATLCGFMMKKVPPSVILYISMIGFMGGCVMLTVTPIHQSYFQNILGIMFVLPIGIDLSFP 474
           A++                       GC+ +       S F+    +MF+  +G  +   
Sbjct: 470 ASI-----------------------GCLQIVWIQPDISVFKQ-YTLMFIPGLGASVLIT 505

Query: 475 AASIILSDALPIQYQGMAGSLVYTITNYSTSICLGMAGSVEAYHNDN 521
            A + +  A+P  +Q +  S+ Y   +   ++ + + G++     DN
Sbjct: 506 VALLAMIAAVPHNHQAVTTSISYAFRSTGCTLGVSIGGAIFRESLDN 552

>YOL158C Chr15 complement(19491..21311) [1821 bp, 606 aa] {ON}
           ENB1Endosomal ferric enterobactin transporter, expressed
           under conditions of iron deprivation; member of the
           major facilitator superfamily; expression is regulated
           by Rcs1p and affected by chloroquine treatment
          Length = 606

 Score = 39.3 bits (90), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 25/35 (71%)

Query: 322 WQSAYIIVLLVLSFCALVIFVVYEVKYAKTPLIPK 356
           W+  +II ++V+  C   IF+++E+K+AK P IP+
Sbjct: 307 WREGHIIAMIVVGGCLGFIFLIWELKFAKNPFIPR 341

>SAKL0F00792g Chr6 (70444..72297) [1854 bp, 617 aa] {ON} similar to
           uniprot|P38731 Saccharomyces cerevisiae YHL040C ARN1
           Transporter member of the ARN family of transporters
           that specifically recognize siderophore-iron chelates
           responsible for uptake of iron bound to ferrirubin
           ferrirhodin and related siderophores
          Length = 617

 Score = 38.9 bits (89), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 28/43 (65%)

Query: 322 WQSAYIIVLLVLSFCALVIFVVYEVKYAKTPLIPKAISSNRGM 364
           WQ++ II  LVL F  + +F+ +E K+AK PL P  +  +RG+
Sbjct: 307 WQNSEIIGPLVLGFVLVPVFIYWESKWAKDPLAPFELLKDRGI 349

>Kwal_26.6697 s26 complement(26786..28519) [1734 bp, 577 aa] {ON}
           YBR293W - Hypothetical ORF [contig 381] FULL
          Length = 577

 Score = 38.9 bits (89), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 94/451 (20%), Positives = 182/451 (40%), Gaps = 59/451 (13%)

Query: 81  QSENKVLSPKYFKNRTHEYLFIISCMVSQFMSQAGLTQALSIMNILAEELNAEKSRQAWL 140
           ++  + L+P  +  R    L   +   + F+S    T   SI  ++  E    K   +W+
Sbjct: 28  ETTTEPLAPSSWTERNRILLIETALFTNVFLSGLDSTITASIYQLIGNEFEDVKV-SSWI 86

Query: 141 MASFTLSMGSFILVSGRLGDIYGLKKVLLGGYAILTIWSLICGFSSYSHNDAFFITSRAF 200
             ++ ++  SF  + G   D  G ++ L     I  +  L CG +S  ++    I  RA 
Sbjct: 87  TTAYLVTCTSFQPLYGSFSDTLGRRRCLFFANTIFALGCLGCGLTSTIYS---LIIMRAV 143

Query: 201 QGLGLAFVLPNSLGLIGVIYEPGSMK------KNMIIGTLGAMSPIGATLGGLFAGIIGT 254
            G+G   ++  S  ++     P   +      +N+++GT GA+  +GA+ GG  A  +G 
Sbjct: 144 TGIGGGGLITLS-TIVNSDIIPAKKRGMYQSFQNILVGT-GAV--VGASCGGEIASSMG- 198

Query: 255 KDPKQWPWSFYSFGIVSFCNMILSWYSIPNN-----------IPTNIYNLSMDWXXXXXX 303
                W W F     +S    ++++  + +            +P+N+  +          
Sbjct: 199 -----WRWCFLLQVPISIGGAVMAYLFVQDQDVVDKNPRSGALPSNVSKIKKIDFLGAFL 253

Query: 304 XXXXXXXNFVF---NQAPIVG---WQSAYIIVLLVLSFCALVIFVVYEVKYAKTPLIPKA 357
                    +F   N +   G   W S   + L +++  +L++F   E      P+IP  
Sbjct: 254 LISGLVSQLIFLTINSSAQEGKSTWLSGRSLALGLVTAVSLILFAYVEKTTTANPIIPHD 313

Query: 358 ISSN-RGMLMILFALFCGWGAFGTWTFYYFSFVLN---VRGYTAAWAGGSYFIFIVSGCA 413
           +        +++  +  G+ ++     Y F+  L    V G TAA AG    + + S C 
Sbjct: 314 LLGQWYSTTVLIVGVLVGFVSYA----YIFTLPLYFQVVVGDTAAEAG--LRLTVPSFCT 367

Query: 414 I--ATLCGFMM---KKVPPSVILYISMIGFMGGCVMLTVTPIHQSYFQNILGIMFVLP-- 466
                + G  M   K++P  +I+ IS++ F   C +L + P    +  ++L    ++P  
Sbjct: 368 PIGGVIMGISMKDPKRLPGLLIVGISLMLFGNLCFLL-IKPTTPYWLTSLL----LVPAN 422

Query: 467 IGIDLSFPAASIILSDALPIQYQGMAGSLVY 497
           IG  ++FP+       A P   Q  A + +Y
Sbjct: 423 IGQGITFPSTLFSFLFAFPPYKQATATATLY 453

>TPHA0G03150 Chr7 (670343..672145) [1803 bp, 600 aa] {ON} Anc_2.473
           YMR088C
          Length = 600

 Score = 38.9 bits (89), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 34/64 (53%), Gaps = 1/64 (1%)

Query: 102 IISCMVSQFMSQAGLTQALSIMNILAEELNAEKSRQAWLMASFTLSMGSFILVSGRLGDI 161
           + S  +  F+S    T    IMN +AE+ NA   +Q W+  S+ L+  +F  + GRL DI
Sbjct: 69  LTSLWLGSFLSALDATIVAVIMNRVAEDFNASNQKQ-WIATSYLLTNTAFQPLYGRLSDI 127

Query: 162 YGLK 165
            G K
Sbjct: 128 IGRK 131

>TBLA0F03040 Chr6 complement(735352..738072) [2721 bp, 906 aa] {ON}
           Anc_8.272 YDR119W
          Length = 906

 Score = 38.9 bits (89), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 99/442 (22%), Positives = 175/442 (39%), Gaps = 65/442 (14%)

Query: 110 FMSQAGLTQALSIMNILAEELNAEKSRQAWLMASFTLSMGSFILVSGRLGDIYGLKKVLL 169
           F++    T   ++M  +  E N +  +  W+  S+ LS   F  + G+L DI+G K +L+
Sbjct: 408 FLAALDNTVVSTLMAHIGSEFN-QIPKVPWVATSYLLSSAVFQPLYGKLSDIFGRKALLI 466

Query: 170 GGYAILTIWSLICGFSSYSHNDAFFITSRAFQGLGLAFVLPNSLGLIGVIYEPGSMKKNM 229
               I     +ICG S+  +     +  R   G+G   +   S+  I V        + +
Sbjct: 467 FSNLIFFFGCIICGMSNSLN---MLVWGRFVAGIGGGGI--TSMTTITVSDIVPLRSRAV 521

Query: 230 IIGTLGAMSPIGATLGGLFAGIIGTKDPKQWPWSFYSFGIVSFCNMIL--SWYSIPN--- 284
             G       +G   GG+  GI        W   F+S   VS  + +L  S+  +P    
Sbjct: 522 YQGICNFFFGLGTAFGGVIGGIF-VDHQYGWRMVFWSQVPVSGLSTLLICSFLVVPRIKN 580

Query: 285 -NIPTNIYNLSMDWXXXXXXXXXXXXXNFVFNQAPIVGWQSAYIIV-------------- 329
             +      + +DW                     ++ W ++++++              
Sbjct: 581 YEVSLGRKLMRVDW----------------LGSISMILWLTSFLLITTMMGGISLDIDSD 624

Query: 330 ----LLVLSFCALVIFVVYEVKYAKTPLIPKAISSNRGML-MILFALFCGWGAFGTWTFY 384
               L++ S  + +IFV+ E+  A  P++P    SNR +L   L   FC  G F T  FY
Sbjct: 625 QFHYLIMFSSVSAIIFVLTELFVASDPVLPLRFLSNRSVLGASLGNFFCVMG-FMTICFY 683

Query: 385 ---YFSFVLNVRGYTAAWAGGSYFIFIVSGCAIATLCGFMMKKVPPS---VILYISMIGF 438
              YF+ VL++            F+    G   A   G  MK+       V+L+ +++  
Sbjct: 684 LPIYFASVLDISPTGIGKRMAPNFLCTALGSLGA---GVYMKQTGKYYWFVVLF-ALVST 739

Query: 439 MGGCVMLTVTPIHQSYFQNILGIMFVLP-IGIDLSFPAASIILSDALPIQYQGMAGSLVY 497
           +G    LT+ P+  S    +  ++ VLP +G  +    A + +  A+P ++Q    S+ Y
Sbjct: 740 LGH-YYLTLIPLTVSI--TVQYLLVVLPGVGSSIIIVVALLAMIAAVPHKHQAATTSISY 796

Query: 498 TITNYSTSICLGMAGSVEAYHN 519
                ST   LG+A     +H 
Sbjct: 797 AF--RSTGGTLGVALGSSVFHR 816

>Kwal_56.22298 s56 (31819..33651) [1833 bp, 610 aa] {ON} YHL040C
           (ARN1) - Product of gene unknown [contig 187] FULL
          Length = 610

 Score = 38.5 bits (88), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 27/43 (62%)

Query: 322 WQSAYIIVLLVLSFCALVIFVVYEVKYAKTPLIPKAISSNRGM 364
           WQ+  +I   VL F  L IF+++E K+A+ P+IP  +  +R +
Sbjct: 301 WQNPRVISPFVLGFVLLPIFLIWEKKWARDPIIPYDLIKDRAV 343

>TDEL0H00130 Chr8 complement(10267..12132) [1866 bp, 621 aa] {ON} 
          Length = 621

 Score = 38.5 bits (88), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 29/51 (56%)

Query: 322 WQSAYIIVLLVLSFCALVIFVVYEVKYAKTPLIPKAISSNRGMLMILFALF 372
           WQSA +I   VL F  + IF+ +E K A  P+ P  +  +RG+   L+ +F
Sbjct: 314 WQSAKLIAPFVLGFVLIAIFIYWESKLALAPIAPFKMLKDRGIWAPLWIMF 364

>ABL040W Chr2 (321534..323237) [1704 bp, 567 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR088C
          Length = 567

 Score = 38.1 bits (87), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 35/64 (54%), Gaps = 1/64 (1%)

Query: 122 IMNILAEELNAEKSRQAWLMASFTLSMGSFILVSGRLGDIYGLKKVLLGGYAILTIWSLI 181
           IMN +AEE + E  ++ W+  SF L+  +F  + GR  DI G K  LL   +   + +L+
Sbjct: 67  IMNKIAEEFH-ESDKKQWMATSFLLTNAAFQPLYGRCSDIVGRKCALLIAQSFFLLGTLL 125

Query: 182 CGFS 185
             F+
Sbjct: 126 TCFA 129

>YKR105C Chr11 complement(658716..660464) [1749 bp, 582 aa] {ON}
           VBA5Putative transporter of the Major Facilitator
           Superfamily (MFS); proposed role as a basic amino acid
           permease based on phylogeny
          Length = 582

 Score = 38.1 bits (87), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 42/173 (24%), Positives = 71/173 (41%), Gaps = 20/173 (11%)

Query: 99  YLFIISCMVSQFMSQAGLTQALSIMNILAEELNAEKSRQAWLMASFTLSMGSFILVSGRL 158
           YL + S  +  F++   +    +I++++AE+     S+  WL+  ++L      L+ GR 
Sbjct: 37  YLCLASLTLVLFITALDILIVGTIIDVVAEQF-GNYSKTGWLVTGYSLPNAILSLIWGRF 95

Query: 159 GDIYGLKKVLLGGYAILTIWSLICGFSSYSHNDAFFITSRAFQGLG------LAFVLPNS 212
             I G +  L+    I    SLI   +S S N    I  R   G+G      L FV+  +
Sbjct: 96  ASIIGFQHSLILAILIFEAGSLIAALAS-SMN--MLIFGRVVAGVGGSGLQTLCFVIGCT 152

Query: 213 LGLIGVIYEPGSMKKNMIIGTLGAMSPIGATLGGLFAGIIGTKDPKQWPWSFY 265
           +         G   + ++I  L     + A +G +  G   T     W W FY
Sbjct: 153 M--------VGERSRPLVISILSCAFAVAAIVGPIIGGAFTTH--VTWRWCFY 195

>TDEL0G04740 Chr7 complement(865319..867124) [1806 bp, 601 aa] {ON} 
          Length = 601

 Score = 38.1 bits (87), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 33/109 (30%), Positives = 57/109 (52%), Gaps = 9/109 (8%)

Query: 322 WQSAYIIVLLVLSFC-ALVIFVVYEVKYAKTPLIPKAISSNRGM---LMILFALFCGWGA 377
           W++A IIV  V+ +  AL +++++E KYA+ PL P  +  +RG+   L+I F +   W  
Sbjct: 293 WKTAGIIVPEVIGWVVALPLYMIWESKYARHPLTPWKLIKDRGIFSALIIAFHINFIWYM 352

Query: 378 FGTWTFYYFSFVLNVRGYTAAWAGGSY-FIFIVSGCAIATLCGFMMKKV 425
            G + F      +N    +A      Y F+ +++G    TL G ++ KV
Sbjct: 353 QGDYMFTVLRVAVNESNSSAQRITSLYSFVSVITG----TLLGLVIVKV 397

>KLTH0D18150g Chr4 complement(1502817..1504640) [1824 bp, 607 aa]
           {ON} similar to uniprot|P38731 Saccharomyces cerevisiae
           YHL040C ARN1 Transporter member of the ARN family of
           transporters that specifically recognize
           siderophore-iron chelates responsible for uptake of iron
           bound to ferrirubin ferrirhodin and related siderophores
          Length = 607

 Score = 38.1 bits (87), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 39/133 (29%), Positives = 60/133 (45%), Gaps = 30/133 (22%)

Query: 322 WQSAYIIVLLVLSFCALVIFVVYEVKYAKTPLIPKAISSNRGMLMILFALFCGWGAFGTW 381
           W + ++I  LVL F  L +F+++E K AK P++P  +  +R +          WGA G  
Sbjct: 298 WSNPHLIGPLVLGFVLLPLFMIWESKAAKYPVVPYGLIKDRAV----------WGALG-- 345

Query: 382 TFYYFSFVLNVRGYTAAWAGGSYFIFIV-------SGCAIATLCGFMMKKVPPSVILYIS 434
             +   F+ N      A AG  Y I IV       S   I++L  F+         LYI+
Sbjct: 346 CQFLIGFIYN------AVAGYIYTILIVAVNESVKSATVISSLSSFVSTVASTFFSLYIT 399

Query: 435 ----MIGF-MGGC 442
               + G+ +GGC
Sbjct: 400 RCTKLKGYIIGGC 412

>SAKL0G06600g Chr7 complement(549492..551381) [1890 bp, 629 aa] {ON}
           similar to uniprot|P39980 Saccharomyces cerevisiae
           YEL065W SIT1 Ferrioxamine B transporter member of the
           ARN family of transporters that specifically recognize
           siderophore-iron chelates transcription is induced
           during iron deprivation and diauxic shift potentially
           phosphorylated by Cdc28p
          Length = 629

 Score = 38.1 bits (87), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 27/43 (62%)

Query: 322 WQSAYIIVLLVLSFCALVIFVVYEVKYAKTPLIPKAISSNRGM 364
           W++A +IV L+L FC + +F  +E + A  P+ P  +  +RG+
Sbjct: 318 WRTAKVIVPLILGFCWIPVFAFWENRIATHPIAPTDMFRDRGV 360

>CAGL0E04092g Chr5 (394380..396317) [1938 bp, 645 aa] {ON} similar
           to uniprot|P38731 Saccharomyces cerevisiae YHL040c ARN1
           or uniprot|P38724 Saccharomyces cerevisiae YHL047c TAF1
          Length = 645

 Score = 38.1 bits (87), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 28/43 (65%)

Query: 322 WQSAYIIVLLVLSFCALVIFVVYEVKYAKTPLIPKAISSNRGM 364
           W ++++I   VL F  + I V++E K+A+ P+IP  +  +RG+
Sbjct: 335 WNNSHVIGPFVLGFVLIPILVLWEYKFARDPIIPYKLVKDRGV 377

>KNAG0E02560 Chr5 (506517..508253) [1737 bp, 578 aa] {ON} Anc_2.473
           YMR088C
          Length = 578

 Score = 37.7 bits (86), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 27/98 (27%), Positives = 50/98 (51%), Gaps = 4/98 (4%)

