Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0D032708.843ON55055027190.0
TBLA0D03280singletonON58053017790.0
TBLA0C01160singletonON60052716510.0
Kpol_541.168.843ON52852515690.0
Suva_13.4678.843ON54352215340.0
TPHA0C047908.843ON55653515130.0
Suva_13.278.843ON55352414960.0
Skud_13.258.843ON53751114930.0
YMR279C8.843ON54050014920.0
Smik_13.4928.843ON54352714870.0
YML116W (ATR1)8.843ON54251314850.0
NDAI0E002808.843ON54952114760.0
Skud_13.4518.843ON53951014700.0
KAFR0B039408.843ON54753014710.0
NCAS0A02540singletonON53952014640.0
NCAS0B002908.843ON54250114500.0
TDEL0B005508.843ON53752414440.0
NDAI0K004008.843ON55348014330.0
Kwal_27.102458.843ON51551114290.0
KNAG0G034308.843ON54251814290.0
Smik_13.188.843ON54550914230.0
SAKL0D01386g8.843ON52148814190.0
KNAG0J002608.843ON55051114210.0
CAGL0M03003g8.843ON55848414210.0
KLTH0C03806g8.843ON52551714150.0
CAGL0B02343g8.843ON53749514050.0
NCAS0C004008.843ON51751013640.0
KAFR0B03930singletonON55552113670.0
KAFR0A028408.843ON52048312931e-173
YOR378Wna 1ON5155248331e-104
Smik_15.560na 1ON5165248251e-103
Skud_15.545na 1ON5164728231e-103
Suva_8.435na 1ON5155268071e-101
KLTH0C10560gna 1ON5155188051e-100
Kwal_23.6547na 1ON5115027973e-99
KLLA0B00352gna 1ON4984667598e-94
TDEL0G04950singletonON5124826721e-80
KNAG0D00130na 1ON5654524705e-51
KAFR0C04860na 1ON5345294352e-46
NCAS0A05720na 1ON5635454142e-43
SAKL0C06116gsingletonON1851903734e-41
CAGL0L02519gna 1ON5294133903e-40
NDAI0K02730singletonON6045763459e-34
Kpol_358.4na 2ON6171481412e-08
KLLA0C18931gna 3ON5534821402e-08
Smik_13.2722.473ON5611071303e-07
Smik_6.24na 4ON5445181296e-07
SAKL0C12122gna 5ON6111411286e-07
Skud_13.2442.473ON5621181232e-06
YMR088C (VBA1)2.473ON5621071224e-06
TPHA0M00120singletonON6191461214e-06
Suva_13.2652.473ON5611191198e-06
Skud_6.16na 4ON5495181181e-05
Suva_5.2na 2ON6271491171e-05
NCAS0A078102.473ON5681391144e-05
KLTH0G09504gna 6ON624821144e-05
Kwal_23.5241na 5ON591801135e-05
NCAS0D02350na 2ON6341451135e-05
SAKL0E02992g2.473ON5701461117e-05
Kpol_416.5singletonON607761117e-05
Kwal_34.15746na 3ON5184871118e-05
NDAI0I02650na 2ON6381501101e-04
Kpol_416.6singletonON5972391101e-04
TDEL0G04740singletonON6011451091e-04
Skud_5.24na 2ON6271481063e-04
SAKL0C02178gsingletonON5651331045e-04
Kwal_23.4853na 6ON603751045e-04
KLLA0F13684g2.473ON5711381037e-04
KLTH0A01562gna 5ON615621038e-04
SAKL0F00440gsingletonON5444201028e-04
KLTH0H16214gsingletonON5511331020.001
Kpol_467.242.473ON3701281000.001
Suva_10.11singletonON5401271000.001
NDAI0H022002.473ON5711201000.002
CAGL0J01375g2.473ON5641401000.002
Smik_5.22na 2ON6281481000.002
YEL065W (SIT1)na 2ON628148990.002
CAGL0E04092gna 7ON645101990.002
NDAI0A02050singletonON617150990.002
SAKL0G06600gsingletonON62973990.002
Kpol_513.33singletonON626100960.005
YKR106W (GEX2)singletonON61573960.005
YCL073C (GEX1)singletonON61573960.005
Skud_18.6singletonON61067960.005
KLTH0B10142gsingletonON568169950.007
TDEL0A024902.473ON55493950.007
SAKL0F00792gsingletonON61778940.009
KAFR0D00790singletonON561178920.016
Smik_21.4singletonON60535910.018
KAFR0I01560singletonON63289910.019
Skud_2.423na 8ON560255910.021
SAKL0E04246gna 9ON56577910.021
Ecym_73992.473ON563106910.021
KLLA0F17776gna 9ON55381900.022
TDEL0D06610singletonON49791900.025
Kwal_34.15711na 7ON618159900.025
ZYRO0C01430g8.272ON59079900.026
Kwal_56.22298singletonON61051890.029
YOL158C (ENB1)singletonON60650890.034
TPHA0B00180singletonON63387880.047
NCAS0A11500singletonON61488880.048
ZYRO0G03234g2.473ON562120880.049
TPHA0G031502.473ON600132880.050
NCAS0I00110na 7ON45273860.063
KLLA0C19272gsingletonON623177870.063
KAFR0D00930singletonON61496870.065
TDEL0H00130singletonON62181860.068
KLLA0A10439gsingletonON63485860.074
KNAG0E025602.473ON578144860.077
Smik_11.370singletonON44097850.10
Smik_6.22singletonON63688850.10
Kwal_14.722singletonON611118850.11
KNAG0J02980singletonON636179840.13
NDAI0H00140na 7ON63289840.13
Suva_10.9singletonON63770840.14
KLTH0D16962gsingletonON571317830.16
Skud_6.14singletonON63670830.20
KLTH0D00506gsingletonON61699820.21
KLLA0E14609gsingletonON63973820.23
ZYRO0G07414gsingletonON70797820.23
YBR293W (VBA2)na 8ON474146810.28
TPHA0G03780singletonON612149810.29
SAKL0G03300gsingletonON61659810.30
Suva_4.553na 8ON562254810.30
YPR198W (SGE1)singletonON54367810.33
Suva_26.1singletonON53450800.34
Kpol_543.448.272ON64350800.36
TBLA0F030408.272ON906358800.39
ABL040W2.473ON56792800.42
KLTH0D18150gsingletonON60758800.44
SAKL0F00110gsingletonON620117800.45
TBLA0C01040singletonON66974790.51
Skud_16.503singletonON543272790.55
AGR076C8.272ON68680790.57
Smik_17.11singletonON544273780.61
Skud_8.3na 7ON631101780.61
KLLA0A04631g8.272ON579153780.64
TDEL0H01600singletonON60435770.82
KLTH0D00110gsingletonON620159770.87
KLTH0B10450gsingletonON620159770.87
SAKL0A00726gsingletonON598147770.89
YKR105C (VBA5)singletonON582410770.96
NDAI0D010202.242ON592148771.0
Kwal_23.2794singletonON619117761.1
TDEL0B00140singletonON632180761.2
KNAG0K01020singletonON599367761.2
Smik_2.434na 8ON474257751.5
KLLA0F03168gna 10ON518158751.7
Kwal_26.9616singletonON562278751.8
CAGL0J09020g7.309ON856103741.9
SAKL0A08228gsingletonON56967741.9
Suva_8.12na 7ON63390742.0
SAKL0E00132gsingletonON620159742.1
Kwal_26.77552.473ON559133742.1
Smik_11.368singletonON580205742.3
SAKL0A07480gsingletonON573195742.3
TBLA0B10150singletonON571177732.5
ZYRO0A00330gsingletonON576167732.7
KLTH0A07964gsingletonON619132733.1
TPHA0O009501.432ON55990723.2
KLTH0D05434g2.473ON57698723.4
SAKL0H16808g8.272ON65748723.4
KLTH0G13464g8.272ON593138723.4
KLTH0C10142gsingletonON573358723.5
KLTH0E04400gna 10ON490255713.9
KLTH0B00110gsingletonON62743724.0
NCAS0C03460na 11ON63084714.3
ZYRO0D13310gsingletonON61675714.4
KLLA0D19941gsingletonON611137714.5
YHL040C (ARN1)na 7ON62790715.0
Smik_16.81na 11ON62584715.1
KLLA0B05841g4.173ON187880715.5
SAKL0D04510gna 12ON53190705.9
KLTH0C10120gsingletonON651348705.9
KLLA0F03311g2.242ON542178706.2
KAFR0J009302.242ON566162706.7
Kwal_56.237548.272ON589136697.3
TDEL0G03260singletonON61284697.7
TPHA0C014507.185ON103476697.8
Skud_15.4748.783ON522205698.6
CAGL0B02189g5.111ON108745698.6
Ecym_42988.272ON678145698.9
TDEL0F039908.272ON63152699.2
Smik_8.1na 7ON62793689.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0D03270
         (550 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0D03270 Chr4 complement(813041..814693) [1653 bp, 550 aa] {O...  1051   0.0  
TBLA0D03280 Chr4 complement(815937..817679) [1743 bp, 580 aa] {O...   689   0.0  
TBLA0C01160 Chr3 complement(246034..247836) [1803 bp, 600 aa] {O...   640   0.0  
Kpol_541.16 s541 complement(43396..44982) [1587 bp, 528 aa] {ON}...   608   0.0  
Suva_13.467 Chr13 complement(807375..809006) [1632 bp, 543 aa] {...   595   0.0  
TPHA0C04790 Chr3 complement(1033653..1035323) [1671 bp, 556 aa] ...   587   0.0  
Suva_13.27 Chr13 (37895..39556) [1662 bp, 553 aa] {ON} YML116W (...   580   0.0  
Skud_13.25 Chr13 (37872..39485) [1614 bp, 537 aa] {ON} YML116W (...   579   0.0  
YMR279C Chr13 complement(824729..826351) [1623 bp, 540 aa] {ON} ...   579   0.0  
Smik_13.492 Chr13 complement(807726..809357) [1632 bp, 543 aa] {...   577   0.0  
YML116W Chr13 (38196..39824) [1629 bp, 542 aa] {ON}  ATR1Multidr...   576   0.0  
NDAI0E00280 Chr5 (37676..39325) [1650 bp, 549 aa] {ON} Anc_8.843      573   0.0  
Skud_13.451 Chr13 complement(798006..799625) [1620 bp, 539 aa] {...   570   0.0  
KAFR0B03940 Chr2 complement(820954..822597) [1644 bp, 547 aa] {O...   571   0.0  
NCAS0A02540 Chr1 complement(481807..483426) [1620 bp, 539 aa] {O...   568   0.0  
NCAS0B00290 Chr2 (33760..35388) [1629 bp, 542 aa] {ON} Anc_8.843      563   0.0  
TDEL0B00550 Chr2 (105483..107096) [1614 bp, 537 aa] {ON} Anc_8.8...   560   0.0  
NDAI0K00400 Chr11 (90040..91701) [1662 bp, 553 aa] {ON}               556   0.0  
Kwal_27.10245 s27 (259090..260637) [1548 bp, 515 aa] {ON} YML116...   555   0.0  
KNAG0G03430 Chr7 complement(734828..736456) [1629 bp, 542 aa] {O...   555   0.0  
Smik_13.18 Chr13 (34422..36059) [1638 bp, 545 aa] {ON} YML116W (...   552   0.0  
SAKL0D01386g Chr4 (109619..111184) [1566 bp, 521 aa] {ON} unipro...   551   0.0  
KNAG0J00260 Chr10 (37950..39602) [1653 bp, 550 aa] {ON} Anc_8.84...   551   0.0  
CAGL0M03003g Chr13 complement(337942..339618) [1677 bp, 558 aa] ...   551   0.0  
KLTH0C03806g Chr3 (332195..333772) [1578 bp, 525 aa] {ON} simila...   549   0.0  
CAGL0B02343g Chr2 complement(222130..223743) [1614 bp, 537 aa] {...   545   0.0  
NCAS0C00400 Chr3 (61257..62810) [1554 bp, 517 aa] {ON} Anc_8.843      530   0.0  
KAFR0B03930 Chr2 complement(816351..818018) [1668 bp, 555 aa] {O...   531   0.0  
KAFR0A02840 Chr1 complement(588197..589759) [1563 bp, 520 aa] {O...   502   e-173
YOR378W Chr15 (1049511..1051058) [1548 bp, 515 aa] {ON} Putative...   325   e-104
Smik_15.560 Chr15 (995453..997003) [1551 bp, 516 aa] {ON} YOR378...   322   e-103
Skud_15.545 Chr15 (988549..990099) [1551 bp, 516 aa] {ON} YOR378...   321   e-103
Suva_8.435 Chr8 (786917..788464) [1548 bp, 515 aa] {ON} YOR378W ...   315   e-101
KLTH0C10560g Chr3 (875216..876763) [1548 bp, 515 aa] {ON} simila...   314   e-100
Kwal_23.6547 s23 (1635677..1637212) [1536 bp, 511 aa] {ON} YOR37...   311   3e-99
KLLA0B00352g Chr2 (22476..23972) [1497 bp, 498 aa] {ON} highly s...   296   8e-94
TDEL0G04950 Chr7 complement(922428..923966) [1539 bp, 512 aa] {O...   263   1e-80
KNAG0D00130 Chr4 complement(6264..7961) [1698 bp, 565 aa] {ON}  ...   185   5e-51
KAFR0C04860 Chr3 (964552..966156) [1605 bp, 534 aa] {ON}  YOR378W     172   2e-46
NCAS0A05720 Chr1 (1117491..1119182) [1692 bp, 563 aa] {ON}            164   2e-43
SAKL0C06116g Chr3 complement(571813..572370) [558 bp, 185 aa] {O...   148   4e-41
CAGL0L02519g Chr12 complement(297555..299144) [1590 bp, 529 aa] ...   154   3e-40
NDAI0K02730 Chr11 complement(612590..614404) [1815 bp, 604 aa] {...   137   9e-34
Kpol_358.4 s358 complement(9458..11311) [1854 bp, 617 aa] {ON} c...    59   2e-08
KLLA0C18931g Chr3 (1680133..1681794) [1662 bp, 553 aa] {ON} unip...    59   2e-08
Smik_13.272 Chr13 complement(427283..428968) [1686 bp, 561 aa] {...    55   3e-07
Smik_6.24 Chr6 (39520..41154) [1635 bp, 544 aa] {ON} YMR279C (REAL)    54   6e-07
SAKL0C12122g Chr3 (1086281..1088116) [1836 bp, 611 aa] {ON} simi...    54   6e-07
Skud_13.244 Chr13 complement(417271..418959) [1689 bp, 562 aa] {...    52   2e-06
YMR088C Chr13 complement(443414..445102) [1689 bp, 562 aa] {ON} ...    52   4e-06
TPHA0M00120 Chr13 (23458..25317) [1860 bp, 619 aa] {ON}                51   4e-06
Suva_13.265 Chr13 complement(424929..426614) [1686 bp, 561 aa] {...    50   8e-06
Skud_6.16 Chr6 (26284..27933) [1650 bp, 549 aa] {ON} YOR378W (REAL)    50   1e-05
Suva_5.2 Chr5 (3340..5223) [1884 bp, 627 aa] {ON} YEL065W (REAL)       50   1e-05