Query: 102 IISCMVSQFMSQAGLTQALSIMNILAEELNAEKSRQAWLMASFTLSMGSFILVSGRLGDI 161
           ++S  +  F+S    T   +IMN +A E  AE  ++ W+  S+ L+  +F  + G+L DI
Sbjct: 45  LLSLWLGSFVSALDGTVVANIMNSIAAEF-AESDKKQWIATSYLLTNTAFQPLYGKLSDI 103

Query: 162 YGLKKVLLGGYAILTIWSLICGFSSYSHNDAFFITSRA 199
            G K  ++  +     ++L C  + ++ N   F  +RA
Sbjct: 104 TGRKVAVITAH---FFFALGCLLTCFAQNVTQFSIARA 138

>Suva_4.553 Chr4 (959592..961280) [1689 bp, 562 aa] {ON} YBR293W
           (REAL)
          Length = 562

 Score = 37.7 bits (86), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 81/396 (20%), Positives = 160/396 (40%), Gaps = 45/396 (11%)

Query: 126 LAEELNAEKSRQAWLMASFTLSMGSFILVSGRLGDIYGLKKVLLGGYAILTIWSLICGFS 185
           +  E N + S  +W+  ++ ++  SF  + G   D  G +  L    A+ TI  L C FS
Sbjct: 85  IGNEFN-QMSISSWITTAYLITSTSFQPLYGSFSDALGRRNCLFFANAVFTIGCLACSFS 143

Query: 186 SYSHNDAFF--------ITSRAFQGLGLAFVLPNSLGLIGVIYEPGSMKKNMIIGTLGAM 237
           +  +  +F                 +  + V+P+S   I   ++      N+++G  GA+
Sbjct: 144 TNIYMLSFMRALAGIGGGGLITLSTIVNSDVIPSSKRGIFQAFQ------NLLLG-FGAI 196

Query: 238 SPIGATLGGLFAGIIGTKDPKQWPWSFYSFGIVSFCNMILSWYSIPNNIPTNIYNLS--- 294
              GA+ GG     IG      W W F     +S    +L  Y +PN    +   ++   
Sbjct: 197 C--GASFGGTITSTIG------WRWCFLIQVPISMIASLLMNYYVPNQKEYDDQKINILL 248

Query: 295 --------MDWXXXXXXXXXXXXXNFVFNQAPIVGWQSAYIIVLLVLSFCALVIFVVYEV 346
                   +D                  +      W +  +++LL+ S   +++F++ E 
Sbjct: 249 SSKKILKDIDITGSILIIAGLTLQLLYLSLGASFSWTNPPVLMLLLASIVIIILFILNER 308

Query: 347 KYAKTPLIP-KAISSNRGMLMILFALFCGWGAFGTWTFYYFSFVLNVRGYTAAWAGGSYF 405
           K     +IP + ++S+   +++  ++  G+ ++  + F    F   V G + A AG    
Sbjct: 309 KTTARAIIPMELVNSSFSFVVLSISILVGFASYA-YLFTLPLFFQIVLGDSTAKAGLRLT 367

Query: 406 IFIVSGCAIATLCGFMMKKVPP-SVILYISM-IGFMGGCVMLTVTPIHQSYFQNILGIMF 463
           I  +     + + G  M K      +LYI + + F+G  + L +     ++   ++G+ F
Sbjct: 368 IPSLFTPVGSLITGISMSKYDCLQSLLYIGIFLMFLGNFLFLFIEKTSPNW---LIGV-F 423

Query: 464 VLP--IGIDLSFPAASIILSDALPIQYQGMAGSLVY 497
           ++P  +G  ++FP        A P + Q  A S +Y
Sbjct: 424 LIPANLGQGITFPTTLFTFIFAFPKRDQATATSTLY 459

>KAFR0I01560 Chr9 (328940..330838) [1899 bp, 632 aa] {ON}  YHL040C
          Length = 632

 Score = 37.7 bits (86), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 27/43 (62%)

Query: 322 WQSAYIIVLLVLSFCALVIFVVYEVKYAKTPLIPKAISSNRGM 364
           W+ + II + VL F  + IF ++E K+A  P++P  +  +RG+
Sbjct: 311 WRDSRIIGVFVLGFVLIPIFFIWEKKFATDPIVPYKLVKDRGV 353

>TBLA0B04640 Chr2 complement(1082147..1083595) [1449 bp, 482 aa]
           {ON} Anc_6.155 YBR241C
          Length = 482

 Score = 37.7 bits (86), Expect = 0.080,   Method: Compositional matrix adjust.
 Identities = 38/145 (26%), Positives = 65/145 (44%), Gaps = 15/145 (10%)

Query: 139 WLMASFTLS--MGSFILVSGRLGDIYGLKKVLLGGYAILTIWSLICGFSSYSHNDAFFIT 196
           W+ + F+L   +GSF   +G   D YG KKV +    ++TI SL+     YS+     + 
Sbjct: 78  WITSIFSLGGLLGSFY--AGSWADHYGRKKVSIASSVVVTIGSLVL---FYSNTYLQLLI 132

Query: 197 SRAFQGLGLAFVLPNSLGLIGVIYEPGSMKKNMIIGTLGAMSPIGATLGGLFAGIIGTK- 255
            R   G+     L  +   I  I  P   +     G LGAM+ +   LG L   ++  + 
Sbjct: 133 GRTIVGIACGVYLVITPLYINEI-APAQHR-----GALGAMNQVAINLGILLTQLLALRY 186

Query: 256 -DPKQWPWSFYSFGIVSFCNMILSW 279
            D  +W W F++  ++    +++ W
Sbjct: 187 TDSFRWRWLFFAGVVLGLLTLVMWW 211

>Skud_16.503 Chr16 (880571..882202) [1632 bp, 543 aa] {ON} YPR198W
           (REAL)
          Length = 543

 Score = 37.7 bits (86), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 40/150 (26%), Positives = 63/150 (42%), Gaps = 27/150 (18%)

Query: 139 WLMASFTLSMGSFILVSGRLGDIYGLKKVLLGGYAILTIWSLICGFSSYSHNDAFFITSR 198
           WL+  + L+   F+L+ GRL +I G  + L+    I  + SLI   S+ S++    I+ R
Sbjct: 47  WLVTGYALTNAVFMLLWGRLAEILGTNECLMISVIIFEVGSLI---SALSNSMGTLISGR 103

Query: 199 AFQGLG------LAFVLPNSLGLIGVIYEPGSMKKNMIIGTLGAMSPIGATLGGLFAGII 252
              G G      LAFV+  S     ++ E     +  +I  L     I   +G    G  
Sbjct: 104 LIAGFGGSGIESLAFVVGTS-----IVQEN---HRGTMITALATSYVIAEGVGPFIGGAF 155

Query: 253 GTKDPKQWPWSFY--------SFGIVSFCN 274
              +   W W FY        +  I++FCN
Sbjct: 156 --NEHLSWRWCFYINLPIGAFALIILAFCN 183

>ZYRO0G03234g Chr7 (247798..249486) [1689 bp, 562 aa] {ON} similar
           to uniprot|Q04301 Saccharomyces cerevisiae YMR088C VBA1
           Permease of basic amino acids in the vacuolar membrane
          Length = 562

 Score = 37.7 bits (86), Expect = 0.083,   Method: Compositional matrix adjust.
 Identities = 42/142 (29%), Positives = 67/142 (47%), Gaps = 16/142 (11%)

Query: 121 SIMNILAEELNAEKSRQAWLMASFTLSMGSFILVSGRLGDIYGLKKVLLGGYAILTIWSL 180
           +IMN +AEE   E  ++ W+  SF L+  +F  + G+L DI G +  LL  +     + L
Sbjct: 55  NIMNRVAEEFE-ESDKKQWIATSFLLTNTAFQPLYGKLSDITGRRFALLTAHF---FFGL 110

Query: 181 ICGFSSYSHNDAFFITSRAFQGLGLAFVLPNSLGLIGV-----IYEPGSMK--KNMIIGT 233
            C  + ++ +   F  +RA    G+     N+   I V       E GS +   N++ GT
Sbjct: 111 GCLLTCFAQSVEQFALARAI--CGIGGGGINACSSIAVSDICTAKERGSYQGYANIVFGT 168

Query: 234 LGAMSPIGATLGGLFAGIIGTK 255
            G M  +G  +GGL    IG +
Sbjct: 169 -GQM--LGGPIGGLLIDTIGWR 187

>KLLA0C19272g Chr3 complement(1717903..1719774) [1872 bp, 623 aa]
           {ON} similar to uniprot|P38724 Saccharomyces cerevisiae
           YHL047C ARN2 Transporter or YHL040C uniprot|P38731
           Saccharomyces cerevisiae YHL040C ARN1 Transporter,
           member of the ARN family of transporters that
           specifically recognize siderophore-iron chelates
           responsible for uptake of iron bound to the siderophore
           triacetylfusarinine C,
          Length = 623

 Score = 37.7 bits (86), Expect = 0.092,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 26/43 (60%)

Query: 322 WQSAYIIVLLVLSFCALVIFVVYEVKYAKTPLIPKAISSNRGM 364
           W + ++I   VL F  L IFVV+E K+A  P+ P  +  +RG+
Sbjct: 311 WNNPHVIAPFVLGFVLLPIFVVWESKWALDPIAPFELLKDRGV 353

>Smik_5.22 Chr5 (30048..31934) [1887 bp, 628 aa] {ON} YEL065W (REAL)
          Length = 628

 Score = 37.4 bits (85), Expect = 0.097,   Method: Compositional matrix adjust.
 Identities = 34/119 (28%), Positives = 62/119 (52%), Gaps = 8/119 (6%)

Query: 322 WQSAYIIVLLVLSFCA-LVIFVVYEVKYAKTPLIPKAISSNRGMLM-ILFALFCGWGAFG 379
           W+SA+IIV  V+ +   L +++++E+KY++ PL P  +  +RG+   +L A F  +  + 
Sbjct: 312 WKSAHIIVPEVIGWVVVLPLYMLWEMKYSRHPLTPWDLIKDRGIFFALLIAFFINFNWYM 371

Query: 380 TWTFYYFSFVLNVR-GYTAAWAGGSYFIFIVSGCAIATLCGFMMKKV---PPSVILYIS 434
              + Y   V+ V     +A    S + F+     + T+ GF++ KV    P +I  IS
Sbjct: 372 QGDYMYTVLVVAVHESIKSATRITSLYSFV--SVIVGTILGFILIKVRRTKPFIIFGIS 428

>Skud_5.24 Chr5 (26839..28722) [1884 bp, 627 aa] {ON} YEL065W (REAL)
          Length = 627

 Score = 37.4 bits (85), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 34/52 (65%), Gaps = 1/52 (1%)

Query: 322 WQSAYIIVLLVLSFC-ALVIFVVYEVKYAKTPLIPKAISSNRGMLMILFALF 372
           W++A+IIV  V+ +  AL +++++E+KY++ PL P  +  +RG+   L   F
Sbjct: 312 WRTAHIIVPEVIGWVVALPLYMLWEMKYSRHPLTPWDLIKDRGIFFALLIAF 363

>YBR293W Chr2 (787006..788430) [1425 bp, 474 aa] {ON}  VBA2Permease
           of basic amino acids in the vacuolar membrane
          Length = 474

 Score = 37.4 bits (85), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 83/361 (22%), Positives = 156/361 (43%), Gaps = 43/361 (11%)

Query: 139 WLMASFTLSMGSFILVSGRLGDIYGLKKVLLGGYAILTIWSLICGFSSYSHNDAFFITSR 198
           W+  ++ ++  SF  + G   D  G +  L       TI  L CGFS   +  +F    R
Sbjct: 6   WITTAYLITSTSFQPLYGSFSDALGRRNCLFFANGAFTIGCLACGFSKNIYMLSFM---R 62

Query: 199 AFQGLGLAFVLPNSLGLIGVIYEPGSMK------KNMIIGTLGAMSPIGATLGGLFAGII 252
           A  G+G   ++  S  ++     P S +      +N+++G  GA+   GA+ GG  A  I
Sbjct: 63  ALTGIGGGGLITLS-TIVNSDVIPSSKRGIFQAFQNLLLG-FGAIC--GASFGGTIASSI 118

Query: 253 GTKDPKQWPWSFYSFGIVSFCNMILSWYSIPNNIPTNIYNLSMDWXXXXXXXXXXXXXNF 312
           G      W W F     +S  + IL  Y +PN    N  N S+               + 
Sbjct: 119 G------WRWCFLIQVPISVISSILMNYYVPNQKEYNRQNSSIFQNPGKILRDIDVMGSI 172

Query: 313 VF--------------NQAPIVGWQSAYIIVLLVLSFCALVIFVVYEVKYAKTPLIP-KA 357
           +                    + W S  +++LLV S   L++F+++E K +   +IP + 
Sbjct: 173 LIITGLTLQLLYLSLGCSTSKLSWTSPSVLLLLVGSVIILLLFILHERKTSARAIIPMEL 232

Query: 358 ISSNRGMLMILFALFCGWGAFGTWTFYYFSFVLNVRGYTAAWAGGSYFIFIVSGCAIATL 417
           ++S+  ++++  ++  G+ ++  + F    F   V G + A AG    I  +     + +
Sbjct: 233 VNSSYSVVVLSISILVGFASYA-YLFTLPLFFQIVLGDSTAKAGLRLTIPSLFTPVGSLI 291

Query: 418 CGFMMKKVPP-SVILYISM-IGFMGGCVMLTVTPIHQSYFQNILGIMFVLP--IGIDLSF 473
            GF M K     ++LYI + + F+G  + L +     ++   ++G +F++P  +G  ++F
Sbjct: 292 TGFSMSKYNCLRLLLYIGISLMFLGNFLFLFIEKTSPNW---LIG-LFLIPANLGQGITF 347

Query: 474 P 474
           P
Sbjct: 348 P 348

>YEL065W Chr5 (27657..29543) [1887 bp, 628 aa] {ON}
           SIT1Ferrioxamine B transporter, member of the ARN family
           of transporters that specifically recognize
           siderophore-iron chelates; transcription is induced
           during iron deprivation and diauxic shift; potentially
           phosphorylated by Cdc28p
          Length = 628

 Score = 37.4 bits (85), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 32/119 (26%), Positives = 63/119 (52%), Gaps = 8/119 (6%)

Query: 322 WQSAYIIVLLVLSFCALV-IFVVYEVKYAKTPLIPKAISSNRGMLM-ILFALFCGWGAFG 379
           W++A+IIV  V+ +  ++ +++++E+KY++ PL P  +  +RG+   +L A F  +  + 
Sbjct: 312 WKTAHIIVPEVIGWVVVLPLYMLWEIKYSRHPLTPWDLIQDRGIFFALLIAFFINFNWYM 371

Query: 380 TWTFYYFSFVLNVR-GYTAAWAGGSYFIFIVSGCAIATLCGFMMKKV---PPSVILYIS 434
              + Y   V+ V     +A    S + F+     + T+ GF++ KV    P +I  IS
Sbjct: 372 QGDYMYTVLVVAVHESIKSATRITSLYSFV--SVIVGTILGFILIKVRRTKPFIIFGIS 428

>KLLA0F17776g Chr6 complement(1627198..1628859) [1662 bp, 553 aa]
           {ON} weakly similar to uniprot|Q04301 Saccharomyces
           cerevisiae YMR088C VBA1 Permease of basic amino acids in
           the vacuolar membrane
          Length = 553

 Score = 37.0 bits (84), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 46/202 (22%), Positives = 91/202 (45%), Gaps = 21/202 (10%)

Query: 102 IISCMVSQFMSQAGLTQALSIMNILAEELNAEKSRQAWLMASFTLSMGSFILVSGRLGDI 161
           + +  V  +++    T   +++  +A EL+A  ++ +W+  S+ LS  +F  + G+L D+
Sbjct: 35  VFALFVGSYLAALDTTIVTTLLPTIASELDAS-NQMSWIATSYLLSCSAFQPLYGKLSDV 93

Query: 162 YGLKKVLLGGYAILTIWSLICGFSSYSHNDAFFITSRAFQGLGLAFVLPNSLGLIG---- 217
           +G K +L+          ++CG + ++ +       R   G+G   +  NSL  I     
Sbjct: 94  FGRKPLLIWSNLCFGFGCILCG-APFTKSLWMLCIGRFIAGVGGGGL--NSLSTITTSDI 150

Query: 218 VIYEPGSMKKNM--IIGTLGAMSPIGATLGGLFAGIIGTKDPKQWPWSFYSFGIVSF--C 273
           +      + + M  I+  LG  S  G+ +G      IG      W W+F     +S   C
Sbjct: 151 IPLRQRGVYQGMGNIVFALGCAS--GSLIGAFLQQRIG------WRWAFLCQVPLSLLSC 202

Query: 274 NMILSWYSIPNNIP-TNIYNLS 294
           ++I+ + ++P   P   + NLS
Sbjct: 203 SLIMKFLNLPAGSPGRGLINLS 224

>YGR224W Chr7 (942806..944647) [1842 bp, 613 aa] {ON}  AZR1Plasma
           membrane transporter of the major facilitator
           superfamily, involved in resistance to azole drugs such
           as ketoconazole and fluconazole
          Length = 613

 Score = 37.0 bits (84), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 37/153 (24%), Positives = 67/153 (43%), Gaps = 22/153 (14%)

Query: 122 IMNILAEELNAE---KSRQAWLMASFTLSMGSFILVSGRLGDIYGLKKVLLGGYAILTIW 178
           I++ + EE+  +    S   WL   ++L      L+ GR+    G K+ +L    I  I 
Sbjct: 86  IVSTIIEEVAKQFGSYSEIGWLFTGYSLPNALLALIWGRIATPIGFKETMLFAIVIFEIG 145

Query: 179 SLICGFSSYSHNDAFFITSRAFQGLG------LAFVLPNSLGLIGVIYEPGSMKKNMIIG 232
           SLI   S+ +++ +  I  R   G+G      L+FV+ ++L     + E    ++ ++I 
Sbjct: 146 SLI---SALANSMSMLIGGRVIAGVGGCGIQSLSFVIGSTL-----VEES---QRGILIA 194

Query: 233 TLGAMSPIGATLGGLFAGIIGTKDPKQWPWSFY 265
            L     I + +G    G+  +     W W FY
Sbjct: 195 VLSCSFAIASVVGPFLGGVFTSS--VTWRWCFY 225

>Kwal_26.9616 s26 (1294683..1296371) [1689 bp, 562 aa] {ON} YPR198W
           (SGE1) - Member of drug-resistance protein family
           [contig 363] FULL
          Length = 562

 Score = 37.0 bits (84), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 62/310 (20%), Positives = 109/310 (35%), Gaps = 55/310 (17%)

Query: 102 IISCMVSQFMSQAGLTQALSIMNILAEELNAEKSRQAWLMASFTLSMGSFILVSGRLGDI 161
           I S  ++ F+    +   +++ + + +  N + +   WLM  + L     +L+ GR+  +
Sbjct: 10  IFSLSLTLFLGALDIVICITLYDTIGKVFN-DYANVGWLMTGYNLPNALCMLLWGRIASL 68

Query: 162 YGLKKVLLGGYAILTIWSLICGFSSYSHNDAFFITSRAFQGLG------LAFVLPNSLGL 215
            GLK  L+    I    SL+   ++   +    I  R   G G      L F +   +  
Sbjct: 69  VGLKNSLVASIVIFEAGSLLAALAT---SMGMLIGGRVIAGFGGSGIETLVFAVGTRM-- 123

Query: 216 IGVIYEPGSMKKNMIIGTLGAMSP-IGATLGGLFAGIIGTKDPKQWPWSFY-SFGIVSFC 273
              + E    +   I+G    ++   G  +GG FA      +   W W F+ +  I    
Sbjct: 124 ---VDEKHRARVVTILGIAYMLAEGAGPFIGGAFA------EHVSWRWCFFINIPIGGVA 174

Query: 274 NMILSW-YSIPNNIPTNIYN------LSMDWXXXXXXXXXXXXXNFVFNQAPIVG----- 321
             IL W Y+     P N  N          W                  Q  IVG     
Sbjct: 175 LAILCWGYNPAGRTPINALNHYWKSYRKCSWKKVFRLTSLTKVVKLFIYQLDIVGLLLSS 234

Query: 322 ------------------WQSAYIIVLLVLSFCALVIFVVYEVKYAKTPLIPKAISSNRG 363
                             W SA II +  +    L IF++Y+  +   P I + + +   
Sbjct: 235 GGFALIMLALTFGGNKFAWNSASIICMFTIGIALLGIFMLYD--FVVLPYIGRRLENGEA 292

Query: 364 MLMILFALFC 373
           M ++ ++L C
Sbjct: 293 MPLVPWSLAC 302

>Smik_17.11 Chr17 complement(8582..10216) [1635 bp, 544 aa] {ON}
           YPR198W (REAL)
          Length = 544

 Score = 37.0 bits (84), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 38/134 (28%), Positives = 55/134 (41%), Gaps = 19/134 (14%)

Query: 138 AWLMASFTLSMGSFILVSGRLGDIYGLKKVLLGGYAILTIWSLICGFSSYSHNDAFFITS 197
            WL+  + LS   F+L+ GRL +I G  + L+    I  I SLI   S+ S+     I  
Sbjct: 46  GWLVTGYALSNAVFMLLWGRLAEILGTTECLMISVVIFEIGSLI---SALSNTMGTLIGG 102

Query: 198 RAFQGLG------LAFVLPNSLGLIGVIYEPGSMKKNMIIGTLGAMSPIGATLGGLFAGI 251
           R   G G      LAFV+  S     ++ E     + ++I  L     I   +G    G 
Sbjct: 103 RVIAGFGGSGIESLAFVVGTS-----IVQEN---YRGIMITALAVSYVIAEGVGPFIGGA 154

Query: 252 IGTKDPKQWPWSFY 265
               +   W W FY
Sbjct: 155 F--NEHLSWRWCFY 166

>KLLA0E14609g Chr5 (1302073..1303992) [1920 bp, 639 aa] {ON} similar
           to uniprot|P38731 Saccharomyces cerevisiae YHL040C ARN1
           Transporter member of the ARN family of transporters
           that specifically recognize siderophore-iron chelates
           responsible for uptake of iron bound to ferrirubin
           ferrirhodin and related siderophores
          Length = 639

 Score = 37.0 bits (84), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 14/43 (32%), Positives = 26/43 (60%)

Query: 322 WQSAYIIVLLVLSFCALVIFVVYEVKYAKTPLIPKAISSNRGM 364
           W +  I+   +L FC +  F+++E KYA+ P+ P  +  +RG+
Sbjct: 325 WSNGKILGPFILGFCLVPAFILWETKYARLPIAPFKMLKDRGI 367

>Smik_11.370 Chr11 (653235..654554) [1320 bp, 440 aa] {ON} YKR106W
           (REAL)
          Length = 440

 Score = 36.6 bits (83), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 32/67 (47%), Gaps = 10/67 (14%)

Query: 322 WQSAYIIVLLVLSFCALVIFVVYEVKYAKTPLIPKAISSNRGMLMILFALFCGWGAFGTW 381
           W+S+ II  LV      +IF+ +E  YA  PL+P  +  +RG+          W   G  
Sbjct: 168 WRSSKIIGTLVSGGVLFLIFMFWEASYAHNPLLPFKLLKDRGI----------WAPLGVA 217

Query: 382 TFYYFSF 388
            F YF+F
Sbjct: 218 FFNYFTF 224

>NDAI0I02650 Chr9 (617474..619390) [1917 bp, 638 aa] {ON} 
          Length = 638

 Score = 36.6 bits (83), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 31/120 (25%), Positives = 61/120 (50%), Gaps = 8/120 (6%)

Query: 322 WQSAYIIVLLVLSFC-ALVIFVVYEVKYAKTPLIPKAISSNRGMLMILFAL----FCGWG 376
           W++A+IIV  V+ +   L +++++E+K++K PL P A+  +RG+   L       FC W 
Sbjct: 300 WKTAHIIVPEVIGWVVCLPLYILWEMKFSKHPLTPWALLKDRGVFSALIIATMINFC-WY 358

Query: 377 AFGTWTFYYFSFVLNVRGYTAAWAGGSY-FIFIVSGCAIATLCGFMMKKVPPSVILYISM 435
             G + +      ++    +A      Y F+ +++G  +  L    +++  P +I  ISM
Sbjct: 359 MQGDYMYTVLVVAVHESVKSATRITSLYSFVSVLTGTGLG-LVLIKVRRTKPFIIFGISM 417

>SAKL0G03300g Chr7 (268199..270049) [1851 bp, 616 aa] {ON} similar
           to uniprot|P38731 Saccharomyces cerevisiae YHL040C ARN1
           Transporter member of the ARN family of transporters
           that specifically recognize siderophore-iron chelates
           responsible for uptake of iron bound to ferrirubin
           ferrirhodin and related siderophores
          Length = 616

 Score = 36.6 bits (83), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 39/77 (50%), Gaps = 16/77 (20%)

Query: 322 WQSAYIIVLLVLSFCALVIFVVYEVKYAKTPLIPKAISSNRGMLMILFALFCGWGAFGTW 381
           WQ++ II  +VL F  + +++ +E K+AK P+ P  +  +RG+          W A G  
Sbjct: 306 WQNSQIIGPIVLGFVLIPMYIYWESKWAKEPMAPFKLLKDRGV----------WAALG-- 353

Query: 382 TFYYFSFVLNVRGYTAA 398
                SF+++   Y AA
Sbjct: 354 ----ISFLIDFIFYMAA 366

>SAKL0H16808g Chr8 complement(1477137..1479110) [1974 bp, 657 aa]
           {ON} weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 657

 Score = 36.6 bits (83), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 21/76 (27%), Positives = 40/76 (52%), Gaps = 1/76 (1%)

Query: 110 FMSQAGLTQALSIMNILAEELNAEKSRQAWLMASFTLSMGSFILVSGRLGDIYGLKKVLL 169
           F++    T   +++  +A E N E    +W+  ++ LS  +F  + G++ DI+G K +L+
Sbjct: 140 FLASLDNTIVSTLLAHIASEFN-EMPHISWIATAYLLSSATFQPLYGKISDIFGRKPLLI 198

Query: 170 GGYAILTIWSLICGFS 185
               +  +  LICG S
Sbjct: 199 FSNVMFALGCLICGLS 214

>NCAS0I00110 Chr9 complement(5312..6670) [1359 bp, 452 aa] {ON} 
          Length = 452

 Score = 35.8 bits (81), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 37/77 (48%), Gaps = 16/77 (20%)

Query: 322 WQSAYIIVLLVLSFCALVIFVVYEVKYAKTPLIPKAISSNRGMLMILFALFCGWGAFGTW 381
           W ++ +I   VL F  + I  V+E K+A+ PLIP  +  +RG+          W A G  
Sbjct: 309 WNNSRVIGPFVLGFVLIPILGVWEYKWARDPLIPYKLVRDRGV----------WAALG-- 356

Query: 382 TFYYFSFVLNVRGYTAA 398
                SF+++   Y AA
Sbjct: 357 ----ISFLIDFIFYMAA 369

>KLTH0B00594g Chr2 (64332..66188) [1857 bp, 618 aa] {ON} similar to
           uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 618

 Score = 35.8 bits (81), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 39/151 (25%), Positives = 60/151 (39%), Gaps = 20/151 (13%)

Query: 121 SIMNILAEELNAEKSRQAWLMASFTLSMGSFILVSGRLGDIYGLKKVLLGGYAILTIWSL 180
           +IM  +A + N   S   WL+  + L      L+ GR G + G K  +L    I  + SL
Sbjct: 97  TIMETVAAKFNG-YSMTGWLVTGYNLPNALLSLLWGRFGTVAGFKTSMLLSIVIFEVGSL 155

Query: 181 ICGFSSYSHNDAFFITSRAFQGLG------LAFVLPNSLGLIGVIYEPGSMKKNMIIGTL 234
           I   ++ + +    I  R   G+G      L FV+ ++L    V         +++    
Sbjct: 156 I---AAAATSMTMLIGGRVISGIGGSGIQTLCFVITSTL----VTDRTRGTAISILSCAF 208

Query: 235 GAMSPIGATLGGLFAGIIGTKDPKQWPWSFY 265
              S  G  LGG FA  +       W W FY
Sbjct: 209 AVASVAGPFLGGAFATHV------TWRWCFY 233

>ZYRO0G07414g Chr7 complement(583978..586101) [2124 bp, 707 aa] {ON}
           similar to uniprot|P38731 Saccharomyces cerevisiae
           YHL040C ARN1 Transporter member of the ARN family of
           transporters that specifically recognize
           siderophore-iron chelates responsible for uptake of iron
           bound to ferrirubin ferrirhodin and related siderophores
          Length = 707

 Score = 35.8 bits (81), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 50/232 (21%), Positives = 92/232 (39%), Gaps = 39/232 (16%)

Query: 322 WQSAYIIVLLVLSFCALVIFVVYEVKYAKTPLIPKAISSNRGMLMILFALFCGWGAFGTW 381
           W  + II  LVL    L + +VYE+K+A+ P++P  +  +R +          W +    
Sbjct: 339 WDDSQIIGPLVLGVVLLPMLIVYELKWAREPILPWKLIKDRAV----------WASMSIS 388

Query: 382 TFYYFSFVLNVRGYTAAWAGGSYFIFIV-------SGCAIATLCGFMMKKVPPSVILYIS 434
             Y F F +    Y        Y + IV       S   I++L  F+     P   LYI+
Sbjct: 389 FLYDFIFYM---AYDYL-----YTVMIVAVDESVKSATRISSLSAFVSTVFSPFFALYIT 440

Query: 435 MIG-----FMGGCVMLTVTP---IH----QSYFQNILGIMFVLPIGIDLSFPAASIILSD 482
            +       + GC +  V      H    +S    I+G + V  +G  +     ++ +  
Sbjct: 441 RVTRLKPYIIAGCGLWMVAMGLLYHFRGGKSSHSGIIGGLCVWGVGTTMFTYPVNVSVQS 500

Query: 483 ALPIQYQGMAGSLVYTITNYSTSICLGMAGSVEAYHNDNGQNILKGYRNAMI 534
           A   +      SL YT+    +++ + ++G +  +  +    I K  ++A I
Sbjct: 501 ATSHENMATVTSLNYTLYRIGSAVGIAVSGCI--WTQNLYHEIFKRVKDAKI 550

>KNAG0I01910 Chr9 complement(373073..374869) [1797 bp, 598 aa] {ON} 
          Length = 598

 Score = 35.8 bits (81), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 44/219 (20%), Positives = 90/219 (41%), Gaps = 13/219 (5%)

Query: 81  QSENKVLSPKYFKNRTHEYLFIISCMVSQFMSQAGLTQALSIMNILAEELNAEKSRQAWL 140
           Q E    +P    + + ++  +    +  F S  G       +  L +E +  +S+    
Sbjct: 95  QPEEVSTAPYTLLSYSQKWGMVAVLTMCGFWSSLGSPIYYPALRQLEKEFHLNESQVNVT 154

Query: 141 MASFTLSMGSFILVSGRLGDIYGLKKVLLGGYAILTIWSL-ICGFSSYSHNDAFFITSRA 199
           +  + L  G     SG L D YG + ++LGG  +  + S+ +    SY       +  R 
Sbjct: 155 VVVYLLFQGIAPTFSGGLADRYGRRPIILGGMLVYVVASIGLARAPSY----GVIVFLRI 210

Query: 200 FQGLGLAFVLPNSLGLIGVIYEPGSMKKNMIIGTLGAMSPIGATLGGLFAGIIGTKDPKQ 259
            Q +G++  +  S G++         ++   +G       IG  +G L   +I  +    
Sbjct: 211 VQSIGISPTIAISSGVVSDYTL--KRERGTFVGATSGFVLIGQGIGPLLGAVIAAR---- 264

Query: 260 WPWSFYSFGIVSFC--NMILSWYSIPNNIPTNIYNLSMD 296
           W W    + +V  C  +M+++++ +P    T + NLS++
Sbjct: 265 WDWRAIFWFLVIGCGTSMLIAFFLLPETKRTIVGNLSIE 303

>KLTH0C10120g Chr3 (839780..841735) [1956 bp, 651 aa] {ON} similar
           to uniprot|P33335 Saccharomyces cerevisiae YPR198W SGE1
           Member of drug-resistance protein family multicopy
           suppressor of gal11 null mutation
          Length = 651

 Score = 35.8 bits (81), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 37/151 (24%), Positives = 67/151 (44%), Gaps = 18/151 (11%)

Query: 120 LSIMNILAEELNAEKSRQAWLMASFTLSMGSFILVSGRLGDIYGLKKVLLGGYAILTIWS 179
           +++   + E+ N + +   WL+  ++LS   F L+ GR+  + GLK  L+    I  I S
Sbjct: 64  VTLYETIGEKFN-DYNDVGWLVTGYSLSSALFTLLWGRMASLLGLKTCLMLSVLIFEIGS 122

Query: 180 LICGFSSYSHNDAFFITSRAFQGLGLAFVLPNSLGLIGVIYEPGS-----MKKNMIIGTL 234
           LI   ++ S++    I  R   G G +       G+  ++Y  G+       + M+I  L
Sbjct: 123 LI---AAVSNSMGMLIAGRVVAGAGGS-------GIQSLVYIVGTSLVSERSRGMVIMVL 172

Query: 235 GAMSPIGATLGGLFAGIIGTKDPKQWPWSFY 265
              + +G+  GG   G     +   W W F+
Sbjct: 173 -TFAFVGSNAGGPILG-GALNEHASWRWCFF 201

>Suva_26.1 Chr26 (1..1602) [1602 bp, 534 aa] {ON} YOL158C (REAL)
          Length = 534

 Score = 35.8 bits (81), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 24/35 (68%)

Query: 322 WQSAYIIVLLVLSFCALVIFVVYEVKYAKTPLIPK 356
           W+  YII ++V+      IF+++E+++AK P IP+
Sbjct: 302 WREGYIIAMIVVGGFLGFIFLIWELRFAKNPFIPR 336