NCAS0A07810 Chr1 complement(1554541..1556247) [1707 bp, 568 aa] ...    49   4e-05
KLTH0G09504g Chr7 complement(792202..794076) [1875 bp, 624 aa] {...    49   4e-05
Kwal_23.5241 s23 (1071768..1073543) [1776 bp, 591 aa] {ON} YEL06...    48   5e-05
NCAS0D02350 Chr4 (439325..441229) [1905 bp, 634 aa] {ON}               48   5e-05
SAKL0E02992g Chr5 complement(243652..245364) [1713 bp, 570 aa] {...    47   7e-05
Kpol_416.5 s416 (23208..25031) [1824 bp, 607 aa] {ON} (23208..25...    47   7e-05
Kwal_34.15746 s34 (37757..39313) [1557 bp, 518 aa] {ON} YGR224W ...    47   8e-05
NDAI0I02650 Chr9 (617474..619390) [1917 bp, 638 aa] {ON}               47   1e-04
Kpol_416.6 s416 (26742..28535) [1794 bp, 597 aa] {ON} (26742..28...    47   1e-04
TDEL0G04740 Chr7 complement(865319..867124) [1806 bp, 601 aa] {O...    47   1e-04
Skud_5.24 Chr5 (26839..28722) [1884 bp, 627 aa] {ON} YEL065W (REAL)    45   3e-04
SAKL0C02178g Chr3 complement(191542..193239) [1698 bp, 565 aa] {...    45   5e-04
Kwal_23.4853 s23 complement(895045..896856) [1812 bp, 603 aa] {O...    45   5e-04
KLLA0F13684g Chr6 complement(1267367..1269082) [1716 bp, 571 aa]...    44   7e-04
KLTH0A01562g Chr1 complement(138389..140236) [1848 bp, 615 aa] {...    44   8e-04
SAKL0F00440g Chr6 complement(36452..38086) [1635 bp, 544 aa] {ON...    44   8e-04
KLTH0H16214g Chr8 complement(1398230..1399885) [1656 bp, 551 aa]...    44   0.001
Kpol_467.24 s467 (55523..56632) [1110 bp, 370 aa] {ON} (55523..5...    43   0.001
Suva_10.11 Chr10 (18934..20556) [1623 bp, 540 aa] {ON} YOR378W (...    43   0.001
NDAI0H02200 Chr8 complement(536385..538100) [1716 bp, 571 aa] {O...    43   0.002
CAGL0J01375g Chr10 (127843..129537) [1695 bp, 564 aa] {ON} simil...    43   0.002
Smik_5.22 Chr5 (30048..31934) [1887 bp, 628 aa] {ON} YEL065W (REAL)    43   0.002
YEL065W Chr5 (27657..29543) [1887 bp, 628 aa] {ON}  SIT1Ferrioxa...    43   0.002
CAGL0E04092g Chr5 (394380..396317) [1938 bp, 645 aa] {ON} simila...    43   0.002
NDAI0A02050 Chr1 complement(456678..458531) [1854 bp, 617 aa] {O...    43   0.002
SAKL0G06600g Chr7 complement(549492..551381) [1890 bp, 629 aa] {...    43   0.002
Kpol_513.33 s513 complement(95274..97154) [1881 bp, 626 aa] {ON}...    42   0.005
YKR106W Chr11 (661442..663289) [1848 bp, 615 aa] {ON}  GEX2Proto...    42   0.005
YCL073C Chr3 complement(6479..8326) [1848 bp, 615 aa] {ON}  GEX1...    42   0.005
Skud_18.6 Chr18 (14597..16429) [1833 bp, 610 aa] {ON} YCL073C (R...    42   0.005
KLTH0B10142g Chr2 complement(847376..849082) [1707 bp, 568 aa] {...    41   0.007
TDEL0A02490 Chr1 (446429..448093) [1665 bp, 554 aa] {ON} Anc_2.4...    41   0.007
SAKL0F00792g Chr6 (70444..72297) [1854 bp, 617 aa] {ON} similar ...    41   0.009
KAFR0D00790 Chr4 (168111..169796) [1686 bp, 561 aa] {ON}               40   0.016
Smik_21.4 Chr21 (1261..3078) [1818 bp, 605 aa] {ON} YOL158C (REAL)     40   0.018
KAFR0I01560 Chr9 (328940..330838) [1899 bp, 632 aa] {ON}  YHL040C      40   0.019
Skud_2.423 Chr2 (756345..758027) [1683 bp, 560 aa] {ON} YBR293W ...    40   0.021
SAKL0E04246g Chr5 (336416..338113) [1698 bp, 565 aa] {ON} weakly...    40   0.021
Ecym_7399 Chr7 complement(820280..821971) [1692 bp, 563 aa] {ON}...    40   0.021
KLLA0F17776g Chr6 complement(1627198..1628859) [1662 bp, 553 aa]...    39   0.022
TDEL0D06610 Chr4 complement(1195341..1196834) [1494 bp, 497 aa] ...    39   0.025
Kwal_34.15711 s34 (21213..23069) [1857 bp, 618 aa] {ON} YHL047C ...    39   0.025
ZYRO0C01430g Chr3 complement(101140..102912) [1773 bp, 590 aa] {...    39   0.026
Kwal_56.22298 s56 (31819..33651) [1833 bp, 610 aa] {ON} YHL040C ...    39   0.029
YOL158C Chr15 complement(19491..21311) [1821 bp, 606 aa] {ON}  E...    39   0.034
TPHA0B00180 Chr2 complement(29722..31623) [1902 bp, 633 aa] {ON}       39   0.047
NCAS0A11500 Chr1 complement(2274436..2276280) [1845 bp, 614 aa] ...    39   0.048
ZYRO0G03234g Chr7 (247798..249486) [1689 bp, 562 aa] {ON} simila...    39   0.049
TPHA0G03150 Chr7 (670343..672145) [1803 bp, 600 aa] {ON} Anc_2.4...    39   0.050
NCAS0I00110 Chr9 complement(5312..6670) [1359 bp, 452 aa] {ON}         38   0.063
KLLA0C19272g Chr3 complement(1717903..1719774) [1872 bp, 623 aa]...    38   0.063
KAFR0D00930 Chr4 complement(195566..197410) [1845 bp, 614 aa] {O...    38   0.065
TDEL0H00130 Chr8 complement(10267..12132) [1866 bp, 621 aa] {ON}       38   0.068
KLLA0A10439g Chr1 complement(913342..915246) [1905 bp, 634 aa] {...    38   0.074
KNAG0E02560 Chr5 (506517..508253) [1737 bp, 578 aa] {ON} Anc_2.4...    38   0.077
Smik_11.370 Chr11 (653235..654554) [1320 bp, 440 aa] {ON} YKR106...    37   0.10 
Smik_6.22 Chr6 complement(31536..33446) [1911 bp, 636 aa] {ON} Y...    37   0.10 
Kwal_14.722 s14 (9019..10854) [1836 bp, 611 aa] {ON} YCL073C - H...    37   0.11 
KNAG0J02980 Chr10 (571855..573765) [1911 bp, 636 aa] {ON}              37   0.13 
NDAI0H00140 Chr8 complement(10247..12145) [1899 bp, 632 aa] {ON}       37   0.13 
Suva_10.9 Chr10 complement(12679..14592) [1914 bp, 637 aa] {ON} ...    37   0.14 
KLTH0D16962g Chr4 (1399514..1401229) [1716 bp, 571 aa] {ON} simi...    37   0.16 
Skud_6.14 Chr6 complement(19547..21457) [1911 bp, 636 aa] {ON} Y...    37   0.20 
KLTH0D00506g Chr4 (47320..49170) [1851 bp, 616 aa] {ON} similar ...    36   0.21 
KLLA0E14609g Chr5 (1302073..1303992) [1920 bp, 639 aa] {ON} simi...    36   0.23 
ZYRO0G07414g Chr7 complement(583978..586101) [2124 bp, 707 aa] {...    36   0.23 
YBR293W Chr2 (787006..788430) [1425 bp, 474 aa] {ON}  VBA2Permea...    36   0.28 
TPHA0G03780 Chr7 complement(800134..801972) [1839 bp, 612 aa] {O...    36   0.29 
SAKL0G03300g Chr7 (268199..270049) [1851 bp, 616 aa] {ON} simila...    36   0.30 
Suva_4.553 Chr4 (959592..961280) [1689 bp, 562 aa] {ON} YBR293W ...    36   0.30 
YPR198W Chr16 (934034..935665) [1632 bp, 543 aa] {ON}  SGE1Plasm...    36   0.33 
Suva_26.1 Chr26 (1..1602) [1602 bp, 534 aa] {ON} YOL158C (REAL)        35   0.34 
Kpol_543.44 s543 (96992..98923) [1932 bp, 643 aa] {ON} (96992..9...    35   0.36 
TBLA0F03040 Chr6 complement(735352..738072) [2721 bp, 906 aa] {O...    35   0.39 
ABL040W Chr2 (321534..323237) [1704 bp, 567 aa] {ON} Syntenic ho...    35   0.42 
KLTH0D18150g Chr4 complement(1502817..1504640) [1824 bp, 607 aa]...    35   0.44 
SAKL0F00110g Chr6 (1456..3318) [1863 bp, 620 aa] {ON} similar to...    35   0.45 
TBLA0C01040 Chr3 (208261..210270) [2010 bp, 669 aa] {ON}               35   0.51 
Skud_16.503 Chr16 (880571..882202) [1632 bp, 543 aa] {ON} YPR198...    35   0.55 
AGR076C Chr7 complement(871564..873624) [2061 bp, 686 aa] {ON} S...    35   0.57 
Smik_17.11 Chr17 complement(8582..10216) [1635 bp, 544 aa] {ON} ...    35   0.61 
Skud_8.3 Chr8 complement(7094..8989) [1896 bp, 631 aa] {ON} YHL0...    35   0.61 
KLLA0A04631g Chr1 complement(415070..416809) [1740 bp, 579 aa] {...    35   0.64 
TDEL0H01600 Chr8 complement(273692..275506) [1815 bp, 604 aa] {O...    34   0.82 
KLTH0D00110g Chr4 (796..2658) [1863 bp, 620 aa] {ON} similar to ...    34   0.87 
KLTH0B10450g Chr2 complement(885429..887291) [1863 bp, 620 aa] {...    34   0.87 
SAKL0A00726g Chr1 (82164..83960) [1797 bp, 598 aa] {ON} similar ...    34   0.89 
YKR105C Chr11 complement(658716..660464) [1749 bp, 582 aa] {ON} ...    34   0.96 
NDAI0D01020 Chr4 complement(229357..231135) [1779 bp, 592 aa] {O...    34   1.0  
Kwal_23.2794 s23 (15194..17053) [1860 bp, 619 aa] {ON} YHL047C (...    34   1.1  
TDEL0B00140 Chr2 (25633..27531) [1899 bp, 632 aa] {ON}                 34   1.2  
KNAG0K01020 Chr11 complement(198213..200012) [1800 bp, 599 aa] {...    34   1.2  
Smik_2.434 Chr2 (773094..774518) [1425 bp, 474 aa] {ON} YBR293W ...    33   1.5  
KLLA0F03168g Chr6 (294261..295817) [1557 bp, 518 aa] {ON} simila...    33   1.7  
Kwal_26.9616 s26 (1294683..1296371) [1689 bp, 562 aa] {ON} YPR19...    33   1.8  
CAGL0J09020g Chr10 (889269..891839) [2571 bp, 856 aa] {ON} highl...    33   1.9  
SAKL0A08228g Chr1 complement(732518..734227) [1710 bp, 569 aa] {...    33   1.9  
Suva_8.12 Chr8 complement(20611..22512) [1902 bp, 633 aa] {ON} Y...    33   2.0  
SAKL0E00132g Chr5 (3269..5131) [1863 bp, 620 aa] {ON} similar to...    33   2.1  
Kwal_26.7755 s26 (500034..501713) [1680 bp, 559 aa] {ON} YMR088C...    33   2.1  
Smik_11.368 Chr11 complement(649880..651622) [1743 bp, 580 aa] {...    33   2.3  
SAKL0A07480g Chr1 complement(658699..660420) [1722 bp, 573 aa] {...    33   2.3  
TBLA0B10150 Chr2 (2445764..2447479) [1716 bp, 571 aa] {ON}             33   2.5  
ZYRO0A00330g Chr1 (19597..21327) [1731 bp, 576 aa] {ON} similar ...    33   2.7  
KLTH0A07964g Chr1 complement(670591..672450) [1860 bp, 619 aa] {...    33   3.1  
TPHA0O00950 Chr15 complement(176003..177682) [1680 bp, 559 aa] {...    32   3.2  
KLTH0D05434g Chr4 (486319..488049) [1731 bp, 576 aa] {ON} simila...    32   3.4  
SAKL0H16808g Chr8 complement(1477137..1479110) [1974 bp, 657 aa]...    32   3.4  
KLTH0G13464g Chr7 complement(1154304..1156085) [1782 bp, 593 aa]...    32   3.4  
KLTH0C10142g Chr3 (842371..844092) [1722 bp, 573 aa] {ON} simila...    32   3.5  
KLTH0E04400g Chr5 (397784..399256) [1473 bp, 490 aa] {ON} weakly...    32   3.9  
KLTH0B00110g Chr2 complement(1655..3538) [1884 bp, 627 aa] {ON} ...    32   4.0  
NCAS0C03460 Chr3 complement(690089..691981) [1893 bp, 630 aa] {O...    32   4.3  
ZYRO0D13310g Chr4 complement(1118820..1120670) [1851 bp, 616 aa]...    32   4.4  
KLLA0D19941g Chr4 complement(1698889..1700724) [1836 bp, 611 aa]...    32   4.5  
YHL040C Chr8 complement(19088..20971) [1884 bp, 627 aa] {ON}  AR...    32   5.0  
Smik_16.81 Chr16 complement(152022..153515,153516..153899) [1878...    32   5.1  
KLLA0B05841g Chr2 complement(522241..527877) [5637 bp, 1878 aa] ...    32   5.5  
SAKL0D04510g Chr4 complement(360010..361605) [1596 bp, 531 aa] {...    32   5.9  
KLTH0C10120g Chr3 (839780..841735) [1956 bp, 651 aa] {ON} simila...    32   5.9  
KLLA0F03311g Chr6 (311639..313267) [1629 bp, 542 aa] {ON} simila...    32   6.2  
KAFR0J00930 Chr10 (168674..170374) [1701 bp, 566 aa] {ON} Anc_2....    32   6.7  
Kwal_56.23754 s56 complement(690851..692620) [1770 bp, 589 aa] {...    31   7.3  
TDEL0G03260 Chr7 (605429..607267) [1839 bp, 612 aa] {ON}               31   7.7  
TPHA0C01450 Chr3 complement(329744..332848) [3105 bp, 1034 aa] {...    31   7.8  
Skud_15.474 Chr15 complement(829767..831335) [1569 bp, 522 aa] {...    31   8.6  
CAGL0B02189g Chr2 complement(202354..205617) [3264 bp, 1087 aa] ...    31   8.6  
Ecym_4298 Chr4 complement(636605..638641) [2037 bp, 678 aa] {ON}...    31   8.9  
TDEL0F03990 Chr6 (740471..742366) [1896 bp, 631 aa] {ON} Anc_8.2...    31   9.2  
Smik_8.1 Chr8 complement(2797..4680) [1884 bp, 627 aa] {ON} YHL0...    31   9.6  

>TBLA0D03270 Chr4 complement(813041..814693) [1653 bp, 550 aa] {ON}
           Anc_8.843 YMR279C
          Length = 550

 Score = 1051 bits (2719), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 523/550 (95%), Positives = 523/550 (95%)

Query: 1   MFSMEENPSXXXXXXXXXXXXXXCKNPEQQSLKNIDSRSSLNSSLTQVLSTDTADNDESS 60
           MFSMEENPS              CKNPEQQSLKNIDSRSSLNSSLTQVLSTDTADNDESS
Sbjct: 1   MFSMEENPSDNTINEINYTNNEDCKNPEQQSLKNIDSRSSLNSSLTQVLSTDTADNDESS 60

Query: 61  SYQNPDYFKNKYQEFGFIFSGMIGQLLSQAGLTQTLSIMNVLAKELDSTSSRQAWLMSSF 120
           SYQNPDYFKNKYQEFGFIFSGMIGQLLSQAGLTQTLSIMNVLAKELDSTSSRQAWLMSSF
Sbjct: 61  SYQNPDYFKNKYQEFGFIFSGMIGQLLSQAGLTQTLSIMNVLAKELDSTSSRQAWLMSSF 120

Query: 121 PLALGSFILVSGRLGDIYGLKKILLGGYIITTVWSIICGLSSYAHNDAFFITARAFQGLG 180
           PLALGSFILVSGRLGDIYGLKKILLGGYIITTVWSIICGLSSYAHNDAFFITARAFQGLG
Sbjct: 121 PLALGSFILVSGRLGDIYGLKKILLGGYIITTVWSIICGLSSYAHNDAFFITARAFQGLG 180

Query: 181 LAFALPNMIGLIGTIYRPGCFRKNMIISIIGAMSPXXXXXXXXXXXXXVKYDKSNWPWSF 240
           LAFALPNMIGLIGTIYRPGCFRKNMIISIIGAMSP             VKYDKSNWPWSF
Sbjct: 181 LAFALPNMIGLIGTIYRPGCFRKNMIISIIGAMSPTGATLGGLFAGLTVKYDKSNWPWSF 240

Query: 241 YAFGLISFVNLIISWYCIPNSIPTNIHGLKMDWLGSVLGVFGLIILNFVFNQAPIVGWQS 300
           YAFGLISFVNLIISWYCIPNSIPTNIHGLKMDWLGSVLGVFGLIILNFVFNQAPIVGWQS
Sbjct: 241 YAFGLISFVNLIISWYCIPNSIPTNIHGLKMDWLGSVLGVFGLIILNFVFNQAPIVGWQS 300

Query: 301 AYIIVLLVLSFCALVIFVVYEVKYAKTPLIPKAISSNRGMLMILFSLFCGWGSFGIWTFY 360
           AYIIVLLVLSFCALVIFVVYEVKYAKTPLIPKAISSNRGMLMILFSLFCGWGSFGIWTFY
Sbjct: 301 AYIIVLLVLSFCALVIFVVYEVKYAKTPLIPKAISSNRGMLMILFSLFCGWGSFGIWTFY 360

Query: 361 YFSFELNLRHYSPLWAGSSYFIFVISGSTVAIVCGLTIKKIKPSVLFCCSMMGFLGGNII 420
           YFSFELNLRHYSPLWAGSSYFIFVISGSTVAIVCGLTIKKIKPSVLFCCSMMGFLGGNII
Sbjct: 361 YFSFELNLRHYSPLWAGSSYFIFVISGSTVAIVCGLTIKKIKPSVLFCCSMMGFLGGNII 420

Query: 421 FAATPVNQTFFRNMLGCMFLLPLGMDFSFPASSIILSDSLPMQYQGMAGSLVNTVINYST 480
           FAATPVNQTFFRNMLGCMFLLPLGMDFSFPASSIILSDSLPMQYQGMAGSLVNTVINYST
Sbjct: 421 FAATPVNQTFFRNMLGCMFLLPLGMDFSFPASSIILSDSLPMQYQGMAGSLVNTVINYST 480

Query: 481 SICLGMAGTVEMKHNSHGKDLLNGYRAAIYFAIGLAGLAVCVSGGYMIECLWKDRVLSLE 540
           SICLGMAGTVEMKHNSHGKDLLNGYRAAIYFAIGLAGLAVCVSGGYMIECLWKDRVLSLE
Sbjct: 481 SICLGMAGTVEMKHNSHGKDLLNGYRAAIYFAIGLAGLAVCVSGGYMIECLWKDRVLSLE 540

Query: 541 ENKQTDIESS 550
           ENKQTDIESS
Sbjct: 541 ENKQTDIESS 550

>TBLA0D03280 Chr4 complement(815937..817679) [1743 bp, 580 aa] {ON} 
          Length = 580

 Score =  689 bits (1779), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 335/530 (63%), Positives = 411/530 (77%), Gaps = 10/530 (1%)

Query: 30  QSLKNIDSRSSLNSSLTQVL------STDTADNDESSSYQN----PDYFKNKYQEFGFIF 79
           Q  KN    S  N+S+ +V+      S D+  N E+   +N    P YFKN+  E+ FI 
Sbjct: 44  QLKKNYSQDSQTNTSMNEVIGSISSVSNDSDINSENLQSENKVLSPKYFKNRTHEYLFII 103