>Kwal_26.7755 s26 (500034..501713) [1680 bp, 559 aa] {ON} YMR088C -
           1:1 [contig 55] FULL
          Length = 559

 Score = 35.8 bits (81), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 35/138 (25%), Positives = 59/138 (42%), Gaps = 23/138 (16%)

Query: 80  LQSEN-KVLSPKYFKNRTHEYL---------------FIISCMVSQFMSQAGLTQALSIM 123
           +Q EN ++LSP    N  H  L                ++S  +  F+     T   ++M
Sbjct: 5   VQDENTRLLSPVDEDNNVHSILEKEYHEQNLNLPKTPILVSLWLGSFLVALDGTIVANVM 64

Query: 124 NILAEELNAEKSRQAWLMASFTLSMGSFILVSGRLGDIYGLKKVLLGGYAILTIWSLICG 183
           N +AEE   E  ++ W+  SF L+  +F  + G+L D+   +K    G A++  +    G
Sbjct: 65  NRIAEEFQ-ESDKKQWIATSFLLTNTAFQPLYGKLSDVATGRK----GAALVAQFFFCLG 119

Query: 184 F--SSYSHNDAFFITSRA 199
              S ++ N   F   RA
Sbjct: 120 LVISCFAQNVTQFAVGRA 137

>KLTH0D00506g Chr4 (47320..49170) [1851 bp, 616 aa] {ON} similar to
           uniprot|P38731 Saccharomyces cerevisiae YHL040C ARN1
           Transporter member of the ARN family of transporters
           that specifically recognize siderophore-iron chelates
           responsible for uptake of iron bound to ferrirubin
           ferrirhodin and related siderophores
          Length = 616

 Score = 35.8 bits (81), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 36/69 (52%)

Query: 322 WQSAYIIVLLVLSFCALVIFVVYEVKYAKTPLIPKAISSNRGMLMILFALFCGWGAFGTW 381
           W + +II   VL F  + I + +E+++A+ PL+P  +  +RG+   L   F  +  F   
Sbjct: 306 WNNPHIIGPFVLGFVLVPILMFWEMRWARDPLVPYGLIKDRGVWSALAISFLNYFIFALA 365

Query: 382 TFYYFSFVL 390
             Y ++ +L
Sbjct: 366 AGYLYAILL 374

>SAKL0F00110g Chr6 (1456..3318) [1863 bp, 620 aa] {ON} similar to
           uniprot|P38724 Saccharomyces cerevisiae YHL047C ARN2
           Transporter member of the ARN family of transporters
           that specifically recognize siderophore-iron chelates
           responsible for uptake of iron bound to the siderophore
           triacetylfusarinine C
          Length = 620

 Score = 35.4 bits (80), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 29/51 (56%)

Query: 322 WQSAYIIVLLVLSFCALVIFVVYEVKYAKTPLIPKAISSNRGMLMILFALF 372
           W+SA II  +VL    +++F+ +E K A  PL P  +  +RG+   L  +F
Sbjct: 315 WRSAKIIAPIVLGSVLVLVFIYWESKLALVPLAPFKMLKDRGIWAPLLLMF 365

>ZYRO0A00330g Chr1 (19597..21327) [1731 bp, 576 aa] {ON} similar to
           uniprot|P38358 Saccharomyces cerevisiae YBR293W VBA2
           Permease of basic amino acids in the vacuolar membrane
          Length = 576

 Score = 35.4 bits (80), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 88/369 (23%), Positives = 143/369 (38%), Gaps = 44/369 (11%)

Query: 97  HEYLFIISCMVSQFMSQAGLTQALSIMNILAEELNAEKSRQAWLMASFTLSMGSFILVSG 156
           H +L   +   + F+S    T   S    +  E N      +W+ AS+ ++  SF  + G
Sbjct: 65  HLWLIEAALYTNVFLSGFDSTVTASTYQTIGNEFN-HMDLSSWITASYLITSTSFQPLYG 123

Query: 157 RLGDIYGLKKVLLGGYAILTIWSLICGFSSYSHNDAFFITSRAFQGLGLAFVLPNSLGLI 216
              D+ G +K L     I +I  L CG S    N  +    RAF G+G   ++  S  ++
Sbjct: 124 SFSDVLGRRKCLFFASMIFSIGCLGCGISI---NILWLSFMRAFTGIGGGGLITLST-IV 179

Query: 217 GVIYEPGSMK------KNMIIGTLGAMSPIGATLGGLFAGIIGTKDPKQWPWSFYSFGIV 270
                P S +      +N+++G LGA+   GA+ GG+    IG      W W F     +
Sbjct: 180 NSDMIPTSKRGIFQAFQNLLLG-LGAIC--GASFGGVITSSIG------WRWCFLLQVPI 230

Query: 271 SFCNMILSWYSIPNNIPTNIYNLSMDWXXXXXXXXXXXXXNFVF--------------NQ 316
           S    ++    + N                           F+               + 
Sbjct: 231 SLAGALIGHLYVRNQDEYERRKSKESSQTKEMLKHIDFSGAFLIIIGLTLQLVYLSLGSA 290

Query: 317 APIVG--WQSAYIIVLLVLSFCALVIFVVYEVKYAKTPLIP-KAISSNRGMLMILFALFC 373
           A   G  W S  +  +LV SF  LV+FV+ E + +   +IP K + S    L++  ++  
Sbjct: 291 ADESGNTWSSPGLSAVLVASFIVLVLFVLTEERTSARAIIPSKLVRSLFSFLVLTISVLV 350

Query: 374 GWGAFGTWTFYYFSFVLNVRGYTAAWAGGSYFI---FIVSGCAIATLCGFMMKKVPPSVI 430
           G+ ++  + F    F   + G + A AG    I   F   G  IA +C  M K      +
Sbjct: 351 GFASYA-YLFTLPLFFQVILGDSTAKAGLRLAIPSVFTPVGGLIAGIC--MSKFNCLQTL 407

Query: 431 LYISMIGFM 439
           LY+  I FM
Sbjct: 408 LYVG-IAFM 415

>NDAI0H00140 Chr8 complement(10247..12145) [1899 bp, 632 aa] {ON} 
          Length = 632

 Score = 35.4 bits (80), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 24/43 (55%)

Query: 322 WQSAYIIVLLVLSFCALVIFVVYEVKYAKTPLIPKAISSNRGM 364
           W    II   VL F  + IF  +E  +A+ PLIP A+  +RG+
Sbjct: 314 WNDGRIIGPFVLGFVLVPIFAAWEYFFARDPLIPYALIKDRGV 356

>NDAI0A02050 Chr1 complement(456678..458531) [1854 bp, 617 aa] {ON} 
          Length = 617

 Score = 35.4 bits (80), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 35/108 (32%), Positives = 57/108 (52%), Gaps = 6/108 (5%)

Query: 322 WQSAYIIVLLVLSF-CALVIFVVYEVKYAKTPLIPKAISSNRGML-MILFALFCGWGAFG 379
           W+SA IIV  V+ +  AL +++ +E K+AK PL P  +  +RG+   +L ALF  +  + 
Sbjct: 301 WKSASIIVPEVIGWLVALPLYIFWEWKFAKFPLTPWNLVKDRGVYGGLLIALFLDFAYYV 360

Query: 380 TWTFYYFSFVLNVRGYT-AAWAGGSYFIFIVSGCAIATLCG-FMMKKV 425
             T+ Y   +++      AA    + F F+  G   A L G F+ KK+
Sbjct: 361 QSTYKYTVLLVSFDTTVLAATRTNNMFTFV--GVITANLLGIFVAKKL 406

>KNAG0J02980 Chr10 (571855..573765) [1911 bp, 636 aa] {ON} 
          Length = 636

 Score = 35.4 bits (80), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 33/131 (25%), Positives = 55/131 (41%), Gaps = 25/131 (19%)

Query: 322 WQSAYIIVLLVLSFCALVIFVVYEVKYAKTPLIPKAISSNRGMLMILFALFCGWGAFGTW 381
           W  + II   VL F  + IF  +E ++A  PL+P  +  +RG+          W A G  
Sbjct: 323 WNHSNIIGPFVLGFVLIPIFSYWEARWATNPLVPYKLVKDRGV----------WAALG-- 370

Query: 382 TFYYFSFVLNVRGYTAAWAGGSYFIFIV-------SGCAIATLCGFMMKKVPPSVILYIS 434
                SF+++   Y A      Y + IV       S   I++L  F+     P V L ++
Sbjct: 371 ----ISFLIDFIFYMA--VDYLYTVLIVAVHESVKSATRISSLSSFVSTVASPIVALALT 424

Query: 435 MIGFMGGCVML 445
            +  M   +++
Sbjct: 425 RVTRMKPVIIV 435

>KLLA0E24113g Chr5 complement(2148115..2149842) [1728 bp, 575 aa]
           {ON} similar to uniprot|P38125 Saccharomyces cerevisiae
           YBR180W DTR1 Multidrug resistance dityrosine transporter
           of the major facilitator superfamily essential for spore
           wall synthesis facilitates the translocation of
           bisformyl dityrosine through the prospore membrane
          Length = 575

 Score = 35.0 bits (79), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 38/137 (27%), Positives = 58/137 (42%), Gaps = 13/137 (9%)

Query: 169 LGGYAILTIWSLICGF-------SSYSHNDAFFITSRAFQGLGLAFVLPNSLGLIGVIYE 221
            GG   L I+SL+          +   H  A +I  R FQ +G + V+P  +G +  +  
Sbjct: 173 FGGRKFLYIFSLMIALIANVLLAAVPKHLAALYIL-RVFQAIGTSAVIPLGVGTVSDLIS 231

Query: 222 PGSMKKNMIIGTLGA-MSPIGATLGGLFAGIIGTKDPKQWPWSFYSFGIVSFCNMILSWY 280
           P +  K +    LG  M PI   LG +F G+I   +  QW W F    I +   +IL   
Sbjct: 232 PMNRAKGVSYFMLGPNMGPI---LGPIFGGLI-LMNGNQWRWLFGFTSITTGVGLILIVT 287

Query: 281 SIPNNIPTNIYNLSMDW 297
            +P  +   + N    W
Sbjct: 288 FLPETLRCIVGNGDPRW 304

>Kwal_34.15711 s34 (21213..23069) [1857 bp, 618 aa] {ON} YHL047C
           (ARN2) - 1:1 [contig 275] FULL
          Length = 618

 Score = 35.0 bits (79), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 25/43 (58%)

Query: 322 WQSAYIIVLLVLSFCALVIFVVYEVKYAKTPLIPKAISSNRGM 364
           W+SA +I   VL F  + +F+ +E K A  PL P  +  +RG+
Sbjct: 313 WRSAKVIAPFVLGFLLVPVFIYWESKLALVPLAPFKMLKDRGI 355

>TDEL0H01600 Chr8 complement(273692..275506) [1815 bp, 604 aa] {ON} 
          Length = 604

 Score = 35.0 bits (79), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 23/35 (65%)

Query: 322 WQSAYIIVLLVLSFCALVIFVVYEVKYAKTPLIPK 356
           W+  +II ++V+  C  ++F V+E+  AK P IP+
Sbjct: 305 WKEGHIIAMIVVGGCCGILFFVWELWLAKKPFIPR 339

>TBLA0C01040 Chr3 (208261..210270) [2010 bp, 669 aa] {ON} 
          Length = 669

 Score = 35.0 bits (79), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 23/43 (53%)

Query: 322 WQSAYIIVLLVLSFCALVIFVVYEVKYAKTPLIPKAISSNRGM 364
           W    II    L F  + IF  +E K++K+PLIP  +  +R +
Sbjct: 356 WNHGNIIAPFALGFVLIPIFTFWEWKFSKSPLIPSKLVKDRAV 398

>Skud_7.560 Chr7 (917668..919596) [1929 bp, 642 aa] {ON} YGR224W
           (REAL)
          Length = 642

 Score = 35.0 bits (79), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 36/153 (23%), Positives = 66/153 (43%), Gaps = 22/153 (14%)

Query: 122 IMNILAEELNAE---KSRQAWLMASFTLSMGSFILVSGRLGDIYGLKKVLLGGYAILTIW 178
           I++ + EE+  +    S   WL   ++L      L+ GR+    G K+ +L    I  + 
Sbjct: 95  IVSTIIEEVAKQFGSYSEIGWLFTGYSLPNALLALIWGRIATPIGFKRTMLFAIVIFEVG 154

Query: 179 SLICGFSSYSHNDAFFITSRAFQGLG------LAFVLPNSLGLIGVIYEPGSMKKNMIIG 232
           SLI   S+ +++    I  R   G+G      L+FV+ ++L     + E     + ++I 
Sbjct: 155 SLI---SALANSMNVLIGGRVIAGVGGCGIQSLSFVIGSNL-----VEES---NRGVLIA 203

Query: 233 TLGAMSPIGATLGGLFAGIIGTKDPKQWPWSFY 265
            L     I + +G    G+  ++    W W FY
Sbjct: 204 ILSCSFAIASVVGPFLGGVFTSR--VTWRWCFY 234

>KLLA0A10439g Chr1 complement(913342..915246) [1905 bp, 634 aa] {ON}
           similar to uniprot|P38731 Saccharomyces cerevisiae
           YHL040C ARN1 Transporter member of the ARN family of
           transporters that specifically recognize
           siderophore-iron chelates responsible for uptake of iron
           bound to ferrirubin ferrirhodin and related siderophores
          Length = 634

 Score = 35.0 bits (79), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 14/47 (29%), Positives = 26/47 (55%)

Query: 322 WQSAYIIVLLVLSFCALVIFVVYEVKYAKTPLIPKAISSNRGMLMIL 368
           W + +II   +L F  +  F+ +E K+A+ P+ P  +  +RG+   L
Sbjct: 324 WNNPHIIAPFILGFVLIPFFIAWESKWAREPIAPFKLLRDRGIWAAL 370

>Kwal_56.23754 s56 complement(690851..692620) [1770 bp, 589 aa] {ON}
           YBR293W - Hypothetical ORF [contig 173] FULL
          Length = 589

 Score = 35.0 bits (79), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 23/99 (23%), Positives = 50/99 (50%), Gaps = 1/99 (1%)

Query: 88  SPKYFKNRTHEYLFIISCMVSQFMSQAGLTQALSIMNILAEELNAEKSRQAWLMASFTLS 147
           +P++  + +   + +IS  +  F++    T   +++  +  E N+   + +W+  S+ LS
Sbjct: 71  TPEFALSSSRIRIIMISMFLGIFLAALDGTIVSTLLTRIGSEFNS-LDKVSWIATSYLLS 129

Query: 148 MGSFILVSGRLGDIYGLKKVLLGGYAILTIWSLICGFSS 186
             +   + G+L D  G K +L+    + +I  LICG S+
Sbjct: 130 SSTCQPLYGKLSDQLGRKPLLVFSNVVFSIGCLICGMST 168

>KLLA0B06798g Chr2 (596500..598491) [1992 bp, 663 aa] {ON} similar
           to uniprot|P38227 Saccharomyces cerevisiae YBR043C QDR3
           Multidrug transporter required for resistance to
           quinidine barban cisplatin and bleomycin member of the
           major facilitator superfamily of transporters conferring
           multiple drug resistance (MFS-MDR)
          Length = 663

 Score = 35.0 bits (79), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 33/119 (27%), Positives = 53/119 (44%), Gaps = 9/119 (7%)

Query: 144 FTLSMGSFILVSGRLGDIYGLKKVLLGGYAILTIWSLICGFSSYSHNDAFFITSRAFQGL 203
           + LS+G F +    L +I G + V +  + +LT +++    S+ S N + FI  R  QG 
Sbjct: 155 YLLSLGIFPIWWSSLSEIEGRRTVYVLSFTLLTAFTI---GSALSPNISAFIVFRMLQGA 211

Query: 204 GLAFVLPNSLGLIGVIYEPGSMKKNMIIGTLGAMSPIGATLGGLFAGIIGTKDPKQWPW 262
             A V     G I  ++ P    KN+    LG +      +  L + IIG     +W W
Sbjct: 212 SSASVQSVGAGTISDLFIPEERGKNLGYYYLGTL------MAPLLSPIIGALLVNRWSW 264

>Skud_2.155 Chr2 complement(291487..293553) [2067 bp, 688 aa] {ON}
           YBR043C (REAL)
          Length = 688

 Score = 35.0 bits (79), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 36/145 (24%), Positives = 64/145 (44%), Gaps = 11/145 (7%)

Query: 144 FTLSMGSFILVSGRLGDIYGLKKVLLGGYAILTIWSLICGFSSYSHNDAFFITSRAFQGL 203
           + LS+G F L    + ++ G +   +  +A+L  +++   F+   ++   FI  R   G 
Sbjct: 152 YLLSLGVFPLWWSSMSELEGRRTTYITSFALLFAFNIGSAFAPDINS---FIALRMLCGA 208

Query: 204 GLAFVLPNSLGLIGVIYEPGSMKKNMIIGTLGAMSPIGATLGGLFAGIIGTKDPKQWPW- 262
             A V     G +  +Y      KN+    LG +      L  L + IIG+    +WPW 
Sbjct: 209 ASASVQSVGAGTVADLYISEDRGKNLSYYYLGPL------LAPLLSPIIGSLLVNRWPWR 262