Query: 80  SGMIGQLLSQAGLTQTLSIMNVLAKELDSTSSRQAWLMSSFPLALGSFILVSGRLGDIYG 139
           S M+ Q +SQAGLTQ LSIMN+LA+EL++  SRQAWLM+SF L++GSFILVSGRLGDIYG
Sbjct: 104 SCMVSQFMSQAGLTQALSIMNILAEELNAEKSRQAWLMASFTLSMGSFILVSGRLGDIYG 163

Query: 140 LKKILLGGYIITTVWSIICGLSSYAHNDAFFITARAFQGLGLAFALPNMIGLIGTIYRPG 199
           LKK+LLGGY I T+WS+ICG SSY+HNDAFFIT+RAFQGLGLAF LPN +GLIG IY PG
Sbjct: 164 LKKVLLGGYAILTIWSLICGFSSYSHNDAFFITSRAFQGLGLAFVLPNSLGLIGVIYEPG 223

Query: 200 CFRKNMIISIIGAMSPXXXXXXXXXXXXXVKYDKSNWPWSFYAFGLISFVNLIISWYCIP 259
             +KNMII  +GAMSP                D   WPWSFY+FG++SF N+I+SWY IP
Sbjct: 224 SMKKNMIIGTLGAMSPIGATLGGLFAGIIGTKDPKQWPWSFYSFGIVSFCNMILSWYSIP 283

Query: 260 NSIPTNIHGLKMDWLGSVLGVFGLIILNFVFNQAPIVGWQSAYIIVLLVLSFCALVIFVV 319
           N+IPTNI+ L MDW+G++LG+FGL+ILNFVFNQAPIVGWQSAYIIVLLVLSFCALVIFVV
Sbjct: 284 NNIPTNIYNLSMDWIGAILGIFGLLILNFVFNQAPIVGWQSAYIIVLLVLSFCALVIFVV 343

Query: 320 YEVKYAKTPLIPKAISSNRGMLMILFSLFCGWGSFGIWTFYYFSFELNLRHYSPLWAGSS 379
           YEVKYAKTPLIPKAISSNRGMLMILF+LFCGWG+FG WTFYYFSF LN+R Y+  WAG S
Sbjct: 344 YEVKYAKTPLIPKAISSNRGMLMILFALFCGWGAFGTWTFYYFSFVLNVRGYTAAWAGGS 403

Query: 380 YFIFVISGSTVAIVCGLTIKKIKPSVLFCCSMMGFLGGNIIFAATPVNQTFFRNMLGCMF 439
           YFIF++SG  +A +CG  +KK+ PSV+   SM+GF+GG ++   TP++Q++F+N+LG MF
Sbjct: 404 YFIFIVSGCAIATLCGFMMKKVPPSVILYISMIGFMGGCVMLTVTPIHQSYFQNILGIMF 463

Query: 440 LLPLGMDFSFPASSIILSDSLPMQYQGMAGSLVNTVINYSTSICLGMAGTVEMKHNSHGK 499
           +LP+G+D SFPA+SIILSD+LP+QYQGMAGSLV T+ NYSTSICLGMAG+VE  HN +G+
Sbjct: 464 VLPIGIDLSFPAASIILSDALPIQYQGMAGSLVYTITNYSTSICLGMAGSVEAYHNDNGQ 523

Query: 500 DLLNGYRAAIYFAIGLAGLAVCVSGGYMIECLWKDRVLSLEENKQTDIES 549
           ++L GYR A+ FA  LAGL + VSG YM+  L   R  S   NK   +E+
Sbjct: 524 NILKGYRNAMIFADALAGLGIIVSGIYMVINLITIRENSKSTNKPKHLET 573

>TBLA0C01160 Chr3 complement(246034..247836) [1803 bp, 600 aa] {ON} 
          Length = 600

 Score =  640 bits (1651), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/527 (59%), Positives = 399/527 (75%), Gaps = 4/527 (0%)

Query: 27  PEQQSL--KNIDSRSSLNSSLTQVLSTDTADNDESSSYQNPDYFKNKYQEFGFIFSGMIG 84
           P+ Q+L  +NI   +S  SSL+     +     ES + + PD FKN++QEFGF+  G+IG
Sbjct: 73  PKDQNLVCQNIMQFASFESSLSATPPDNKPFITESQNLRRPDIFKNRFQEFGFVLVGVIG 132

Query: 85  QLLSQAGLTQTLSIMNVLAKELDSTSSRQAWLMSSFPLALGSFILVSGRLGDIYGLKKIL 144
           Q LSQ GLTQ LS MN+LA+EL +T  RQ WLM++FPL LG  IL+SGRLGDI+GLKK+L
Sbjct: 133 QFLSQVGLTQVLSTMNILAEELHTTKMRQPWLMAAFPLGLGCTILISGRLGDIFGLKKVL 192

Query: 145 LGGYIITTVWSIICGLSSYAHNDAFFITARAFQGLGLAFALPNMIGLIGTIYRPGCFRKN 204
           L GYIITT+W++ICG SSYAH+D  FI +R FQGLGLA ALPNM  LIG IY+P CF+KN
Sbjct: 193 LLGYIITTIWTLICGFSSYAHSDDLFIVSRTFQGLGLACALPNMFELIGIIYKPHCFKKN 252

Query: 205 MIISIIGAMSPXXXXXXXXXXXXXVKYDKSNWPWSFYAFGLISFVNLIISWYCIPNSIPT 264
           MI  IIGAMSP             VKY+  NWPWSFY+F +++F+N II+W+CIPN I  
Sbjct: 253 MIFCIIGAMSPIGATLGGIFAGLSVKYNIKNWPWSFYSFAIVAFLNGIIAWFCIPNDIEK 312

Query: 265 NIHGLKMDWLGSVLGVFGLIILNFVFNQAPIVGWQSAYIIVLLVLSFCALVIFVVYEVKY 324
           N  GLKMDW+GS LG+FGL++LNFVFNQ PI GW SAY+IVLLV+S  AL++FV+YE+  
Sbjct: 313 NPQGLKMDWIGSALGLFGLVVLNFVFNQTPIDGWSSAYLIVLLVVSVVALILFVIYELTM 372

Query: 325 AKTPLIPKAISSNRGMLMILFSLFCGWGSFGIWTFYYFSFELNLRHYSPLWAGSSYFIFV 384
           A  PLIPK I SN  +++IL +LFCGWG F IWTFYYF+F+LNLRHYSPLWA SS F+ +
Sbjct: 373 ANFPLIPKGIHSNYRLILILLTLFCGWGGFAIWTFYYFAFQLNLRHYSPLWASSSNFVLI 432

Query: 385 ISGSTVAIVCGLTIKKIKPSVLFCCSMMGFLGGNIIFAATPVNQTFFRNMLGCMFLLPLG 444
           ISG+   I+C L ++++KP +L   SM+GFLGGNI+FA TP++QTFFRNM G MFL PLG
Sbjct: 433 ISGTIYTIICCLAVQRMKPPILLFFSMLGFLGGNILFAVTPIHQTFFRNMFGSMFLFPLG 492

Query: 445 MDFSFPASSIILSDSLPMQYQGMAGSLVNTVINYSTSICLGMAGTVEMKHNSHGKDLLNG 504
           M FSFP++S++ +++LP  Y+ MAGSLVN  INY+TSIC+GMAG+  + HN+HG+DLL+G
Sbjct: 493 MVFSFPSASMMTAETLPTHYKSMAGSLVNVAINYATSICVGMAGSANVNHNNHGQDLLHG 552

Query: 505 YRAAIYFAIGLAGLAVCVSGGYMIECLWKDRVLSLEENK--QTDIES 549
           +RAA Y AIGL+G +V +SG YMI  +W DR   ++ENK   TD ES
Sbjct: 553 FRAASYLAIGLSGFSVFLSGLYMIGSIWTDRNQKMKENKLINTDSES 599

>Kpol_541.16 s541 complement(43396..44982) [1587 bp, 528 aa] {ON}
           complement(43396..44982) [1587 nt, 529 aa]
          Length = 528

 Score =  608 bits (1569), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/525 (58%), Positives = 390/525 (74%), Gaps = 15/525 (2%)

Query: 33  KNIDSRSSLNSSLTQVLSTDTAD-NDES-------SSYQNPDYFKNKYQEFGFIFSGMIG 84
           KNI+  S +     + + +D +D NDES       SS +NPDYF +  QE+ FIFS M+ 
Sbjct: 8   KNIEVSSYIAE---ETIRSDCSDANDESPSMELKNSSLRNPDYFNSTTQEYAFIFSCMLS 64

Query: 85  QLLSQAGLTQTLSIMNVLAKELDSTSSRQAWLMSSFPLALGSFILVSGRLGDIYGLKKIL 144
           QLL+ AG TQTLSIMNVL ++L S+ S + WL++SFPL  GSFILVSGRLGDIYGLKK+L
Sbjct: 65  QLLNLAGTTQTLSIMNVLTRQLHSSDSLKVWLVASFPLVSGSFILVSGRLGDIYGLKKML 124

Query: 145 LGGYIITTVWSIICGLSSYAHNDAFFITARAFQGLGLAFALPNMIGLIGTIYRPGCFRKN 204
           + GY+I  +WS+I GLS Y+H+  FFI ARAFQGLG++  LPN++GLIG IY+PG  +KN
Sbjct: 125 ILGYVILVIWSLITGLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLIGMIYKPGTLKKN 184

Query: 205 MIISIIGAMSPXXXXXXXXXXXXXVKYDKSNWPWSFYAFGLISFVNLIISWYCIPNSIPT 264
           M+ISI+GAMSP                 + +WPW+FYA+ L +F+N  IS+Y IPN+IPT
Sbjct: 185 MVISIVGAMSPIGATLGGLFSGLVATESEGSWPWAFYAYTLAAFINTFISYYSIPNNIPT 244

Query: 265 NIHGLKMDWLGSVLGVFGLIILNFVFNQAPIVGWQSAYIIVLLVLSFCALVIFVVYEVKY 324
           N++ L MDW+GS  GV GLI+ NFV+NQAP  GW SAY+IVLLV+S  AL+ F +YE++Y
Sbjct: 245 NVNRLSMDWIGSFTGVLGLILFNFVWNQAPADGWNSAYLIVLLVISVIALIAFGIYELRY 304

Query: 325 AKTPLIPKAISSNRGMLMILFSLFCGWGSFGIWTFYYFSFELNLRHYSPLWAGSSYFIFV 384
           A+ PL+P  I  NR ++MIL ++  GWGSFGIWTFYYFSF LNLR+YSPLWAG SYFIFV
Sbjct: 305 AENPLLPSEIIRNRQLIMILTAMTFGWGSFGIWTFYYFSFVLNLRNYSPLWAGGSYFIFV 364

Query: 385 ISGSTVAIVCGLTIKKIKPSVLFCCSMMGFLGGNIIFAATPVNQTFFRNMLGCMFLLPLG 444
           ISG+  AI CG  +KKI+P+VL   SM+GF  G IIF+ TPV+QT+FRN+LG M +LPLG
Sbjct: 365 ISGTITAISCGFLMKKIRPAVLLTFSMVGFNLGCIIFSVTPVHQTYFRNILGTMIILPLG 424

Query: 445 MDFSFPASSIILSDSLPMQYQGMAGSLVNTVINYSTSICLGMAGTVEMKHNSHGKDLLNG 504
           MD SFPASSIILSD+LP Q+QGMAGSLVNTVINYS S+ LG+AGTVE   N +G DLL G
Sbjct: 425 MDLSFPASSIILSDNLPNQHQGMAGSLVNTVINYSNSLFLGIAGTVEQHCNKNGTDLLRG 484

Query: 505 YRAAIYFAIGLAGLAVCVSGGYMIECLWKDRVLSLEENKQTDIES 549
           YR A+YF I  +G+AV ++G YM+E ++     S ++ K+ D E+
Sbjct: 485 YRGALYFGIACSGVAVLIAGLYMVETIFD----SYKDRKEKDCEN 525

>Suva_13.467 Chr13 complement(807375..809006) [1632 bp, 543 aa] {ON}
           YMR279C (REAL)
          Length = 543

 Score =  595 bits (1534), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/522 (55%), Positives = 373/522 (71%), Gaps = 8/522 (1%)

Query: 28  EQQSLKNIDSR--SSLNSSLTQVLSTDTADN-DESSSYQNPDYFKNKYQEFGFIFSGMIG 84
           ++ S+K  D    SS +  +T V S++ +      S +Q+P YF +  +E  FI + M+ 
Sbjct: 20  DKISMKAEDKVVVSSEDEDVTTVASSNKSTQVSNDSPWQDPTYFSSFGRELMFIVTCMLA 79

Query: 85  QLLSQAGLTQTLSIMNVLAKELDSTSSRQAWLMSSFPLALGSFILVSGRLGDIYGLKKIL 144
           QLL+QAG T  L+IMNVL+K  +S S +QAWLM+SFPL  GSFIL+SGRLGDIYGLKK+L
Sbjct: 80  QLLNQAGQTHALTIMNVLSKSFNSESDKQAWLMASFPLVAGSFILISGRLGDIYGLKKML 139

Query: 145 LGGYIITTVWSIICGLSSYAHNDAFFITARAFQGLGLAFALPNMIGLIGTIYRPGCFRKN 204
           + GY+   VWS+ICGLS Y++NDAFFIT RAFQGLG+AF LPN++GL+G +Y+ G  RKN
Sbjct: 140 MIGYVTIIVWSLICGLSKYSNNDAFFITCRAFQGLGIAFILPNVMGLVGHVYKVGSTRKN 199

Query: 205 MIISIIGAMSPXXXXXXXXXXXXXVKYDKSNWPWSFYAFGLISFVNLIISWYCIPNSIPT 264
           ++IS IGA +P             V  D   WPW FYAF +  F+N+I++WY IPN+IPT
Sbjct: 200 LVISFIGACAPAGGMFGGLFGGLIVNEDSEQWPWVFYAFAIAFFLNMILAWYSIPNNIPT 259

Query: 265 NIHGLKMDWLGSVLGVFGLIILNFVFNQAPIVGWQSAYIIVLLVLSFCALVIFVVYEVKY 324
           N+HG  MDW GSVL V GLI+ NFV+NQAP  GW +AYII LL++S   LV F VYEVKY
Sbjct: 260 NVHGFSMDWTGSVLAVIGLILFNFVWNQAPTAGWGTAYIIALLIISVFFLVAFFVYEVKY 319

Query: 325 AKTPLIPKAISSNRGMLMILFSLFCGWGSFGIWTFYYFSFELNLRHYSPLWAGSSYFIFV 384
           AK PL+P A++ NR M+MIL ++F GWGSFGIWTFYY SF+LNLRHYSP+W G +YF+FV
Sbjct: 320 AKVPLLPHAVTKNRHMIMILLAVFLGWGSFGIWTFYYMSFQLNLRHYSPVWTGGTYFVFV 379

Query: 385 ISGSTVAIVCGLTIKKIKPSVLFCCSMMGFLGGNIIFAATPVNQTFFRNMLGCMFLLPLG 444
           I G+  A +  L+IK++ P+ L C +++ F  G+I+F+  PV Q+F++   G   +L  G
Sbjct: 380 IFGTIAAFMVALSIKRVGPAFLLCFALVAFDVGSIMFSVLPVKQSFWKLNFGMQAILCFG 439

Query: 445 MDFSFPASSIILSDSLPMQYQGMAGSLVNTVINYSTSICLGMAGTVEMKHNSHGKDLLNG 504
           MD SFPASSIILSD LPM+YQGMAGSLVNTVINYS S+CLGM  TVE + N +GKDLL G
Sbjct: 440 MDLSFPASSIILSDGLPMEYQGMAGSLVNTVINYSASLCLGMGATVEHQINKNGKDLLKG 499

Query: 505 YRAAIYFAIGLAGLAVCVSGGYMIECLWKDRVLSLEENKQTD 546
           YR AIY  +GLA L V +S  YM+E  W +R      ++Q D
Sbjct: 500 YRGAIYLGVGLASLGVLISFTYMLETFWNNR-----RDRQKD 536

>TPHA0C04790 Chr3 complement(1033653..1035323) [1671 bp, 556 aa]
           {ON} Anc_8.843 YMR279C
          Length = 556

 Score =  587 bits (1513), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/535 (53%), Positives = 379/535 (70%), Gaps = 13/535 (2%)

Query: 25  KNPEQQSLKNIDSRSSLNSSLTQVLSTDTAD--------NDESSSYQNPDYFKNKYQEFG 76
           ++        ++S   ++SS  QV+ TD+             S S Q P YF +K  E+ 
Sbjct: 21  RSDSDSDNSTVNSSQKIDSS-EQVVPTDSEKYFATVRSSESLSVSSQKPQYFSSKLHEWA 79

Query: 77  FIFSGMIGQLLSQAGLTQTLSIMNVLAKELDSTSSRQAWLMSSFPLALGSFILVSGRLGD 136
           FIF+ ++GQLL+QAG TQ++SIMN++A++  S +S+QAWL +SFPL  GSFILV GR GD
Sbjct: 80  FIFTCLMGQLLNQAGTTQSMSIMNIIAEDFGSETSKQAWLFASFPLVSGSFILVGGRFGD 139

Query: 137 IYGLKKILLGGYIITTVWSIICGLSSYAHNDAFFITARAFQGLGLAFALPNMIGLIGTIY 196
           IYGLKK+LL GY I T+WSIICGL+ Y H+D FFI A+AFQGLG++F LPN+IGL+GTIY
Sbjct: 140 IYGLKKMLLLGYAILTIWSIICGLTHYTHSDDFFIVAKAFQGLGVSFILPNIIGLVGTIY 199

Query: 197 RPGCFRKNMIISIIGAMSPXXXXXXXXXXXXXVKYDKSNWPWSFYAFGLISFVNLIISWY 256
            PG  +KN+ IS IGAM+P             V  D  NWPW+FYAF ++SF+  +  ++
Sbjct: 200 EPGSMKKNITISFIGAMAPLGATFGGLFSGIVVVKDDKNWPWTFYAFAIVSFLVGVTCYF 259

Query: 257 CIPNSIPTNIHGLKMDWLGSVLGVFGLIILNFVFNQAPIVGWQSAYIIVLLVLSFCALVI 316
            +P+++PTN + LKMDW+GS +GV GL++ +FV+NQAP+ GW  AYIIVLLV+S   ++ 
Sbjct: 260 FVPDNVPTNTNNLKMDWIGSAVGVVGLLLFSFVWNQAPMDGWDKAYIIVLLVISVILIIA 319

Query: 317 FVVYEVKYAKTPLIPKAISSNRGMLMILFSLFCGWGSFGIWTFYYFSFELNLRHYSPLWA 376
           F +YE+ YA+ PL+PKAI+ NR ++MIL ++F GWG+FGIW+FYYFSF LNLRH+SP+W 
Sbjct: 320 FFIYEINYAEVPLLPKAITGNRHIIMILLAIFMGWGTFGIWSFYYFSFSLNLRHFSPVWT 379

Query: 377 GSSYFIFVISGSTVAIVCGLTIKKIKPSVLFCCSMMGFLGGNIIFAATPVNQTFFRNMLG 436
           G +YF F++SG T+A   G  IK I+PS++   S+ GF  GN+IFA TP +QT++RN  G
Sbjct: 380 GGAYFAFILSGFTIASCVGFLIKIIRPSIILVISITGFTMGNLIFAVTPADQTYWRNTFG 439

Query: 437 CMFLLPLGMDFSFPASSIILSDSLPMQYQGMAGSLVNTVINYSTSICLGMAGTVEMKHNS 496
            M LLPLGMD SFPASSIILSD LP +YQGMAGSLVNT++NYS S CLG+A TVE + NS
Sbjct: 440 MMLLLPLGMDLSFPASSIILSDQLPPEYQGMAGSLVNTMVNYSQSFCLGVATTVEKQINS 499

Query: 497 HGKDLLNGYRAAIYFAIGLAGLAVCVSGGYMIECLWKDRVLSLEENK-QTDIESS 550
            G DLL GYRAA Y  +G+  L + ++  YM E  W D     E+ K   DIESS
Sbjct: 500 SGDDLLKGYRAAFYTGVGIGTLGISIASLYMFETFWTDYK---EKTKLANDIESS 551

>Suva_13.27 Chr13 (37895..39556) [1662 bp, 553 aa] {ON} YML116W
           (REAL)
          Length = 553

 Score =  580 bits (1496), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/524 (53%), Positives = 381/524 (72%), Gaps = 3/524 (0%)

Query: 25  KNPEQQSLKNIDSRSSLNSSLTQVLSTDTADN--DESSSYQNPDYFKNKYQEFGFIFSGM 82
           +N      ++   R++   +LT ++ T++ D        +QNP+YFK  +QE+ FIF+ M
Sbjct: 28  ENEVALEAEDSSPRNNKEGALTTIVLTNSEDEVMKTKQKWQNPNYFKYPWQEYLFIFTCM 87

Query: 83  IGQLLSQAGLTQTLSIMNVLAKELDSTSSRQAWLMSSFPLALGSFILVSGRLGDIYGLKK 142
           I QLL+Q+G TQTLSIMN+LA    S ++ ++WLM+SFPL  GSFIL+SGR+GDI+GLK 
Sbjct: 88  ISQLLNQSGTTQTLSIMNILADSFGSDANSRSWLMASFPLVSGSFILISGRMGDIFGLKN 147

Query: 143 ILLGGYIITTVWSIICGLSSYAHNDAFFITARAFQGLGLAFALPNMIGLIGTIYRPGCFR 202
           +LL GY++  +WS+ICGL+ Y+ +D FFI +RAFQGLG+AF LPN++G+IG +Y  G FR
Sbjct: 148 MLLIGYVMIIIWSLICGLTKYSGSDTFFIVSRAFQGLGIAFVLPNVLGIIGNVYVGGTFR 207

Query: 203 KNMIISIIGAMSPXXXXXXXXXXXXXVKYDKSNWPWSFYAFGLISFVNLIISWYCIPNSI 262
           KN++IS IGAM+P                + + WPW+FYA+ + + +NLI+S Y IPN+I
Sbjct: 208 KNIVISFIGAMAPIGATLGCFFAGLIGTMNPNQWPWAFYAYTITAVINLILSIYAIPNNI 267

Query: 263 PTNIHGLKMDWLGSVLGVFGLIILNFVFNQAPIVGWQSAYIIVLLVLSFCALVIFVVYEV 322
           PTN+H   MDW+GS LGV GL++LN V+NQAPI GW  AYIIVLL++S   LV+F VYE+
Sbjct: 268 PTNVHRFSMDWIGSGLGVIGLVLLNLVWNQAPISGWNQAYIIVLLIISVLFLVLFGVYEI 327

Query: 323 KYAKTPLIPKAISSNRGMLMILFSLFCGWGSFGIWTFYYFSFELNLRHYSPLWAGSSYFI 382
            +AK+PL+P+A+  +R M+ I+ SLF GWGSFGI+TFYYF F+LN+RHY+PLWAG SYF+
Sbjct: 328 HFAKSPLLPQAVMKDRHMIQIMLSLFFGWGSFGIFTFYYFQFQLNIRHYTPLWAGGSYFM 387

Query: 383 FVISGSTVAIVCGLTIKKIKPSVLFCCSMMGFLGGNIIFAATPVNQTFFRNMLGCMFLLP 442
           F+I G   A++ G +IK++ PSV    +M+ F  G+I+ + TPV++T+FR  +G M +L 
Sbjct: 388 FLIWGIIAALLVGFSIKRVSPSVFLFFAMVAFNVGSIMASVTPVHETYFRMQMGTMIILS 447