Query: 263 -SFYSFGIVSFCNMILSWYSIPNNI 286
            + +   I+S CN+IL    +P  +
Sbjct: 263 STQWFMVILSGCNVILLTVLLPETL 287

>TPHA0K02330 Chr11 (506158..508053) [1896 bp, 631 aa] {ON} 
          Length = 631

 Score = 35.0 bits (79), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 32/131 (24%), Positives = 54/131 (41%), Gaps = 25/131 (19%)

Query: 322 WQSAYIIVLLVLSFCALVIFVVYEVKYAKTPLIPKAISSNRGMLMILFALFCGWGAFGTW 381
           W    +I   +L F  +  F ++E  +A+ PL+P  +  +RG+          W A G  
Sbjct: 319 WNHGNVIGPFILGFVLIPFFALWEKFFARDPLLPAKLVKDRGV----------WSAMG-- 366

Query: 382 TFYYFSFVLNVRGYTAAWAGGSYFIFIV-------SGCAIATLCGFMMKKVPPSVILYIS 434
                SF+++   Y A  A   Y + IV       S   I++L  F+     P   LY++
Sbjct: 367 ----ISFLIDFIYYMA--ADYLYTVLIVAVDESVKSATRISSLSSFVSTVASPFFALYLT 420

Query: 435 MIGFMGGCVML 445
               +   +ML
Sbjct: 421 RCSRLKPWIML 431

>Kpol_513.33 s513 complement(95274..97154) [1881 bp, 626 aa] {ON}
           complement(95274..97154) [1881 nt, 627 aa]
          Length = 626

 Score = 34.7 bits (78), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 28/45 (62%), Gaps = 1/45 (2%)

Query: 321 GWQSAYIIVLLVLSFC-ALVIFVVYEVKYAKTPLIPKAISSNRGM 364
           GW SA  IV  VL +  AL +F+ +E+K+A  P+ P  +  +RG+
Sbjct: 295 GWGSAKFIVPEVLGWALALPLFLTWELKFASNPITPLDLIKDRGI 339

>Suva_4.275 Chr4 complement(487620..489671) [2052 bp, 683 aa] {ON}
           YBR043C (REAL)
          Length = 683

 Score = 34.7 bits (78), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 37/136 (27%), Positives = 61/136 (44%), Gaps = 11/136 (8%)

Query: 144 FTLSMGSFILVSGRLGDIYGLKKVLLGGYAILTIWSLICGFSSYSHNDAFFITSRAFQGL 203
           + LS+G F L    L ++ G +   +  +A+L  +S+    S+ + +   FI  R   G 
Sbjct: 152 YLLSLGVFPLWWSSLSELEGRRTTYITSFAMLFAFSI---GSALAPDINSFIALRMLCGA 208

Query: 204 GLAFVLPNSLGLIGVIYEPGSMKKNMIIGTLGAMSPIGATLGGLFAGIIGTKDPKQWPW- 262
             A V     G +  +Y      KN+    LG +      L  L + IIG+    +WPW 
Sbjct: 209 ASASVQSVGAGTVADLYISEDRGKNLSYYYLGPL------LAPLLSPIIGSLLVNRWPWR 262

Query: 263 -SFYSFGIVSFCNMIL 277
            + +   I+S CN+IL
Sbjct: 263 STQWFMVILSGCNVIL 278

>Smik_18.10 Chr18 complement(16419..18014) [1596 bp, 531 aa] {ON}
           YAL067C (REAL)
          Length = 531

 Score = 34.3 bits (77), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 21/82 (25%), Positives = 37/82 (45%), Gaps = 4/82 (4%)

Query: 215 LIGVIYEPGSMKKN---MIIGTLGAMSPIGATLGGLFAGIIGTKDPKQWPWSFYSFGIVS 271
           L G  ++ G + +    MI+G    +   GA    +F  +  +     W W F   G +S
Sbjct: 199 LFGSFFKSGEVARRSGFMIVGQYAGLMSTGAMQSAIFGALNTSHGLSGWRWYFIIVGAIS 258

Query: 272 FCNMILSWYSIPNNIPTNIYNL 293
               +L +YS+P +I  N Y++
Sbjct: 259 IVVALLGFYSLPGDIH-NCYSI 279

>Suva_10.9 Chr10 complement(12679..14592) [1914 bp, 637 aa] {ON}
           YEL065W (REAL)
          Length = 637

 Score = 34.3 bits (77), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 15/42 (35%), Positives = 27/42 (64%)

Query: 321 GWQSAYIIVLLVLSFCALVIFVVYEVKYAKTPLIPKAISSNR 362
           GW++  +I + V+    L+ +V++EV +A  PL+PK +  NR
Sbjct: 330 GWKNPSMIAMEVIGGIFLISYVIFEVFFAPFPLLPKRVLVNR 371

>Ecym_4298 Chr4 complement(636605..638641) [2037 bp, 678 aa] {ON}
           similar to Ashbya gossypii AGR076C
          Length = 678

 Score = 34.3 bits (77), Expect = 0.94,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 41/80 (51%), Gaps = 1/80 (1%)

Query: 104 SCMVSQFMSQAGLTQALSIMNILAEELNAEKSRQAWLMASFTLSMGSFILVSGRLGDIYG 163
           S +V  F+     T   ++++ +A E  A     +W+ AS+ LS   F  + G+L DI+G
Sbjct: 157 SLVVGVFLGSLDGTILSTLLDYIASEFEALP-YISWIAASYLLSACIFQPLYGKLSDIFG 215

Query: 164 LKKVLLGGYAILTIWSLICG 183
            K +LL    +  +  L+CG
Sbjct: 216 RKAILLFSNLMFGLGCLVCG 235

>Kwal_23.2794 s23 (15194..17053) [1860 bp, 619 aa] {ON} YHL047C
           (ARN2) - Triacetylfusarinine C transporter [contig 246]
           FULL
          Length = 619

 Score = 34.3 bits (77), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 28/51 (54%)

Query: 322 WQSAYIIVLLVLSFCALVIFVVYEVKYAKTPLIPKAISSNRGMLMILFALF 372
           W+SA +I   VL F  + +F+ +E + A  PL P  +  +RG+   L  +F
Sbjct: 313 WRSAKVIAPFVLGFALVPVFLYWESRIALVPLAPFKMLKDRGIWAPLAIMF 363

>Smik_6.22 Chr6 complement(31536..33446) [1911 bp, 636 aa] {ON}
           YEL065W (REAL)
          Length = 636

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 26/42 (61%)

Query: 321 GWQSAYIIVLLVLSFCALVIFVVYEVKYAKTPLIPKAISSNR 362
           GW +  +I + V+    L+ +VV+EV +A  PL+PK +  NR
Sbjct: 329 GWNNPSMIAMEVVGGILLISYVVFEVFFAPFPLLPKRVLMNR 370

>ABL210C Chr2 complement(7071..8507) [1437 bp, 478 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YKL217W
           (JEN1)
          Length = 478

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 44/82 (53%), Gaps = 7/82 (8%)

Query: 126 LAEELNAEKSRQAWLM--ASFTLSMGSFILVSGRLGDIYGLKKVLLGGYAILTIWSLICG 183
           +AE+LN    +  W M  A  T ++G+  ++ G +GD +G K   +    +++I  L+ G
Sbjct: 71  IAEDLNVNDEKVTWGMTIALMTRTIGA--VLYGYIGDQFGQKASFMINIGMISILQLLTG 128

Query: 184 FSSYSHNDAFFITSRAFQGLGL 205
           F++      +FI  RA+ G+ L
Sbjct: 129 FAT---TFPYFIACRAYFGVEL 147

>TPHA0A01750 Chr1 complement(354061..355971) [1911 bp, 636 aa] {ON}
           Anc_8.272 YDR119W
          Length = 636

 Score = 33.9 bits (76), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 29/104 (27%), Positives = 48/104 (46%), Gaps = 7/104 (6%)

Query: 80  LQSENKVLSPKYFKNRTHEYLFIISCMVSQFMSQAGLTQALSIMNILAEELNAEKSRQAW 139
           L ++   LSP   +      L + S  +  F+S    T   +++  +  E N E  R +W
Sbjct: 82  LDNDKNNLSPTRLR------LAMSSMYLGIFLSALDNTIVSTLLARIGSEFN-ELPRISW 134

Query: 140 LMASFTLSMGSFILVSGRLGDIYGLKKVLLGGYAILTIWSLICG 183
           +  ++ LS  +F  + G++ DI+G K VL        I  LICG
Sbjct: 135 IATAYLLSSATFQPLYGKISDIFGRKIVLTFCNVNFFIGCLICG 178

>Skud_6.14 Chr6 complement(19547..21457) [1911 bp, 636 aa] {ON}
           YEL065W (REAL)
          Length = 636

 Score = 33.9 bits (76), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 26/42 (61%)

Query: 321 GWQSAYIIVLLVLSFCALVIFVVYEVKYAKTPLIPKAISSNR 362
           GW +  +I + V+    L+ +VV+EV +A  PL+PK +  NR
Sbjct: 329 GWNNPSMIAMEVVGGIFLISYVVFEVFFAPFPLLPKRVLMNR 370

>NCAS0A11500 Chr1 complement(2274436..2276280) [1845 bp, 614 aa]
           {ON} 
          Length = 614

 Score = 33.9 bits (76), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 32/52 (61%), Gaps = 1/52 (1%)

Query: 314 FNQAPIVGWQSAYIIVLLVLSFC-ALVIFVVYEVKYAKTPLIPKAISSNRGM 364
           F  A  + W+S  IIV  VL +  A+ +++++E+KYA+ PL P     +RG+
Sbjct: 305 FTLAGSLTWKSPKIIVPEVLGWVLAIPLYLIWELKYARYPLTPWNSIKDRGI 356

>Kpol_534.27 s534 (61814..63322) [1509 bp, 502 aa] {ON}
           (61814..63322) [1509 nt, 503 aa]
          Length = 502

 Score = 33.5 bits (75), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 37/121 (30%), Positives = 51/121 (42%), Gaps = 11/121 (9%)

Query: 162 YGLKKVLLGGYAILTIWSLICGFSSYSHNDAFFITSRAFQGLGLAFVLPNSLGLIGVIYE 221
           YG KK       I  I S I  F+S S+     I  R   GLG    + N+   I  +  
Sbjct: 119 YGRKKTAFIANIINAIGSYIL-FASNSYTS--LIIGRLIVGLGSGIFIVNAPLFISEV-T 174

Query: 222 PGSMKKNMIIGTLGAMSPIGATLGGLFAGIIGT--KDPKQWPWSFYSFGIVSFCNMILSW 279
           P S+K     G +G+M+ +   LG +          +  QW W  +   IVS CNM+L  
Sbjct: 175 PLSLK-----GLMGSMNQVSINLGIILTQFCALFFANAYQWRWILFVAFIVSICNMVLLV 229

Query: 280 Y 280
           Y
Sbjct: 230 Y 230

>SAKL0D11286g Chr4 (938289..941777) [3489 bp, 1162 aa] {ON} some
           similarities with uniprot|P47107 Saccharomyces
           cerevisiae YJR039W Hypothetical ORF
          Length = 1162

 Score = 33.9 bits (76), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 43/77 (55%), Gaps = 8/77 (10%)

Query: 456 QNILGIMFVLPIGIDLSFPAASIILSD--ALPIQYQGMAGSLVYTITNYSTSI----CLG 509
           Q+++ +  V    I  ++P A  I+SD  A+P++ + ++G  +   T+Y+  +    CL 
Sbjct: 756 QDLIKVSTVATYDISENYPQA--IVSDMTAVPVRRKLLSGQFIDNETSYAKQLTLEKCLL 813

Query: 510 MAGSVEAYHNDNGQNIL 526
           +A + E+  +D G N+L
Sbjct: 814 VALNYESAEDDTGDNLL 830

>YHL040C Chr8 complement(19088..20971) [1884 bp, 627 aa] {ON}
           ARN1Transporter, member of the ARN family of
           transporters that specifically recognize
           siderophore-iron chelates; responsible for uptake of
           iron bound to ferrirubin, ferrirhodin, and related
           siderophores
          Length = 627

 Score = 33.5 bits (75), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 44/212 (20%), Positives = 85/212 (40%), Gaps = 37/212 (17%)

Query: 322 WQSAYIIVLLVLSFCALVIFVVYEVKYAKTPLIPKAISSNRGMLMILFALFCGWGAFGTW 381
           W  + +I   VL F  + I  ++E ++A+ P++P  +  +R +          W + G  
Sbjct: 318 WNDSRLIGPFVLGFVLIPILWIWEYRFARDPILPYRLVKDRAV----------WSSMG-- 365

Query: 382 TFYYFSFVLNVRGYTAAWAGGSYFIFIV-------SGCAIATLCGFMMKKVPPSVILYIS 434
                SF+++   Y A  A   Y + IV       S   IATL  F+     P   L ++
Sbjct: 366 ----ISFLIDFIYYMA--ADYLYTVMIVAVNESVKSATRIATLSSFVSTVASPFFALLVT 419

Query: 435 MIG-----FMGGCVMLTVTPIHQSYFQ-------NILGIMFVLPIGIDLSFPAASIILSD 482
                    M GC +  V      +F+        I+G + V  +G  L     ++ +  
Sbjct: 420 RCTRLKPFIMFGCALWMVAMGLLYHFRGGSQSHSGIIGALCVWGVGTTLFTYPVTVSVQS 479

Query: 483 ALPIQYQGMAGSLVYTITNYSTSICLGMAGSV 514
           A+  +      +L YT+    +++   ++G++
Sbjct: 480 AVSHENMATVTALNYTLYRIGSAVGSAVSGAI 511

>CAGL0J09020g Chr10 (889269..891839) [2571 bp, 856 aa] {ON} highly
           similar to uniprot|P10870 Saccharomyces cerevisiae
           YDL194w SNF3 or uniprot|Q12300 Saccharomyces cerevisiae
           YDL138w RGT2
          Length = 856

 Score = 33.5 bits (75), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 40/76 (52%), Gaps = 5/76 (6%)

Query: 135 SRQAWLMASFTLSMGSFI--LVSGRLGDIYGLKKVLLGGYAILTIWSLICGFSSYSHNDA 192
           ++Q  ++ SF LS+G+F+  L +  + D YG KK ++  ++   ++SL       +HN  
Sbjct: 162 AQQLAILVSF-LSLGTFVGALSAPVISDKYGRKKTIM--FSTAVVFSLGNSLQVGAHNIQ 218

Query: 193 FFITSRAFQGLGLAFV 208
             I  R   GLG+  V
Sbjct: 219 LLIAGRVISGLGVGLV 234

>Suva_14.276 Chr14 (502686..504374) [1689 bp, 562 aa] {ON} YNL065W
           (REAL)
          Length = 562

 Score = 33.5 bits (75), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 43/177 (24%), Positives = 76/177 (42%), Gaps = 21/177 (11%)

Query: 126 LAEELNAEKSRQAWLMASFTLSMGSFILVSGRLGDIYGLKKVLLGGYAILTIWS--LICG 183
           L +E N +++     +  + +  G    V G L D +G + ++LGG  +  + S  L C 
Sbjct: 127 LEKEFNVDENMINITVVVYLMFQGIAPTVCGGLADCFGRRPIILGGMLVYVVASVGLACA 186

Query: 184 FSSYSHNDAFFITSRAFQGLGLAFVLPNSLGLIG---VIYEPGSMKKNMIIGTLGAMSPI 240
             SY       I  R  Q +G++  +  S G++G   + +E G+         +GA S  
Sbjct: 187 -PSY----GVIIFLRCVQSIGISPTIAISSGVVGDFTLKHERGTF--------VGATSGF 233

Query: 241 GATLGGLFAGIIGTKDPKQWPWS--FYSFGIVSFCNMILSWYSIPNNIPTNIYNLSM 295
              LG  F  +IG     +W W   F+   I      +++++ +P    T   NLS+
Sbjct: 234 -VLLGQCFGSLIGAVLTARWDWRSIFWFLTIGCGTCFLIAFFILPETKRTIAGNLSV 289

>ZYRO0D13310g Chr4 complement(1118820..1120670) [1851 bp, 616 aa]
           {ON} similar to uniprot|P43581 Saccharomyces cerevisiae
           YFL011W HXT10 Putative hexose transporter expressed at
           low levels and expression is repressed by glucose
          Length = 616

 Score = 33.5 bits (75), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 35/157 (22%), Positives = 64/157 (40%), Gaps = 37/157 (23%)

Query: 30  IDATPESKERKDYFQLKKNYSQDSQTNTSMNEVIGXXXXXXXXXXXXXENLQSENKVLSP 89
           I  TP ++ R +  +   NYS  SQ  T                    E+L+ ++   + 
Sbjct: 65  IYRTPTNRSRDETIEYSSNYSHFSQKLTPEKS----------------EHLEIDSIPSTE 108

Query: 90  KYFKNRTHEYLFIISCM---------------VSQFMSQAGLTQALSIMNILAEELNAEK 134
           K   + T+ +  I SC+               +S F++     +     +   EE    +
Sbjct: 109 K--GSVTNHWSIICSCLMIAFGGFVFGWDTGTISGFINMTDFKRRFGHWDSTNEEFQLSE 166

Query: 135 SRQAWLMASFTL--SMGSFILVSGRLGDIYGLKKVLL 169
           +R   +++ F +  ++G F L  GRLGDIYG ++ L+
Sbjct: 167 ARMGLIVSVFNVGCAIGGFTL--GRLGDIYGRREGLM 201

>Kwal_14.782 s14 (42720..44195) [1476 bp, 491 aa] {ON} YGR260W
           (TNA1) - Tna1p is a high affinity nicotinic acid plasma
           membrane permease [contig 245] FULL
          Length = 491

 Score = 33.1 bits (74), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 26/113 (23%), Positives = 45/113 (39%), Gaps = 6/113 (5%)

Query: 178 WSLICGFSSYSHNDAFFITSRAFQGLGLAFVLPNSLGLIGVIYEPGSMKKNMIIGTLGAM 237
           WS+I   S +  +    + +R   G       P    LI ++Y+P    K   I      
Sbjct: 127 WSVITLSSGFVQSYGSLLATRILLGTFEGGFFPAMTLLITMMYKPKEQAKR--IAFFFGS 184

Query: 238 SPIGATLGGL----FAGIIGTKDPKQWPWSFYSFGIVSFCNMILSWYSIPNNI 286
           S +    GGL     A +  T   + W W +   G++S C     ++ +P+N+
Sbjct: 185 SALSGAFGGLIATGLASVKSTSGLEGWRWLYIIEGLISVCATAWLFFGLPDNL 237

>KNAG0K01020 Chr11 complement(198213..200012) [1800 bp, 599 aa] {ON}
           
          Length = 599

 Score = 33.1 bits (74), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 36/150 (24%), Positives = 63/150 (42%), Gaps = 17/150 (11%)

Query: 121 SIMNILAEELNAEKSRQAWLMASFTLSMGSFILVSGRLG-DIYGLKKVLLGGYAILTIWS 179
           +I+N +    +A  ++  W++A ++L      L+ GR+     G K  +L    I  I S
Sbjct: 80  TIINDVGAHFDAY-AKTGWIIAGYSLPNALMSLLWGRIAFSFLGFKTAMLSAIVIFEIGS 138

Query: 180 LICGFSSYSHNDAFFITSRAFQGLGLAFVLPNSLGLIGVIYEPGSMKKNMII----GTLG 235
           LIC   + +++    I  R   G+G + +   S  +   +  P    +  II     + G
Sbjct: 139 LIC---ALANSMDMLIGGRVIAGIGGSGIQSLSFVIGSTLVSPRG--RGFIIAFMSASFG 193

Query: 236 AMSPIGATLGGLFAGIIGTKDPKQWPWSFY 265
             S IG  +GG F   +       W W F+
Sbjct: 194 IASVIGPFIGGAFTSHV------TWRWCFW 217

>KLTH0E16720g Chr5 (1482846..1484570) [1725 bp, 574 aa] {ON} similar
           to uniprot|P38358 Saccharomyces cerevisiae YBR293W VBA2
           Permease of basic amino acids in the vacuolar membrane
          Length = 574

 Score = 33.1 bits (74), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 97/436 (22%), Positives = 173/436 (39%), Gaps = 54/436 (12%)

Query: 94  NRTHEYLFIISCMVSQ-FMSQAGLTQALSIMNILAEELNAEKSRQAWLMASFTLSMGSFI 152
           +  H+ L I + + +  F+S    T + S   ++  E    K   +W+  ++ ++  SF 
Sbjct: 37  SERHKVLLIETALFTNVFLSGLDSTISASTYQLIGNEFGDVK-LSSWITTAYLITCTSFQ 95

Query: 153 LVSGRLGDIYGLKKVLLGGYAILTIWSLICGFSSYSHNDAFFITSRAFQGLGLAFVLPNS 212
            + G   D  G +  L     I  +    CG ++  ++    I  RA  G+G   ++  S
Sbjct: 96  PLYGSFSDTLGRRHCLFFANTIFALGCFGCGTTTTIYS---LILMRALTGIGGGGLITLS 152

Query: 213 LGLIGVIYEPGSMK------KNMIIGTLGAMSPIGATLGGLFAGIIGTKDPKQWPWSFYS 266
             +I     P   +      +N+++GT GA+  +GA+ GGL A  +G      W W F  
Sbjct: 153 -TIINSDIIPAKKRGIYQAFQNVLLGT-GAV--VGASCGGLIATTMG------WRWCFLL 202

Query: 267 FGIVSFCNMILSWYSIPNNIP-----------TNIYNLS-MDWXXXXXXXXXXXXXNFVF 314
              +S    +++++ + +  P           T    L  +D+              F  
Sbjct: 203 QVPISVGGTLVAFFFVHDQRPDINGGVSAVRTTGWEKLEKIDFSGALLLVLGLACQLFFL 262

Query: 315 -----NQAPIVGWQSAYIIVLLVLSFCALVIFVVYEVKYAKTPLIPKA-ISSNRGMLMIL 368
                +++    W S   IVL + +  +L++F   E      P+IP   +    G  +++
Sbjct: 263 TLNSTSKSSESYWYSPQSIVLTLSTGVSLILFAYVEHTTKANPIIPHDLLRQAHGATVLI 322

Query: 369 FALFCGWGAFGTWTFYYFSFVLN---VRGYTAAWAGGSYFIFIVSGCAI--ATLCGFMMK 423
            ++  G+ A+     Y F+  L    V G TAA AG    + + S C      + G  MK
Sbjct: 323 ISVLVGFVAYA----YIFTLPLYFQVVIGDTAAKAG--LRLTVPSFCTPIGGLITGLSMK 376

Query: 424 KVPPSVILYISMIGFM--GGCVMLTVTPIHQSYFQNILGIMFVLPIGIDLSFPAASIILS 481
                 +L IS I  M  G    L + P    Y+Q  L ++    +G  ++FP+      
Sbjct: 377 NPNHLPVLLISGITCMLLGNLCFLFIKP-WTPYWQTSL-LLVPANVGQGITFPSTLFTFL 434

Query: 482 DALPIQYQGMAGSLVY 497
            A P   Q  A S +Y
Sbjct: 435 FAFPPYKQATATSTLY 450

>SAKL0E08756g Chr5 complement(714902..716599) [1698 bp, 565 aa] {ON}
           similar to uniprot|P53943 Saccharomyces cerevisiae
           YNL065W AQR1 Plasma membrane transporter of the major
           facilitator superfamily that confers resistance to
           short- chain monocarboxylic acids and quinidine
          Length = 565

 Score = 33.1 bits (74), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 60/286 (20%), Positives = 114/286 (39%), Gaps = 24/286 (8%)

Query: 21  SLSTAETLDIDATPESKERKDYFQLKKNYSQ------DSQTNTSMNEVIGXXXXXXXXXX 74
           S+ + +T + +     +E K+  Q K N+        +S + T+  EV            
Sbjct: 14  SILSDDTFNENQNGTEQEVKELVQGKNNFKGLKGDNVNSLSRTTTREVRATPSESDLDTY 73

Query: 75  XXXENLQSENKVLSPKYFKNRTH-EYLFIISCMVSQ-FMSQAGLTQALSIMNILAEELNA 132
              E   + +KV     +   TH +  F+++ + S  F S  G       +  L +  N 
Sbjct: 74  TDAE---TPDKVSCETPYTLMTHGQKWFMVALLTSGGFWSSLGSPIYYPALKQLEQVFNI 130

Query: 133 EKSRQAWLMASFTLSMGSFILVSGRLGDIYGLKKVLLGGYAILTIWS--LICGFSSYSHN 190
            +      +  + +  G    +SG L D+YG + ++L G  I  + S  L C   S S+ 
Sbjct: 131 NEEMVNITVVVYFIFQGVAPTISGGLADVYGRRPIILAGMLIYVVASIGLAC---SNSYG 187

Query: 191 DAFFITSRAFQGLGLAFVLPNSLGLIGVIYEPGSMKKNMIIGTLGAMSPIGATLGGLF-A 249
              F+  R  Q  G++ ++  S G++G        ++   +G +   + +G   G L  A
Sbjct: 188 VIVFL--RCVQSAGISPLIAISSGVVGDFTTKS--ERGSFVGAVSGFALMGQAFGSLIGA 243

Query: 250 GIIGTKDPKQWPWSFYSFGIVSFCNMILSWYSIPNNIPTNIYNLSM 295
           G+    D   W   F+   I      +++++ +P    T   NLS+
Sbjct: 244 GLTAAYD---WRAIFWFLTIGCGTCFVINFFLLPETKRTITGNLSI 286

>AFR333W Chr6 (1041317..1042819) [1503 bp, 500 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YKL217W (JEN1)
          Length = 500

 Score = 33.1 bits (74), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 23/89 (25%), Positives = 51/89 (57%), Gaps = 8/89 (8%)

Query: 119 ALSIMNILAEELNAEKSRQAW--LMASFTLSMGSFILVSGRLGDIYGLKKVLLGGYAILT 176
           +L++++I A++LN  +    W   +A  T ++G+  +V G +GD +G +   L    +++
Sbjct: 65  SLNVVSI-AQDLNVREDTVTWGITVALMTRTIGA--IVYGYIGDRFGQRTSFLINVGMIS 121

Query: 177 IWSLICGFSSYSHNDAFFITSRAFQGLGL 205
           +  L+ GF++   +  +F+  RA+ G+ L
Sbjct: 122 VLQLVTGFAT---SFPYFLACRAYFGIEL 147

>KLTH0A07964g Chr1 complement(670591..672450) [1860 bp, 619 aa] {ON}
           similar to uniprot|P38724 Saccharomyces cerevisiae
           YHL047C ARN2 Transporter member of the ARN family of
           transporters that specifically recognize
           siderophore-iron chelates responsible for uptake of iron
           bound to the siderophore triacetylfusarinine C
          Length = 619

 Score = 33.1 bits (74), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 27/51 (52%)

Query: 322 WQSAYIIVLLVLSFCALVIFVVYEVKYAKTPLIPKAISSNRGMLMILFALF 372
           W+S  +I   VL F  +  FV +E + A+ PL P  +  +RG+   L+  F
Sbjct: 313 WRSGKVIAPFVLGFSLIPAFVYWESRLARFPLAPFLMLKDRGIWAPLWIYF 363

>Skud_8.3 Chr8 complement(7094..8989) [1896 bp, 631 aa] {ON} YHL040C
           (REAL)
          Length = 631

 Score = 33.1 bits (74), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 14/43 (32%), Positives = 24/43 (55%)

Query: 322 WQSAYIIVLLVLSFCALVIFVVYEVKYAKTPLIPKAISSNRGM 364
           W  + +I   VL F  + I  V+E  YA+ P++P  +  +RG+
Sbjct: 322 WNDSRLIGPFVLGFVLIPILWVWEYSYARDPILPYKLVKDRGV 364

>AAR192C Chr1 complement(686882..688384) [1503 bp, 500 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YKL217W
           (JEN1)
          Length = 500

 Score = 33.1 bits (74), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 21/82 (25%), Positives = 46/82 (56%), Gaps = 7/82 (8%)

Query: 126 LAEELNAEKSRQAW--LMASFTLSMGSFILVSGRLGDIYGLKKVLLGGYAILTIWSLICG 183
           +AE+L+  + +  W   +A  T ++G+  +V G +GD +G +   L    ++++  L+ G
Sbjct: 71  IAEDLHVREDKVTWGITVALMTRTIGA--IVYGYVGDRFGQRTSFLINIGMISVLQLVTG 128

Query: 184 FSSYSHNDAFFITSRAFQGLGL 205
           F++   +  +F+  RA+ G+ L
Sbjct: 129 FAT---SFPYFLACRAYFGVEL 147

>KLTH0D05434g Chr4 (486319..488049) [1731 bp, 576 aa] {ON} similar
           to uniprot|Q04301 Saccharomyces cerevisiae YMR088C VBA1
           Permease of basic amino acids in the vacuolar membrane
          Length = 576

 Score = 33.1 bits (74), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 27/103 (26%), Positives = 47/103 (45%), Gaps = 3/103 (2%)

Query: 102 IISCMVSQFMSQAGLTQALSIMNILAEELNAEKSRQAWLMASFTLSMGSFILVSGRLGDI 161
           ++S  +  F+     T   ++MN +AEE   E  ++ W+  SF L+  +F  + G+L D+
Sbjct: 43  LVSLWLGSFLVALDGTIVANVMNRIAEEFQ-ESDKKQWIATSFLLTNTAFQPLYGKLSDV 101

Query: 162 YGLKKVLLGGYAILTIWSLICGFSSYSHNDAFFITSRAFQGLG 204
              +K+            LI   S ++ N   F   RA  G+G
Sbjct: 102 ATGRKLATLIAQFFFFLGLI--ISCFAQNVTQFAIGRAVCGIG 142

>Kwal_14.722 s14 (9019..10854) [1836 bp, 611 aa] {ON} YCL073C -
           Hypothetical ORF [contig 245] FULL
          Length = 611

 Score = 33.1 bits (74), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 27/51 (52%)

Query: 322 WQSAYIIVLLVLSFCALVIFVVYEVKYAKTPLIPKAISSNRGMLMILFALF 372
           W    II  LV+    L++F+ +E K+AK   +P  +  +RG+   + A F
Sbjct: 306 WHEPGIIATLVIGIALLLVFLFWEAKFAKNAALPFNLLKDRGVWASIVAAF 356

>SAKL0D04070g Chr4 (331254..333257) [2004 bp, 667 aa] {ON} similar
           to uniprot|P38227 Saccharomyces cerevisiae YBR043C QDR3
           Multidrug transporter required for resistance to
           quinidine barban cisplatin and bleomycin member of the
           major facilitator superfamily of transporters conferring
           multiple drug resistance (MFS-MDR)
          Length = 667

 Score = 32.7 bits (73), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 32/119 (26%), Positives = 50/119 (42%), Gaps = 9/119 (7%)

Query: 144 FTLSMGSFILVSGRLGDIYGLKKVLLGGYAILTIWSLICGFSSYSHNDAFFITSRAFQGL 203
           + +S+G F L    + ++ G + V L  + +L  +   C  ++ S N   FI  R   G 
Sbjct: 144 YLISLGVFPLWWSSISELKGRRTVYLVSFTLLFAF---CIGTAVSPNIQAFIILRVLCGA 200

Query: 204 GLAFVLPNSLGLIGVIYEPGSMKKNMIIGTLGAMSPIGATLGGLFAGIIGTKDPKQWPW 262
             A V     G I  +Y P    KN+    LGA++        L + IIG+     W W
Sbjct: 201 SSASVQSVGAGTIADLYAPEERGKNLGYFYLGALT------APLLSPIIGSLLVNHWSW 253

>KLTH0B00110g Chr2 complement(1655..3538) [1884 bp, 627 aa] {ON}
           similar to uniprot|P25596 Saccharomyces cerevisiae
           YCL073C and similar to uniprot|P36173 Saccharomyces
           cerevisiae YKR106W
          Length = 627

 Score = 32.7 bits (73), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 12/43 (27%), Positives = 26/43 (60%)

Query: 322 WQSAYIIVLLVLSFCALVIFVVYEVKYAKTPLIPKAISSNRGM 364
           W    II  +V+ F + + F+ +++K+AK  ++P  +  +RG+
Sbjct: 320 WNKPGIIATIVVGFVSFMFFLAWDIKFAKNAVLPFKLLKDRGV 362

>SAKL0F00198g Chr6 complement(10713..12326) [1614 bp, 537 aa] {ON}
           similar to uniprot|P36172 Saccharomyces cerevisiae
           YKR105C Hypothetical ORF
          Length = 537

 Score = 32.3 bits (72), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 90/440 (20%), Positives = 160/440 (36%), Gaps = 70/440 (15%)

Query: 123 MNILAEELNAEKSRQAWLMASFTLSMGSFILVSGRLGDIYGLKKVLLGGYAILTIWSLIC 182
           + +++E+ N + S+  W+++ ++L      L+ GR   I+G K  LL    I    SLI 
Sbjct: 65  IEVISEQFN-DYSKSGWIVSGYSLPEALLTLLWGRFATIFGFKLSLLLSILIFETGSLI- 122

Query: 183 GFSSYSHNDAFFITSRAFQGLG------LAFVLPNSLGLIGVIYEPGSMKKNMIIGTLGA 236
             S+ S++    I  R   G+G      L FV+ ++L             + + I  L  
Sbjct: 123 --SAVSNSMNVLIGGRVVAGIGGSGIQSLCFVIASTL--------TTERSRGVAISVLSC 172

Query: 237 MSPIGATLGGLFAGIIGTKDPKQWPWSFY---SFGIVSFCNMILSWYSIPNNIPTNIYNL 293
              + A           T     W W FY     G ++F  ++L++     N   +I ++
Sbjct: 173 AYAVAAVASPFMGSAFTTH--VTWRWCFYINLPIGGLAFAVLVLTYKPHEGNSARSIVSV 230