Query: 443 LGMDFSFPASSIILSDSLPMQYQGMAGSLVNTVINYSTSICLGMAGTVEMKHNSHGKDLL 502
            GMD SFPASSII SD LPM+YQGMAGSLVNTV+NYS S+CLGM  TVEM+ +  GK +L
Sbjct: 448 FGMDLSFPASSIIFSDYLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVEMQLDPDGKHIL 507

Query: 503 NGYRAAIYFAIGLAGLAVCVSGGYMIECLWKD-RVLSLEENKQT 545
            GYR A Y  IGLA LA  +SG YM+EC  KD R  ++ E+K++
Sbjct: 508 KGYRGAQYLGIGLASLACIISGLYMVECYIKDHRAKAVAEDKRS 551

>Skud_13.25 Chr13 (37872..39485) [1614 bp, 537 aa] {ON} YML116W
           (REAL)
          Length = 537

 Score =  579 bits (1493), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/511 (54%), Positives = 369/511 (72%), Gaps = 3/511 (0%)

Query: 28  EQQSLKNIDSRSSLN-SSLTQVLSTDTADN--DESSSYQNPDYFKNKYQEFGFIFSGMIG 84
           E +S+  +   S  + +  T  +STD  +    +   +QNP+YFKN + E+ FIF+ MI 
Sbjct: 20  ENESVSAVKKSSRHDGNEETVTISTDHGEEMTVDKQRWQNPNYFKNSWHEYLFIFTCMIS 79

Query: 85  QLLSQAGLTQTLSIMNVLAKELDSTSSRQAWLMSSFPLALGSFILVSGRLGDIYGLKKIL 144
           QLL+QAG TQTLSIMN++A    S  + + WLM+SFPL  GSFIL+SGRLGDIYGLKK+L
Sbjct: 80  QLLNQAGTTQTLSIMNIIANSFGSNENSRTWLMASFPLVSGSFILISGRLGDIYGLKKML 139

Query: 145 LGGYIITTVWSIICGLSSYAHNDAFFITARAFQGLGLAFALPNMIGLIGTIYRPGCFRKN 204
             GY++  +WS+ICGL+ Y+ +D FFI +RAFQGLG+AF LPN++G+IG IY  G FRKN
Sbjct: 140 TIGYVVIIIWSLICGLTKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIGNIYVSGTFRKN 199

Query: 205 MIISIIGAMSPXXXXXXXXXXXXXVKYDKSNWPWSFYAFGLISFVNLIISWYCIPNSIPT 264
           ++IS++GAM+P                +   WPW+FYA+ + S +NL +S Y IPN+IPT
Sbjct: 200 IVISLVGAMAPVGATLGCLFAGLIGTKNPKQWPWAFYAYTITSIINLALSVYSIPNNIPT 259

Query: 265 NIHGLKMDWLGSVLGVFGLIILNFVFNQAPIVGWQSAYIIVLLVLSFCALVIFVVYEVKY 324
           NI    MDW+GS LGV GL+++NFV+NQAPI GW  AYIIVLLV+S   LV+F++YE ++
Sbjct: 260 NIQHFSMDWIGSALGVIGLVLMNFVWNQAPISGWDQAYIIVLLVISVVFLVVFIIYENRF 319

Query: 325 AKTPLIPKAISSNRGMLMILFSLFCGWGSFGIWTFYYFSFELNLRHYSPLWAGSSYFIFV 384
           AK+PL+P+A+  +R M+ I+ +LF GWGSFGI+TFYYF F+LN+RHYS +WAG +YF+F+
Sbjct: 320 AKSPLLPRAVLKDRHMIQIMLALFFGWGSFGIFTFYYFQFQLNIRHYSAVWAGGTYFMFL 379

Query: 385 ISGSTVAIVCGLTIKKIKPSVLFCCSMMGFLGGNIIFAATPVNQTFFRNMLGCMFLLPLG 444
           I G   A++ G+ IKK+ PSV    SMM F  G+I+ + TPV++T+FR  LG M +L  G
Sbjct: 380 IWGIIAALLVGIYIKKVSPSVFLFLSMMAFNIGSIMASVTPVHETYFRTQLGTMIILSFG 439

Query: 445 MDFSFPASSIILSDSLPMQYQGMAGSLVNTVINYSTSICLGMAGTVEMKHNSHGKDLLNG 504
           MDFSFPASSII SD+LPM+YQGMAGSLVNTV+NYS S+CLGM  TVE   +  GK +L G
Sbjct: 440 MDFSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVETHVDPDGKHVLKG 499

Query: 505 YRAAIYFAIGLAGLAVCVSGGYMIECLWKDR 535
           YR A Y  IGLA LA  +SG YM+E + KD 
Sbjct: 500 YRGAQYLGIGLASLACIISGLYMVERIIKDH 530

>YMR279C Chr13 complement(824729..826351) [1623 bp, 540 aa] {ON}
           Putative boron transporter involved in boron efflux and
           resistance; overexpression mutant but not null mutant
           displays boron tolerance phenotype; identified as a
           heat-induced gene in a high-throughout screen; YMR279C
           is not an essential gene; paralog of the efflux pump
           ATR1
          Length = 540

 Score =  579 bits (1492), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/500 (56%), Positives = 365/500 (73%)

Query: 46  TQVLSTDTADNDESSSYQNPDYFKNKYQEFGFIFSGMIGQLLSQAGLTQTLSIMNVLAKE 105
           T V ST +      S +Q+P YF +  +E  FI + M+ QLL+QAG T  L IMNVL+K 
Sbjct: 41  TIVSSTKSTQVTNDSPWQDPTYFSSFGKELMFIATCMLAQLLNQAGQTHALCIMNVLSKS 100

Query: 106 LDSTSSRQAWLMSSFPLALGSFILVSGRLGDIYGLKKILLGGYIITTVWSIICGLSSYAH 165
            +S ++ QAWLM+SFPLA GSFIL+SGRLGDIYGLKK+L+ GY+I  VWSII GLS Y++
Sbjct: 101 FNSEANNQAWLMASFPLAAGSFILISGRLGDIYGLKKMLIVGYVIVIVWSIISGLSKYSN 160

Query: 166 NDAFFITARAFQGLGLAFALPNMIGLIGTIYRPGCFRKNMIISIIGAMSPXXXXXXXXXX 225
           +DAFFIT+RAFQG+G+AF LPN++GL+G +Y+ G FRKN++IS IGA +P          
Sbjct: 161 SDAFFITSRAFQGVGIAFILPNIMGLVGHVYKVGSFRKNIVISFIGACAPTGGMFGGLFG 220

Query: 226 XXXVKYDKSNWPWSFYAFGLISFVNLIISWYCIPNSIPTNIHGLKMDWLGSVLGVFGLII 285
              V  D + WPW FYAFG+ +F++L+++WY IPN++PTNIHGL MDW GS L + GLI+
Sbjct: 221 GLIVTEDPNQWPWVFYAFGIATFLSLLMAWYSIPNNVPTNIHGLSMDWTGSALAIIGLIL 280

Query: 286 LNFVFNQAPIVGWQSAYIIVLLVLSFCALVIFVVYEVKYAKTPLIPKAISSNRGMLMILF 345
            NFV+NQAPIVGW   YIIVLL++S   LV F VYE KYA+ PL+P+A++ NR M+MIL 
Sbjct: 281 FNFVWNQAPIVGWDKPYIIVLLIISVIFLVAFFVYESKYAEVPLLPRAMTKNRHMIMILL 340

Query: 346 SLFCGWGSFGIWTFYYFSFELNLRHYSPLWAGSSYFIFVISGSTVAIVCGLTIKKIKPSV 405
           ++F GWGSFGIWTFYY SF+LNLRHYSP+W G +YF+FVI GS  A     +IK++ P++
Sbjct: 341 AVFLGWGSFGIWTFYYVSFQLNLRHYSPVWTGGTYFVFVIFGSMAAFFVAFSIKRLGPAL 400

Query: 406 LFCCSMMGFLGGNIIFAATPVNQTFFRNMLGCMFLLPLGMDFSFPASSIILSDSLPMQYQ 465
           L C S+M F  G+I+F+  PV Q++++       +L  GMD SFPASSIILSD LPMQYQ
Sbjct: 401 LLCFSLMAFDAGSIMFSVLPVEQSYWKLNFAMQAILCFGMDLSFPASSIILSDGLPMQYQ 460

Query: 466 GMAGSLVNTVINYSTSICLGMAGTVEMKHNSHGKDLLNGYRAAIYFAIGLAGLAVCVSGG 525
           GMAGSLVNTVINYS S+CLGM GTVE + N  G DLL GYRAA+Y  +GLA L V +S  
Sbjct: 461 GMAGSLVNTVINYSASLCLGMGGTVEHQINKSGNDLLKGYRAAVYLGVGLASLGVVISVT 520

Query: 526 YMIECLWKDRVLSLEENKQT 545
           YM+E LW     S + + + 
Sbjct: 521 YMLENLWNRHRKSEDRSLEA 540

>Smik_13.492 Chr13 complement(807726..809357) [1632 bp, 543 aa] {ON}
           YMR279C (REAL)
          Length = 543

 Score =  577 bits (1487), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/527 (54%), Positives = 377/527 (71%), Gaps = 6/527 (1%)

Query: 28  EQQSLKNIDSR---SSLNSSLTQVLSTDTADN-DESSSYQNPDYFKNKYQEFGFIFSGMI 83
             +++  +D +   S+ +  +T V S++ ++     S +Q+P YF +  +E  FI + M+
Sbjct: 19  HDKTIMKVDDKVVISTEDEEVTTVTSSNESNQVTNDSPWQDPIYFSSFGKELMFIATCML 78

Query: 84  GQLLSQAGLTQTLSIMNVLAKELDSTSSRQAWLMSSFPLALGSFILVSGRLGDIYGLKKI 143
            QLL+QAG T  L IMNVL+K  +S S+ QAWLM+SFPLA GSFIL+SGRLGDIYGLKK+
Sbjct: 79  AQLLNQAGQTHALCIMNVLSKSFNSESNNQAWLMASFPLAAGSFILISGRLGDIYGLKKM 138

Query: 144 LLGGYIITTVWSIICGLSSYAHNDAFFITARAFQGLGLAFALPNMIGLIGTIYRPGCFRK 203
           LL GY+I  +WSII GLS Y+++DAFFIT RAFQGLG+AF LPN++GL+G +Y+ G  RK
Sbjct: 139 LLIGYVIIIIWSIISGLSKYSNSDAFFITCRAFQGLGIAFILPNIMGLVGHVYKVGSLRK 198

Query: 204 NMIISIIGAMSPXXXXXXXXXXXXXVKYDKSNWPWSFYAFGLISFVNLIISWYCIPNSIP 263
           N++IS+IGA +P             V  D   WPW FYAF + +F++L+++WY IPN++P
Sbjct: 199 NLVISVIGACAPAGGMFGGVFGGLIVTEDPEQWPWVFYAFSIATFISLLMAWYSIPNNVP 258

Query: 264 TNIHGLKMDWLGSVLGVFGLIILNFVFNQAPIVGWQSAYIIVLLVLSFCALVIFVVYEVK 323
           TN+HGL MDW GS L V GLI+ NFV+NQAPI GW  AYIIVLL+LS   L+ F VYE+K
Sbjct: 259 TNVHGLSMDWTGSTLAVLGLILFNFVWNQAPIAGWGEAYIIVLLILSVFFLIAFFVYEIK 318

Query: 324 YAKTPLIPKAISSNRGMLMILFSLFCGWGSFGIWTFYYFSFELNLRHYSPLWAGSSYFIF 383
           YA+ PL+P A++ NR M+MIL ++F GWGSFGIWTFYY SF+LNLRHYSP+W G +YF+F
Sbjct: 319 YAEVPLLPHAVTKNRHMIMILLAVFLGWGSFGIWTFYYVSFQLNLRHYSPVWTGGTYFVF 378