Query: 294 -------------SMDWXXXXXXXXXXXXXN----------FVFNQAPIVG-----WQSA 325
                        S D                          +F      G     W S 
Sbjct: 231 LKSCCEFGTARLFSKDLYLKMFNELVFGFDFIGFIFCSVGFILFRLGLTFGGDKYTWSSG 290

Query: 326 YIIVLLVLSFCALVIFVVYEV----KYAKT-------PLIPKAISSNRGMLMILFALFCG 374
            IIV  V+     V F++Y+     K+ +        PL+P ++ S  G+   + A F  
Sbjct: 291 AIIVYFVVGVTISVAFLLYDFMVFPKFGRVRKNASFRPLVPWSVVSRPGIATAVAANFLM 350

Query: 375 WGAFGTWTFYYFSFVLNVRGYTAAWAGGSYFIFI----VSGCAIATLCGFMMKKVPPSVI 430
             A+     Y   F   VRG + AW    + + +    +   AI+     M   V P  I
Sbjct: 351 CVAYSAQVVYIIQFFQLVRG-SDAWRASIHVVALEIPDIITVAISGAISRMTGHVKP--I 407

Query: 431 LYISMIGFMGGCVMLTVTPIHQSYFQNILGIMFVLPIGIDLSFPAASIILSDALPIQYQG 490
           +++ +I  + G  +LT+        ++I G++ +  +        + +     +P     
Sbjct: 408 IFVGIIAGLVGAGLLTLLDNDSGSSKHI-GLLILPGVAFGAMLQGSLLSCQLQIPKDSAS 466

Query: 491 MAGSLVYTITNYSTSICLGM 510
                V T T ++ SI LGM
Sbjct: 467 FMPDFVSTTTVHTFSISLGM 486

>KLTH0G13464g Chr7 complement(1154304..1156085) [1782 bp, 593 aa]
           {ON} weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 593

 Score = 32.3 bits (72), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 23/98 (23%), Positives = 47/98 (47%), Gaps = 1/98 (1%)

Query: 88  SPKYFKNRTHEYLFIISCMVSQFMSQAGLTQALSIMNILAEELNAEKSRQAWLMASFTLS 147
           S +++   +   + + S  +  F++    T   +++  +  E N+   + +W+  S+ LS
Sbjct: 75  SAEFYLPSSRILIIMFSMFLGIFLAALDGTIVSTLLTHIGSEFNSLD-KASWIATSYLLS 133

Query: 148 MGSFILVSGRLGDIYGLKKVLLGGYAILTIWSLICGFS 185
             +   + G+L D  G K +L+   A+  I  LICG S
Sbjct: 134 SSTCQPLYGKLSDRLGRKPLLVFSNAVFAIGCLICGLS 171

>KLTH0D00110g Chr4 (796..2658) [1863 bp, 620 aa] {ON} similar to
           uniprot|P38724 Saccharomyces cerevisiae YHL047C ARN2
           Transporter member of the ARN family of transporters
           that specifically recognize siderophore-iron chelates
           responsible for uptake of iron bound to the siderophore
           triacetylfusarinine C
          Length = 620

 Score = 32.3 bits (72), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 30/55 (54%), Gaps = 4/55 (7%)

Query: 322 WQSAYIIVLLVLSFCALVIFVVYEVKYAKTPLIPKAISSNRGM---LMILFALFC 373
           W+SA +I  LVL    +  F+ +E K A  PL P  +  +RG+   L+I F L C
Sbjct: 315 WRSAKVIAPLVLGSLLVPFFIYWESKLALVPLAPFKMLKDRGIWAPLLITF-LIC 368

>KLTH0B10450g Chr2 complement(885429..887291) [1863 bp, 620 aa] {ON}
           similar to uniprot|P38724 Saccharomyces cerevisiae
           YHL047C ARN2 Transporter member of the ARN family of
           transporters that specifically recognize
           siderophore-iron chelates responsible for uptake of iron
           bound to the siderophore triacetylfusarinine C
          Length = 620

 Score = 32.3 bits (72), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 30/55 (54%), Gaps = 4/55 (7%)

Query: 322 WQSAYIIVLLVLSFCALVIFVVYEVKYAKTPLIPKAISSNRGM---LMILFALFC 373
           W+SA +I  LVL    +  F+ +E K A  PL P  +  +RG+   L+I F L C
Sbjct: 315 WRSAKVIAPLVLGSLLVPFFIYWESKLALVPLAPFKMLKDRGIWAPLLITF-LIC 368

>Suva_8.12 Chr8 complement(20611..22512) [1902 bp, 633 aa] {ON}
           YHL040C (REAL)
          Length = 633

 Score = 32.3 bits (72), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 14/43 (32%), Positives = 24/43 (55%)

Query: 322 WQSAYIIVLLVLSFCALVIFVVYEVKYAKTPLIPKAISSNRGM 364
           W  + +I   VL F  + I  V+E + A+ P+IP  +  +RG+
Sbjct: 323 WNDSRLIGPFVLGFVLIPILWVWEYRVARDPIIPYKLVKDRGV 365

>KLTH0H02728g Chr8 complement(242682..244436) [1755 bp, 584 aa] {ON}
           similar to uniprot|P39709 Saccharomyces cerevisiae
           YAL067C SEO1 Putative permease member of the allantoate
           transporter subfamily of the major facilitator
           superfamily mutation confers resistance to ethionine
           sulfoxide
          Length = 584

 Score = 32.3 bits (72), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 51/200 (25%), Positives = 88/200 (44%), Gaps = 21/200 (10%)

Query: 104 SCMV--SQFMSQAGLTQALSIMNILAEELNAEKSRQAWLMASFTLSMGSFILVSGRLGDI 161
           SCM    +++  A L  A   ++ L EELN + +      A +T+  G+ +    +L  I
Sbjct: 142 SCMAYWVKYLDTANLNNAY--VSGLKEELNFKGNELVETQAMYTV--GNIVF---QLPFI 194

Query: 162 YGLKKVLLGGY--AILTIWSLICGFSSYSHNDAFFITSRAFQGLGLAFVLPNSLG---LI 216
           + L KV L     A+   WS++   +S   +       R F G+   F  P+ L    L 
Sbjct: 195 FFLDKVPLNYVLPALDLCWSILTIGASQVDSVPHLKAIRFFIGV---FEAPSYLAYQYLF 251

Query: 217 GVIYEPGSMKKNMIIGTLGAMSPIGATLG---GLFAGIIGTKDPKQWPWSFYSFGIVSFC 273
           G  Y+   M +      LG  + I +  G    ++A + G      W W+F   G++S  
Sbjct: 252 GSFYKHDEMVRRSAFYYLGQYAGILSASGIQSAIYAAMDGKHGLSGWRWNFIVDGLISVV 311

Query: 274 NMILSWYSIPNNIPTNIYNL 293
             ++ +YS+P + P N Y++
Sbjct: 312 VGLIGFYSLPGD-PHNCYSI 330

>KLTH0E03234g Chr5 complement(293162..294727) [1566 bp, 521 aa] {ON}
           similar to uniprot|P15365 Saccharomyces cerevisiae
           YJR152W DAL5 Allantoin permease;ureidosuccinate
           permease; expression is constitutive but sensitive to
           nitrogen catabolite repression
          Length = 521

 Score = 32.3 bits (72), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 37/153 (24%), Positives = 64/153 (41%), Gaps = 7/153 (4%)

Query: 109 QFMSQAGLTQALSIMNILAEELNAEKSRQAWLMASFTLSMGSFILVSGRLGDIYGLKKVL 168
           Q+M +   + A SIM  L ++L    ++ +W+   F L    F + S      + + KV 
Sbjct: 89  QYMDKQTNSYA-SIMG-LRKDLKMHGNQYSWVGTCFYLGYMIFEIPSSLALQRFPIAKV- 145

Query: 169 LGGYAILTIWSLICGFSSYSHNDAFFITSRAFQGLGLAFVLPNSLGLIGVIYEPGSMKKN 228
                 + +W  +   +S   N A FI +R   G+  + V P  + L    Y     ++ 
Sbjct: 146 --SAVFIVLWGFVLCMTSLPKNYASFIATRTVLGILESAVTPAFMLLTSQWYR--REEQF 201

Query: 229 MIIGTLGAMSPIGATLGGLFAGIIGTKDPKQWP 261
           +      A + +GA LG L A  +  +DP   P
Sbjct: 202 LRTSIWSASAGLGAILGSLIAYGLAVRDPSSLP 234

>NCAS0G02990 Chr7 complement(549460..551205) [1746 bp, 581 aa] {ON} 
          Length = 581

 Score = 32.0 bits (71), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 40/149 (26%), Positives = 67/149 (44%), Gaps = 21/149 (14%)

Query: 154 VSGRLGDIYGLKKVLLGGYAILTIWS--LICGFSSYSHNDAFFITSRAFQGLGLAFVLPN 211
           +SG L D++G + V+L G  I  + S  L C   SY       +  R  Q +G++  +  
Sbjct: 145 ISGGLADVFGRRPVILIGMLIYVVASIGLACA-PSY----GVIVFLRIIQSIGISPTIAI 199

Query: 212 SLGLIG---VIYEPGSMKKNMIIGTLGAMSPIGATLGGLFAGIIGTKDPKQWPWS--FYS 266
           S G++G   + +E G+         +GA S +   LG  F  +IG      W W   F+ 
Sbjct: 200 SSGVVGDFTLKHERGTF--------VGATSGL-VLLGQCFGSLIGAVLAAAWNWRAIFWF 250

Query: 267 FGIVSFCNMILSWYSIPNNIPTNIYNLSM 295
             I    + I+++  +P    T + NLS+
Sbjct: 251 LTIGCGTSFIIAFLLLPETKRTLVGNLSI 279

>YBR043C Chr2 complement(321876..323945) [2070 bp, 689 aa] {ON}
           QDR3Multidrug transporter of the major facilitator
           superfamily, has a role in polyamine homeostasis;
           expression is upregulated under polyamine stress;
           required for resistance to quinidine, barban, cisplatin,
           and bleomycin
          Length = 689

 Score = 32.0 bits (71), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 36/145 (24%), Positives = 63/145 (43%), Gaps = 11/145 (7%)

Query: 144 FTLSMGSFILVSGRLGDIYGLKKVLLGGYAILTIWSLICGFSSYSHNDAFFITSRAFQGL 203
           + LS+G F L    L ++ G +   +  +A+L  +++    S+ + +   FI  R   G 
Sbjct: 152 YLLSLGVFPLWWSSLSELEGRRTTYITSFALLFAFNI---GSALAPDINSFIALRMLCGA 208

Query: 204 GLAFVLPNSLGLIGVIYEPGSMKKNMIIGTLGAMSPIGATLGGLFAGIIGTKDPKQWPW- 262
             A V     G +  +Y      KN+    LG +      L  L + I G+    +WPW 
Sbjct: 209 ASASVQSVGAGTVADLYISEDRGKNLSYYYLGPL------LAPLLSPIFGSLLVNRWPWR 262

Query: 263 -SFYSFGIVSFCNMILSWYSIPNNI 286
            + +   I+S CN+IL    +P  +
Sbjct: 263 STQWFMVILSGCNVILLTVLLPETL 287

>SAKL0D04510g Chr4 complement(360010..361605) [1596 bp, 531 aa] {ON}
           similar to uniprot|P36035 Saccharomyces cerevisiae
           YKL217W JEN1 Lactate transporter, required for uptake of
           lactate and pyruvate; expression is derepressed by
           transcriptional activator Cat8p under nonfermentative
           growth conditions, and repressed in the presence of
           glucose, fructose, and mannose
          Length = 531

 Score = 32.0 bits (71), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 29/57 (50%), Gaps = 2/57 (3%)

Query: 156 GRLGDIYGLKKVLLGGYAILTIWSLICGFSSYSHNDAFFITSRAFQGLGLAFVLPNS 212
           G +GD YG K   +     + +  +I GF    HN  +F+ +RAF G+ L  +  NS
Sbjct: 131 GYIGDRYGRKVSFIINLFFMMVLEIITGF--IKHNFKYFLIARAFFGVVLGGIFGNS 185

>Smik_2.161 Chr2 complement(302754..304823) [2070 bp, 689 aa] {ON}
           YBR043C (REAL)
          Length = 689

 Score = 31.6 bits (70), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 35/136 (25%), Positives = 60/136 (44%), Gaps = 11/136 (8%)

Query: 144 FTLSMGSFILVSGRLGDIYGLKKVLLGGYAILTIWSLICGFSSYSHNDAFFITSRAFQGL 203
           + LS+G F L    L ++ G +   +  +A+L  +++    S+ + +   FI  R   G 
Sbjct: 152 YLLSLGVFPLWWSSLSELEGRRTTYITSFALLFAFNI---GSALAPDINSFIALRMLCGA 208

Query: 204 GLAFVLPNSLGLIGVIYEPGSMKKNMIIGTLGAMSPIGATLGGLFAGIIGTKDPKQWPW- 262
             A V     G +  +Y      KN+    LG +      L  L + I G+    +WPW 
Sbjct: 209 ASASVQSVGAGTVADLYISEDRGKNLSYYYLGPL------LAPLLSPIFGSLLVNRWPWR 262

Query: 263 -SFYSFGIVSFCNMIL 277
            + +   I+S CN+IL
Sbjct: 263 STQWFMVILSGCNVIL 278

>NDAI0A01510 Chr1 (335693..337732) [2040 bp, 679 aa] {ON} Anc_7.411
           YER113C
          Length = 679

 Score = 31.6 bits (70), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 25/50 (50%), Gaps = 7/50 (14%)

Query: 373 CGWGAFGTWTFYYFSFVLNVRGYTAAWAGGSYFIFIVSGCAIATLCGFMM 422
           C W     ++ YY  F+LN+RG++      S FI +  G    TLCG  M
Sbjct: 612 CAW-YMELYSLYYVFFILNIRGFS------SIFISVCYGALFNTLCGCAM 654

>YAL067C Chr1 complement(7235..9016) [1782 bp, 593 aa] {ON}
           SEO1Putative permease, member of the allantoate
           transporter subfamily of the major facilitator
           superfamily; mutation confers resistance to ethionine
           sulfoxide
          Length = 593

 Score = 31.6 bits (70), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 32/122 (26%), Positives = 53/122 (43%), Gaps = 10/122 (8%)

Query: 178 WSLICGFSSYSHNDAFFITSRAFQGLGLAFVLPNSLG---LIGVIYEPGSMKKNMIIGTL 234
           WSL+   ++Y ++       R F G   AF  P+ L    L G  Y+   M +      L
Sbjct: 214 WSLLTVGAAYVNSVPHLKAIRFFIG---AFEAPSYLAYQYLFGSFYKHDEMVRRSAFYYL 270

Query: 235 GAMSPI---GATLGGLFAGIIGTKDPKQWPWSFYSFGIVSFCNMILSWYSIPNNIPTNIY 291
           G    I   G     +++ + G    + W W+F    IVS    ++ +YS+P + P N Y
Sbjct: 271 GQYIGILSAGGIQSAVYSSLNGVNGLEGWRWNFIIDAIVSVVVGLIGFYSLPGD-PYNCY 329

Query: 292 NL 293
           ++
Sbjct: 330 SI 331

>TDEL0C00120 Chr3 complement(7481..9190) [1710 bp, 569 aa] {ON} 
          Length = 569

 Score = 31.6 bits (70), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 99/446 (22%), Positives = 176/446 (39%), Gaps = 49/446 (10%)

Query: 110 FMSQAGLTQALSIMNILAEELNAEKSRQAWLMASFTLSMGSFILVSGRLGDIYGLKKVLL 169
           F+S    T   S    +  E N   +  +W+  ++ ++  SF  + G   D  G +  L 
Sbjct: 66  FLSGFDGTVTASTYQTIGNEFN-HMNISSWITTAYLITSTSFQPLYGSFSDALGRRNCLF 124

Query: 170 GGYAILTIWSLICGFSSYSHNDAFFITSRAFQGLGLAFVLPNSLGLIGVIYEPGSMK--- 226
                 TI  L CG S    N       RA  G+G   ++  S  ++     P S +   
Sbjct: 125 FANTSFTIGCLACGLSP---NIVVLSFMRALTGIGGGGLITLST-IVNSDMIPSSKRGIF 180

Query: 227 ---KNMIIGTLGAMSPIGATLGGLFAGIIGTKDPKQWPWSFYSFGIVSFCNMILSWYSIP 283
              +N+++G LGA+   GA+ GG  A  IG      W W F+    +   N ++    +P
Sbjct: 181 QAFQNLLLG-LGAIC--GASFGGSIASSIG------WRWCFFVQVPICITNSLIMSSYVP 231

Query: 284 NNI------------PTNIY-NLSMDWXXXXXXXXXXXXXNFVFNQAPI-VGWQSAYIIV 329
           N              P  I  ++ +                     + + V W S  ++ 
Sbjct: 232 NQKEYEDREIGFLFHPKKILKDIDVTGSVFIIIGLTLQLLYLSLGSSKVGVSWTSPSVLP 291

Query: 330 LLVLSFCALVIFVVYEVKYAKTPLIP-KAISSNRGMLMILFALFCGWGAFGTWTFYYFSF 388
           LL  S   LV+FV  E K +   +IP + + S+   +++  ++  G+ ++  + F    F
Sbjct: 292 LLFASGIILVLFVYNEAKTSARAIIPLELMRSSFSFVVLTISILVGFASYA-YLFTLPLF 350

Query: 389 VLNVRGYTAAWAGGSYFI---FIVSGCAIATLCGFMMKKVPPSVILYISM-IGFMGGCVM 444
              V G + A AG    I   F   G  I  +C  M +     ++LY  + +  +G  + 
Sbjct: 351 FQIVLGDSTAKAGLRLTIPSLFTPVGGLITGIC--MSRYNCLQILLYAGVFLMALGNFLF 408

Query: 445 LTVTPIHQSYFQNILGIMFVLP--IGIDLSFPAASIILSDALPIQYQGMAGSLVYTITNY 502
           L +    +    N L  +F++P  +G  ++FPA       A P   Q  A S +Y   + 
Sbjct: 409 LFI----EKGSPNWLVGLFLIPANLGQGITFPATLFTFIFAFPKSRQATATSTLYLFRSI 464

Query: 503 STSICLGMA-GSVEAYHNDNGQNILK 527
            +   + M+ G ++ Y   + ++ LK
Sbjct: 465 GSVWGVAMSTGVIQLYFGKSLRSNLK 490

>TBLA0G02550 Chr7 complement(668523..670364) [1842 bp, 613 aa] {ON}
           Anc_2.242 YNL065W
          Length = 613

 Score = 31.6 bits (70), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 35/143 (24%), Positives = 59/143 (41%), Gaps = 9/143 (6%)

Query: 154 VSGRLGDIYGLKKVLLGGYAILTIWSL-ICGFSSYSHNDAFFITSRAFQGLGLAFVLPNS 212
           VSG L DIYG + V+L G  +  + S+ I   +SY       I  R  Q  G++ ++  S
Sbjct: 153 VSGGLADIYGRRPVILFGMLVYVVASIGIAACNSY----GVIIFLRCLQSTGISPLIAIS 208

Query: 213 LGLIGVIYEPGSMKKNMIIGTLGAMSPIGATLGGLFAGIIGTKDPKQWPWSFYSFGIVSF 272
            G +G        ++   +G +  +  +G   G L    +       W   F+   I   
Sbjct: 209 SGAVGDFTVKA--ERGTFVGAVSGLVLMGQAFGSLIGAALAAA--YNWRAIFWFLAIGCG 264

Query: 273 CNMILSWYSIPNNIPTNIYNLSM 295
             M ++   +P    T + NLS+
Sbjct: 265 ACMAIAGIVLPETKRTLVGNLSV 287

>KLLA0C19019g Chr3 (1689555..1691090) [1536 bp, 511 aa] {ON} similar
           to uniprot|P53322 Saccharomyces cerevisiae YGR260W TNA1
           High affinity nicotinic acid plasma membrane permease
          Length = 511

 Score = 31.2 bits (69), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 27/117 (23%), Positives = 47/117 (40%), Gaps = 9/117 (7%)

Query: 178 WSLICGFSSYSHNDAFFITSRAFQGLGLAFVLPNSLGLIGVIYEPGSMKKNMIIGTLGAM 237
           WS+I   +++  + A  I  R   G       P    +I ++Y+     K   I      
Sbjct: 147 WSIITLCNAFVQSYASLIALRVLLGAFEGGFFPAMTLIISILYKKQEQGKR--IAFFFGS 204

Query: 238 SPIGATLGGLFAGIIGTKDP----KQWPWSFYSFGIVSFCNMILSWYSIP---NNIP 287
           S +    GGL A  + +  P    + W W +   G++S C  +  +  +P   +NIP
Sbjct: 205 SALSGAFGGLIATGLASMKPAGGLEGWRWLYIIEGLISVCASVWLFLELPKDFDNIP 261

>NDAI0K03000 Chr11 (686056..687834) [1779 bp, 592 aa] {ON} 
          Length = 592

 Score = 31.2 bits (69), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 32/122 (26%), Positives = 50/122 (40%), Gaps = 10/122 (8%)

Query: 178 WSLICGFSSYSHNDAFFITSRAFQGLGLAFVLPNSLG---LIGVIYEPGSMKKNMIIGTL 234
           WSL+   ++Y ++       R F G   AF  P+ L    L G  Y+   M +       
Sbjct: 219 WSLLTVGAAYVNSVPHLKAIRFFIG---AFEAPSYLAYQYLFGCFYKHDEMVRRSAFYYF 275

Query: 235 GAMSPI---GATLGGLFAGIIGTKDPKQWPWSFYSFGIVSFCNMILSWYSIPNNIPTNIY 291
           G    I   G     +F  + G      W W+F    I+S    I+ +YS+P + P N Y
Sbjct: 276 GQYIGILSSGGIQSAVFTSLDGVNGMSGWRWNFIIDAIISVVVGIIGFYSLPGD-PHNCY 334

Query: 292 NL 293
           ++
Sbjct: 335 SI 336

>TDEL0C04590 Chr3 (831668..833257) [1590 bp, 529 aa] {ON} Anc_2.242
           YNL065W
          Length = 529

 Score = 31.2 bits (69), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 45/177 (25%), Positives = 74/177 (41%), Gaps = 21/177 (11%)

Query: 126 LAEELNAEKSRQAWLMASFTLSMGSFILVSGRLGDIYGLKKVLLGGYAILTIWS--LICG 183
           L +E N ++ +    +  + L  G     SG L DIYG + V++ G  I    S  L C 
Sbjct: 90  LEKEFNIDEDKVNVTVVVYLLFQGIAPTFSGGLADIYGRRPVIVIGMIIYVAVSVGLAC- 148

Query: 184 FSSYSHNDAFFITSRAFQGLGLAFVLPNSLGLIG---VIYEPGSMKKNMIIGTLGAMSPI 240
               S++    +  R  Q   ++  +  S G +G   + +E G+         +GA S  
Sbjct: 149 ----SNSYGVLVFLRILQSACISPTIAISSGFVGDFTLKFERGTF--------VGATSGF 196

Query: 241 GATLGGLFAGIIGTKDPKQWPWSFYSFGIVSFCN--MILSWYSIPNNIPTNIYNLSM 295
            A LG  F  +IG      W W    + +V  C   M++ +  +P    T + NLS+
Sbjct: 197 -ALLGQAFGSLIGAALAAAWDWRAIFWFLVIGCGVCMLIIFTLLPETKRTLVGNLSV 252

>TDEL0F05630 Chr6 complement(1053523..1055160) [1638 bp, 545 aa]
           {ON} 
          Length = 545

 Score = 31.2 bits (69), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 27/49 (55%), Gaps = 1/49 (2%)

Query: 246 GLFAGIIGTKDPKQWPWSFYSFGIVSFCNMILSWYSIPNNIPTNIYNLS 294
           G+  G+ G K  + W W F   G ++   + L+++ +P+N P+N   LS
Sbjct: 240 GIIKGMDGVKGLRAWRWCFIIEGAITVATVPLAYFILPDN-PSNTKFLS 287

>SAKL0A07480g Chr1 complement(658699..660420) [1722 bp, 573 aa] {ON}
           similar to uniprot|P38358 Saccharomyces cerevisiae
           YBR293W VBA2 Permease of basic amino acids in the
           vacuolar membrane
          Length = 573

 Score = 31.2 bits (69), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 36/136 (26%), Positives = 66/136 (48%), Gaps = 11/136 (8%)

Query: 322 WQSAYIIVLLVLSFCALVIFVVYEVKYAKTPLIP-KAISSNRGMLMILFALFCGWGAFGT 380
           W S   I L++L+  +LV+F+  E      P+IP K +S +   ++++ ++  G+ ++  
Sbjct: 276 WLSKESIGLILLTVLSLVMFIHTERTTQANPIIPTKLLSQSHSTMVLVISVLVGFVSYA- 334

Query: 381 WTFYYFSFVLNVRGYTAAWAGGSYFIFIVSGCA-IATLCGFMMKKVPPSVILYIS----- 434
           + F    F   V G +AA AG  + + I S C  I  L   +  ++P ++   +S     
Sbjct: 335 YLFTLPLFFQIVVGDSAARAG--FRLAIPSFCTPIGGLITGLSMRIPKTLPFLLSFGMVL 392

Query: 435 -MIGFMGGCVMLTVTP 449
            MIG     ++ T TP
Sbjct: 393 MMIGNAFFLLLKTTTP 408

>Kwal_23.4824 s23 (883258..884919) [1662 bp, 553 aa] {ON} YNL065W
           (AQR1) - multidrug resistance transporter [contig 5]
           FULL
          Length = 553

 Score = 31.2 bits (69), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 57/279 (20%), Positives = 108/279 (38%), Gaps = 30/279 (10%)

Query: 31  DATPESKERKDYFQL-----KKNYSQDSQTNTSMNEVIGXXXXXXXXXXXXXENLQSENK 85
           DA   +   K+  QL     K  Y QD+ +  + +E+ G             +N      
Sbjct: 15  DAQSANHLEKEVHQLNHDGNKHKYEQDAPSRVTTHEMKGSSSESIEGHDIAHDNAPLPQH 74

Query: 86  VLSPKYFKNRTHEYLFIISCMVSQFMSQAGLTQALSIMNILAEELNAEKSRQAWLMASFT 145
             +P    +   ++  +     + F S  G       +  L ++ +  +      +  + 
Sbjct: 75  --APYTLLSNAQKWCMVALLTSAGFWSSLGSPIYYPALKQLEKQFSVSEELVNITVVVYL 132

Query: 146 LSMGSFILVSGRLGDIYGLKKVLLGGYAILTIWS--LICGFSSYSHNDAFFITSRAFQGL 203
           +  G    +SG L D+YG + V+L G  I    S  L C     S++    +  R  Q  
Sbjct: 133 IFQGVAPTISGGLADVYGRRPVILIGMLIYVCASIGLAC-----SNSYGVIVFLRCLQSA 187

Query: 204 GLAFVLPNSLGLIG---VIYEPGSMKKNMIIGTLGAMSPIGATL-GGLFAGIIGTKDPKQ 259
           G++ ++  + G++G   V  E G+         +GA+S  G TL G  F  +IG      
Sbjct: 188 GISPIIAINSGVVGDFTVKQERGTF--------VGAVS--GFTLMGQAFGSLIGAALTAA 237

Query: 260 WPWS--FYSFGIVSFCNMILSWYSIPNNIPTNIYNLSMD 296
           + W   F+   I     M++++  +P    + + N+S+ 
Sbjct: 238 FDWRAIFWFLTIGCGTCMLVNFLLLPETKRSIVGNMSIK 276

>SAKL0E00132g Chr5 (3269..5131) [1863 bp, 620 aa] {ON} similar to
           uniprot|P38724 Saccharomyces cerevisiae YHL047C ARN2
           Transporter member of the ARN family of transporters
           that specifically recognize siderophore-iron chelates
           responsible for uptake of iron bound to the siderophore
           triacetylfusarinine C
          Length = 620

 Score = 31.2 bits (69), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 30/55 (54%), Gaps = 4/55 (7%)

Query: 322 WQSAYIIVLLVLSFCALVIFVVYEVKYAKTPLIPKAISSNRGM---LMILFALFC 373
           W+SA +I  +VL    +  F+ +E K A  PL P  +  +RG+   L+I F L C
Sbjct: 315 WRSAKVIAPIVLGSVLVPAFIYWESKLALVPLAPFKMLKDRGIWAPLLITF-LIC 368

>Smik_11.368 Chr11 complement(649880..651622) [1743 bp, 580 aa] {ON}
           YKR105C (REAL)
          Length = 580

 Score = 31.2 bits (69), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 89/442 (20%), Positives = 164/442 (37%), Gaps = 74/442 (16%)

Query: 99  YLFIISCMVSQFMSQAGLTQALSIMNILAEELNAEKSRQAWLMASFTLSMGSFILVSGRL 158
           YL + S  +  F++   +    +I++++AE+     S+  WL+  ++L      LV GR 
Sbjct: 35  YLCLTSLTLVLFITALDILIVGTIIDVVAEQF-GNYSKTGWLVTGYSLPNAILSLVWGRF 93

Query: 159 GDIYGLKKVLLGGYAILTIWSLICGFSSYSHNDAFFITSRAFQGLGLAFVLPNSLGLIGV 218
             I G +  L+    I    SL+   +    N    +             L     +IG 
Sbjct: 94  ASIIGFQHSLILAVLIFEAGSLVAALA----NSMNMLIVGRVVAGVGGSGLQTLCFVIGC 149

Query: 219 IYEPGSMKKNMIIGTLGAMSPIGATLGGLFAGIIGTKDPKQWPWSFY------SFGIVSF 272
                   + ++I  L     + A +G +  G   T     W W FY       F ++ F
Sbjct: 150 TM-VNERSRPLVISILSCAFAVAAIVGPIIGGAFTTH--VTWRWCFYINLPIGGFAVIMF 206

Query: 273 CNMILSWYSIPNNIPTNIYNLSMDWXXXXXXXXXXXXXN----------------FVFNQ 316
              +L++ +   NI     N+ +               N                F  + 
Sbjct: 207 ---LLTYKTKSENILQQTRNI-LGRISKFELRRLTEPGNLRKALIGILFKFDFLGFALSS 262

Query: 317 APIV-------------GWQSAYIIVLLVLSFCALVIFVVYEV-----------KYAKTP 352
           A +V              W S  II  LVL     V  ++Y+              +  P
Sbjct: 263 AGLVLFLLGLTFGGNKYSWNSGQIITYLVLGILLFVFSLIYDFFIFQKFNPEPDNTSYRP 322

Query: 353 LIPKAISSNRGML---MILFALFCGWGAFGTWTFYYFSFVLNVRGYTAAWAGGSYFIFIV 409
           L  K + +   ++   M+ F L  G+     ++  +F  +      ++AW  G + I IV
Sbjct: 323 LFLKRLVAKPAVIIVNMVTFLLCIGYNGQMIYSVQFFQLIFA----SSAWKAGLHLIPIV 378

Query: 410 SGCAIATLC-GFMMKK---VPPSVILYISMIGFMGGCVMLTVTPIHQSYFQNILGIMFVL 465
               IA +  G + KK   V P ++++  ++G +G  +M  ++    S  Q  +G++ +L
Sbjct: 379 ITNVIAAIASGVITKKLGLVKP-LLIFGGILGVIGAGLMTLMSNNSTSSTQ--IGVL-IL 434

Query: 466 PIGIDLSFPAASIILSDALPIQ 487
           P G+ L F   + ++S  L I+
Sbjct: 435 P-GLSLGFALQASLMSAQLQIK 455

>Kwal_56.22949 s56 complement(342503..344431) [1929 bp, 642 aa] {ON}
           YBR043C (AQR2) - YBR043C [contig 184] FULL
          Length = 642

 Score = 31.2 bits (69), Expect = 10.0,   Method: Compositional matrix adjust.
 Identities = 31/122 (25%), Positives = 51/122 (41%), Gaps = 15/122 (12%)

Query: 144 FTLSMGSFILVSGRLGDIYGLKKVLLGGYAILTIWSLICGF---SSYSHNDAFFITSRAF 200
           + LS+G   L    L ++ G + V +  +      +L+C F   S+ + N   FI  R  
Sbjct: 137 YLLSLGVLPLWWSSLSELRGRRTVYVLSF------TLLCAFCIGSALAPNIEAFIVFRML 190

Query: 201 QGLGLAFVLPNSLGLIGVIYEPGSMKKNMIIGTLGAMSPIGATLGGLFAGIIGTKDPKQW 260
            G   A V     G +  +Y+P    K +    LGA+      +  L + IIG+    +W
Sbjct: 191 CGASSASVQSVGAGTVADLYKPEDRGKRLGYYYLGAL------MAPLLSPIIGSLLVNRW 244

Query: 261 PW 262
            W
Sbjct: 245 SW 246

>YIL047C Chr9 complement(265115..267823) [2709 bp, 902 aa] {ON}
           SYG1Plasma membrane protein of unknown function;
           truncation and overexpression suppresses lethality of
           G-alpha protein deficiency
          Length = 902

 Score = 31.2 bits (69), Expect = 10.0,   Method: Compositional matrix adjust.
 Identities = 13/40 (32%), Positives = 24/40 (60%), Gaps = 1/40 (2%)

Query: 404 YFI-FIVSGCAIATLCGFMMKKVPPSVILYISMIGFMGGC 442
           YF+ F +  CA+ ++  F ++K+ P   LYI ++ F+  C
Sbjct: 499 YFLTFFIVPCAVCSMLSFALEKLTPLGFLYIGIVSFLFLC 538

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.324    0.138    0.417 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 56,058,880
Number of extensions: 2269358
Number of successful extensions: 6747
Number of sequences better than 10.0: 302
Number of HSP's gapped: 6813
Number of HSP's successfully gapped: 330
Length of query: 580
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 465
Effective length of database: 40,294,809
Effective search space: 18737086185
Effective search space used: 18737086185
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 69 (31.2 bits)