Query: 384 VISGSTVAIVCGLTIKKIKPSVLFCCSMMGFLGGNIIFAATPVNQTFFRNMLGCMFLLPL 443
           VI GS  A     +IK++ P++L C ++M F  G+I+F+  PV Q++++       +L  
Sbjct: 379 VIFGSIAAFFVAFSIKRLGPAILLCFALMAFDAGSIMFSVLPVEQSYWKLNFAMQAILCF 438

Query: 444 GMDFSFPASSIILSDSLPMQYQGMAGSLVNTVINYSTSICLGMAGTVEMKHNSHGKDLLN 503
           GMD SFPASSIILSD LPMQYQGMAGSLVNTVINYS S+CLGM  TVE + N  G++LL 
Sbjct: 439 GMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINYSASLCLGMGVTVERQINKSGQNLLK 498

Query: 504 GYRAAIYFAIGLAGLAVCVSGGYMIECLWKDRVLSLEENKQTDIESS 550
           GYRAAIY  IGLA L + +S  YM+E  W     S  E K+ + E+S
Sbjct: 499 GYRAAIYLGIGLASLGLLISVTYMLENFWNKHKES--EKKRLEAETS 543

>YML116W Chr13 (38196..39824) [1629 bp, 542 aa] {ON}  ATR1Multidrug
           efflux pump of the major facilitator superfamily,
           required for resistance to aminotriazole and
           4-nitroquinoline-N-oxide
          Length = 542

 Score =  576 bits (1485), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/513 (54%), Positives = 373/513 (72%), Gaps = 2/513 (0%)

Query: 25  KNPEQQSLKNIDSRSSLNSSLTQVLSTDTADN--DESSSYQNPDYFKNKYQEFGFIFSGM 82
           +N  +  +K     +++  SLT    T + D   D +  +QNP+YFK  +QE+ FIF+ M
Sbjct: 17  ENETELPVKKSSRDNNIGESLTATAFTQSEDEMVDSNQKWQNPNYFKYAWQEYLFIFTCM 76

Query: 83  IGQLLSQAGLTQTLSIMNVLAKELDSTSSRQAWLMSSFPLALGSFILVSGRLGDIYGLKK 142
           I QLL+QAG TQTLSIMN+L+    S  + ++WLM+SFPL  GSFIL+SGRLGDIYGLKK
Sbjct: 77  ISQLLNQAGTTQTLSIMNILSDSFGSEGNSKSWLMASFPLVSGSFILISGRLGDIYGLKK 136

Query: 143 ILLGGYIITTVWSIICGLSSYAHNDAFFITARAFQGLGLAFALPNMIGLIGTIYRPGCFR 202
           +LL GY++  +WS+ICG++ Y+ +D FFI +RAFQGLG+AF LPN++G+IG IY  G FR
Sbjct: 137 MLLVGYVLVIIWSLICGITKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIGNIYVGGTFR 196

Query: 203 KNMIISIIGAMSPXXXXXXXXXXXXXVKYDKSNWPWSFYAFGLISFVNLIISWYCIPNSI 262
           KN++IS +GAM+P                D   WPW+FYA+ + +F+N ++S Y IP++I
Sbjct: 197 KNIVISFVGAMAPIGATLGCLFAGLIGTEDPKQWPWAFYAYSIAAFINFVLSIYAIPSTI 256

Query: 263 PTNIHGLKMDWLGSVLGVFGLIILNFVFNQAPIVGWQSAYIIVLLVLSFCALVIFVVYEV 322
           PTNIH   MDW+GSVLGV GLI+LNFV+NQAPI GW  AYIIV+L++S   LV+F++YE+
Sbjct: 257 PTNIHHFSMDWIGSVLGVIGLILLNFVWNQAPISGWNQAYIIVILIISVIFLVVFIIYEI 316

Query: 323 KYAKTPLIPKAISSNRGMLMILFSLFCGWGSFGIWTFYYFSFELNLRHYSPLWAGSSYFI 382
           ++AKTPL+P+A+  +R M+ I+ +LF GWGSFGI+TFYYF F+LN+R Y+ LWAG +YF+
Sbjct: 317 RFAKTPLLPRAVIKDRHMIQIMLALFFGWGSFGIFTFYYFQFQLNIRQYTALWAGGTYFM 376

Query: 383 FVISGSTVAIVCGLTIKKIKPSVLFCCSMMGFLGGNIIFAATPVNQTFFRNMLGCMFLLP 442
           F+I G   A++ G TIK + PSV    SM+ F  G+I+ + TPV++T+FR  LG M +L 
Sbjct: 377 FLIWGIIAALLVGFTIKNVSPSVFLFFSMVAFNVGSIMASVTPVHETYFRTQLGTMIILS 436

Query: 443 LGMDFSFPASSIILSDSLPMQYQGMAGSLVNTVINYSTSICLGMAGTVEMKHNSHGKDLL 502
            GMD SFPASSII SD+LPM+YQGMAGSLVNTV+NYS S+CLGM  TVE + NS GK LL
Sbjct: 437 FGMDLSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVETQVNSDGKHLL 496

Query: 503 NGYRAAIYFAIGLAGLAVCVSGGYMIECLWKDR 535
            GYR A Y  IGLA LA  +SG YM+E   K R
Sbjct: 497 KGYRGAQYLGIGLASLACMISGLYMVESFIKGR 529

>NDAI0E00280 Chr5 (37676..39325) [1650 bp, 549 aa] {ON} Anc_8.843
          Length = 549

 Score =  573 bits (1476), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/521 (54%), Positives = 373/521 (71%), Gaps = 2/521 (0%)

Query: 29  QQSLKNIDSRSSLNSSLTQVLSTDTADND--ESSSYQNPDYFKNKYQEFGFIFSGMIGQL 86
           ++   +I    +   S  ++ S++  DN   + S +QNPDYF+NK+QE+ FIFS M+ QL
Sbjct: 28  EEECSSITKEENNEVSEDELPSSEQEDNTIGDHSKWQNPDYFQNKWQEYLFIFSCMMSQL 87

Query: 87  LSQAGLTQTLSIMNVLAKELDSTSSRQAWLMSSFPLALGSFILVSGRLGDIYGLKKILLG 146
           L+QA   QTLSIMN++     S   ++ WL++SFPL  GSFIL+SGR+GDIYGLKK L+G
Sbjct: 88  LNQAATPQTLSIMNIITDSFKSEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLIG 147

Query: 147 GYIITTVWSIICGLSSYAHNDAFFITARAFQGLGLAFALPNMIGLIGTIYRPGCFRKNMI 206
           GY+   +WS+I G + Y+HND FFI +RAFQGLG+AF LPN++G++G IY+P   RKN++
Sbjct: 148 GYLFFIIWSLISGFTDYSHNDIFFIISRAFQGLGIAFILPNVMGIVGNIYKPDTQRKNIV 207

Query: 207 ISIIGAMSPXXXXXXXXXXXXXVKYDKSNWPWSFYAFGLISFVNLIISWYCIPNSIPTNI 266
           IS+IGA +P                +   WPW+FYAF + S +NL IS Y IPN+IPTNI
Sbjct: 208 ISMIGASAPIGAFMGSLFAGLIGTENPKQWPWAFYAFAIASAINLAISIYSIPNNIPTNI 267

Query: 267 HGLKMDWLGSVLGVFGLIILNFVFNQAPIVGWQSAYIIVLLVLSFCALVIFVVYEVKYAK 326
           HG  MDW+GS++ V GLI+LNFV+NQ PIVGWQ AYIIVLL++S  ALV+F  YE+KYAK
Sbjct: 268 HGFAMDWIGSIMAVIGLILLNFVWNQGPIVGWQKAYIIVLLIISIIALVLFFTYEIKYAK 327

Query: 327 TPLIPKAISSNRGMLMILFSLFCGWGSFGIWTFYYFSFELNLRHYSPLWAGSSYFIFVIS 386
           +P++P  ++ NR ++MIL +LF GWGSFGI++FYYFSF LNLRHYS LWAG++YF+F I 
Sbjct: 328 SPILPVEVTKNRHIIMILAALFLGWGSFGIFSFYYFSFLLNLRHYSALWAGTTYFMFAIW 387

Query: 387 GSTVAIVCGLTIKKIKPSVLFCCSMMGFLGGNIIFAATPVNQTFFRNMLGCMFLLPLGMD 446
           G+  A++ G  IK+I  SV+   SM+ F  G I+ + TPV+QT+FR  LG M +L  GMD
Sbjct: 388 GTVAAVIVGAFIKRISASVILFFSMIAFNIGLIMLSVTPVDQTYFRMNLGTMIILSFGMD 447

Query: 447 FSFPASSIILSDSLPMQYQGMAGSLVNTVINYSTSICLGMAGTVEMKHNSHGKDLLNGYR 506
            SFPA++IILSD L MQYQGMAGSL NT++NYS S+CLGM  TVE + N  GK++L GYR
Sbjct: 448 MSFPAAAIILSDGLTMQYQGMAGSLANTMVNYSMSLCLGMGTTVERQINKSGKEILKGYR 507

Query: 507 AAIYFAIGLAGLAVCVSGGYMIECLWKDRVLSLEENKQTDI 547
           AA Y  +GLAGL + +SG YM E LW  R   L  N+  D+
Sbjct: 508 AAEYLGVGLAGLGIVISGIYMAEVLWAKRKERLSSNRDHDM 548

>Skud_13.451 Chr13 complement(798006..799625) [1620 bp, 539 aa] {ON}
           YMR279C (REAL)
          Length = 539

 Score =  570 bits (1470), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/510 (55%), Positives = 370/510 (72%), Gaps = 2/510 (0%)

Query: 28  EQQSLKNIDSR-SSLNSSLTQVLSTDTADN-DESSSYQNPDYFKNKYQEFGFIFSGMIGQ 85
           ++ S+K  D    S +  +T V S+  ++     S +Q+P YF +  +E  FI + M+ Q
Sbjct: 20  DKISMKEEDKVIVSTDEEVTTVASSSKSNQISNDSPWQDPTYFSSFGKELMFIGTCMLAQ 79

Query: 86  LLSQAGLTQTLSIMNVLAKELDSTSSRQAWLMSSFPLALGSFILVSGRLGDIYGLKKILL 145
           LL+QAG T  L IMNVL+K   S S+ QAWLM+SFPLA GSFIL+SGRLGDIYGLKK+L+
Sbjct: 80  LLNQAGQTHALCIMNVLSKSFGSESNNQAWLMASFPLAAGSFILISGRLGDIYGLKKMLM 139

Query: 146 GGYIITTVWSIICGLSSYAHNDAFFITARAFQGLGLAFALPNMIGLIGTIYRPGCFRKNM 205
            GY+I  VWSII GLS Y++ND+FFIT RAFQG+G+AF LPN++GL+G +Y+ G  RKN+
Sbjct: 140 IGYVIIIVWSIISGLSKYSNNDSFFITCRAFQGVGIAFILPNIMGLVGHVYKVGSLRKNL 199

Query: 206 IISIIGAMSPXXXXXXXXXXXXXVKYDKSNWPWSFYAFGLISFVNLIISWYCIPNSIPTN 265
           +IS+IGA  P             V  D + WPW FYAFG+ +F++++++WY IPN++PTN
Sbjct: 200 VISVIGACGPTGALFGGVFGGLIVTEDPNQWPWVFYAFGIATFISMLMAWYSIPNNVPTN 259

Query: 266 IHGLKMDWLGSVLGVFGLIILNFVFNQAPIVGWQSAYIIVLLVLSFCALVIFVVYEVKYA 325
           +HGL MDW GSVL V GLI+ NFV+N+API GW  AYIIVLLV+S   LV F VYE+KYA
Sbjct: 260 VHGLSMDWTGSVLAVIGLILFNFVWNEAPIAGWDKAYIIVLLVVSVFFLVAFFVYEIKYA 319

Query: 326 KTPLIPKAISSNRGMLMILFSLFCGWGSFGIWTFYYFSFELNLRHYSPLWAGSSYFIFVI 385
           + PL+P A++ NR M+MIL ++F GWGSFGIWTFYY SF+LNLRHYSP+W G +YF+F I
Sbjct: 320 EVPLLPHAVTKNRHMIMILLAVFVGWGSFGIWTFYYVSFQLNLRHYSPVWTGGTYFVFAI 379

Query: 386 SGSTVAIVCGLTIKKIKPSVLFCCSMMGFLGGNIIFAATPVNQTFFRNMLGCMFLLPLGM 445
            G+  A     +IK++ P++L C ++M F  G+I+F+  PV Q++++       +L  GM
Sbjct: 380 FGTIAAFFVAFSIKRLGPALLLCFALMAFDAGSIMFSVLPVEQSYWKLNFAMQAVLCFGM 439

Query: 446 DFSFPASSIILSDSLPMQYQGMAGSLVNTVINYSTSICLGMAGTVEMKHNSHGKDLLNGY 505
           D SFPASSIILSD LPMQYQGMAGSLVNTVINYS S+CLGM  TVE + N  GK++L GY
Sbjct: 440 DLSFPASSIILSDGLPMQYQGMAGSLVNTVINYSASLCLGMGATVEHQINKSGKNVLEGY 499

Query: 506 RAAIYFAIGLAGLAVCVSGGYMIECLWKDR 535
           RAA+Y  IGLA L V +S  YM+E +W +R
Sbjct: 500 RAAVYLGIGLASLGVLISVTYMLETVWNER 529

>KAFR0B03940 Chr2 complement(820954..822597) [1644 bp, 547 aa] {ON}
           Anc_8.843 YMR279C
          Length = 547

 Score =  571 bits (1471), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/530 (53%), Positives = 367/530 (69%), Gaps = 8/530 (1%)

Query: 25  KNP-EQQSLKNIDSRSSLN-------SSLTQVLSTDTADNDESSSYQNPDYFKNKYQEFG 76
           KNP E      + +++SL+            +   D +    +S +Q+P YFK+ +QE+ 
Sbjct: 16  KNPIEDFQTTTVTAQTSLDVLSDSVKKDQISITDDDVSSISNNSKWQDPTYFKSSWQEYT 75

Query: 77  FIFSGMIGQLLSQAGLTQTLSIMNVLAKELDSTSSRQAWLMSSFPLALGSFILVSGRLGD 136
           FI + M+  LL+QAG TQTLS MNVLA  L+S  + + WLM+SF LA GSFILVSGR+GD
Sbjct: 76  FIGTCMLANLLNQAGQTQTLSTMNVLADSLNSDGAAKTWLMASFTLASGSFILVSGRIGD 135

Query: 137 IYGLKKILLGGYIITTVWSIICGLSSYAHNDAFFITARAFQGLGLAFALPNMIGLIGTIY 196
           IYGLK   +GG II  +WSI+CG+S Y  N  FFI  RAFQGLG+AF LPN++GL+G IY
Sbjct: 136 IYGLKATFIGGNIIFCIWSILCGVSKYTENVTFFIICRAFQGLGVAFVLPNVMGLVGNIY 195

Query: 197 RPGCFRKNMIISIIGAMSPXXXXXXXXXXXXXVKYDKSNWPWSFYAFGLISFVNLIISWY 256
             G  RKN++IS IG M+P             V  +K  WPW F+A  +  F+NLI+  Y
Sbjct: 196 NVGSMRKNIVISFIGCMAPVGQTFGGMWGGLIVDSNKDQWPWIFFATAIAVFINLIMGIY 255

Query: 257 CIPNSIPTNIHGLKMDWLGSVLGVFGLIILNFVFNQAPIVGWQSAYIIVLLVLSFCALVI 316
            IPN +PTNI+ LKMDW+GS+LGV GLI++NFV+NQAPI GW  AYIIV+L+++   LV 
Sbjct: 256 SIPNHVPTNIYNLKMDWIGSLLGVIGLILMNFVWNQAPISGWSKAYIIVILIVAVFFLVA 315

Query: 317 FVVYEVKYAKTPLIPKAISSNRGMLMILFSLFCGWGSFGIWTFYYFSFELNLRHYSPLWA 376
           F +YE+K A++PL+P  ++ NR ++ I+ SLF GWG+FGIWTFYY++F LNLRH+SPLWA
Sbjct: 316 FFIYELKKAESPLLPPEVTKNRHIVTIIISLFLGWGAFGIWTFYYYAFNLNLRHFSPLWA 375

Query: 377 GSSYFIFVISGSTVAIVCGLTIKKIKPSVLFCCSMMGFLGGNIIFAATPVNQTFFRNMLG 436
           GS++F+F+I GS  AI    TI K+ PSVLFC S +GF  GNIIF+ T  +QT++RN LG
Sbjct: 376 GSTHFVFIIFGSLTAITVAFTINKVGPSVLFCLSSIGFTCGNIIFSVTSPDQTYWRNSLG 435

Query: 437 CMFLLPLGMDFSFPASSIILSDSLPMQYQGMAGSLVNTVINYSTSICLGMAGTVEMKHNS 496
              +L LGMD SFP SSIILSD LPMQYQGM+GSLVNT+ NY+TS+CLGM  T E+++N+
Sbjct: 436 MQIILALGMDLSFPGSSIILSDLLPMQYQGMSGSLVNTITNYATSLCLGMGTTAEVQYNN 495

Query: 497 HGKDLLNGYRAAIYFAIGLAGLAVCVSGGYMIECLWKDRVLSLEENKQTD 546
            GKD+L GYRAA+Y AIGL  L    S  YM E LW       +  K+ D
Sbjct: 496 GGKDVLKGYRAALYVAIGLGALGFAFSFSYMAEDLWIRYRKRRQNEKKED 545

>NCAS0A02540 Chr1 complement(481807..483426) [1620 bp, 539 aa] {ON} 
          Length = 539

 Score =  568 bits (1464), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 273/520 (52%), Positives = 362/520 (69%), Gaps = 1/520 (0%)

Query: 31  SLKNIDSRSSLNSSLTQVLSTDTADNDESSSYQNPDYFKNKYQEFGFIFSGMIGQLLSQA 90
           S  N D   S N       STD+  +D+S  +QNP+YF +KY+E+ FIF+ M+  LL+QA
Sbjct: 20  SFPNEDKNISHNEKEVYSNSTDSVLDDDSP-WQNPNYFSSKYKEYFFIFTCMVANLLNQA 78

Query: 91  GLTQTLSIMNVLAKELDSTSSRQAWLMSSFPLALGSFILVSGRLGDIYGLKKILLGGYII 150
           G TQ LS MNV+++   S S +Q WLM+SFPL  GSFIL+SGR+GDIYGLKK ++GGYI 
Sbjct: 79  GQTQVLSTMNVISESFHSDSGKQTWLMASFPLVSGSFILISGRIGDIYGLKKTMIGGYIF 138

Query: 151 TTVWSIICGLSSYAHNDAFFITARAFQGLGLAFALPNMIGLIGTIYRPGCFRKNMIISII 210
             +WS++CG + + HND FFI  RAFQGLG++F LPN++GLIG IY+ G  RKN++IS+I
Sbjct: 139 MIIWSLLCGFADFTHNDTFFIVCRAFQGLGISFILPNVMGLIGNIYKVGTLRKNIVISMI 198

Query: 211 GAMSPXXXXXXXXXXXXXVKYDKSNWPWSFYAFGLISFVNLIISWYCIPNSIPTNIHGLK 270
           G  +P             V  +   WPW FYA+ L   VNLI++ Y +PN IPTN+H   
Sbjct: 199 GLTAPTGACMGALWGGLIVTENAKQWPWIFYAYALTGLVNLIMALYSVPNCIPTNVHNFA 258

Query: 271 MDWLGSVLGVFGLIILNFVFNQAPIVGWQSAYIIVLLVLSFCALVIFVVYEVKYAKTPLI 330
           MDW+GS++GV GLI+ NFV+NQ P+ GW  AYIIVLL++S   LV FVVYE+KY  +PL+
Sbjct: 259 MDWIGSIIGVVGLILFNFVWNQGPVAGWDKAYIIVLLIISVLFLVAFVVYELKYPISPLL 318

Query: 331 PKAISSNRGMLMILFSLFCGWGSFGIWTFYYFSFELNLRHYSPLWAGSSYFIFVISGSTV 390
           P  ++ N  +L IL  LF GWG+FGIWTFYYF+F+LNLR YSP+W G +YF+F+I G+  
Sbjct: 319 PVEVTKNGQILTILSILFLGWGAFGIWTFYYFAFQLNLRDYSPVWVGGTYFMFIIWGTIA 378

Query: 391 AIVCGLTIKKIKPSVLFCCSMMGFLGGNIIFAATPVNQTFFRNMLGCMFLLPLGMDFSFP 450
           A++   TIKK+ P++L   S +GF  G+++ + TP++Q ++R  LG   +L  GMD SFP
Sbjct: 379 ALIVAFTIKKVGPAILLFFSALGFTMGSLMLSVTPIHQMYWRMNLGMQIILCFGMDLSFP 438

Query: 451 ASSIILSDSLPMQYQGMAGSLVNTVINYSTSICLGMAGTVEMKHNSHGKDLLNGYRAAIY 510
           ASSIILSD LPMQYQGMAGSLVNTVINY+TS+CLGM  TVE + N  G+DLL GYR+A+Y
Sbjct: 439 ASSIILSDHLPMQYQGMAGSLVNTVINYATSLCLGMGTTVERQINKSGEDLLKGYRSALY 498

Query: 511 FAIGLAGLAVCVSGGYMIECLWKDRVLSLEENKQTDIESS 550
            A+GL GL  C++   +   LW  R   L + K    + S
Sbjct: 499 LAVGLGGLGSCIAFINLCYTLWMKRRDRLADLKSVSTDDS 538

>NCAS0B00290 Chr2 (33760..35388) [1629 bp, 542 aa] {ON} Anc_8.843
          Length = 542

 Score =  563 bits (1450), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/501 (55%), Positives = 356/501 (71%)

Query: 47  QVLSTDTADNDESSSYQNPDYFKNKYQEFGFIFSGMIGQLLSQAGLTQTLSIMNVLAKEL 106
            V+S       E S +QNPDYF+N++QE+ FIFS M+ QLL+QA   QTLSIMN++    
Sbjct: 41  DVISQTETPQLEHSKWQNPDYFQNQWQEYLFIFSCMMSQLLNQAATPQTLSIMNIITDSF 100

Query: 107 DSTSSRQAWLMSSFPLALGSFILVSGRLGDIYGLKKILLGGYIITTVWSIICGLSSYAHN 166
           +S   ++ WL++SFPL  GSFIL+SGR+GDIYGLKK L+GGYI   +WSII GL+ Y+H+
Sbjct: 101 NSEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLVGGYIFFIIWSIISGLTKYSHS 160

Query: 167 DAFFITARAFQGLGLAFALPNMIGLIGTIYRPGCFRKNMIISIIGAMSPXXXXXXXXXXX 226
           D FFI +RAFQGL +AF LPN++G++G IY+P   RKN++IS+IGA +P           
Sbjct: 161 DTFFIVSRAFQGLSIAFILPNVMGIVGNIYKPDSNRKNIVISMIGASAPIGAFFGSLFAG 220

Query: 227 XXVKYDKSNWPWSFYAFGLISFVNLIISWYCIPNSIPTNIHGLKMDWLGSVLGVFGLIIL 286
                D   WPW+FYAF + S  NL IS Y IPNS+PTN+HG  MDW+GSVL V GLI+L
Sbjct: 221 LIGTEDPDQWPWAFYAFAIASAFNLAISIYSIPNSVPTNVHGFAMDWIGSVLAVIGLILL 280

Query: 287 NFVFNQAPIVGWQSAYIIVLLVLSFCALVIFVVYEVKYAKTPLIPKAISSNRGMLMILFS 346
           NFV+NQ PIVGWQ+AYII LLV+S   L +F  YEVKYA++PL+P  ++ NR ++MIL +
Sbjct: 281 NFVWNQGPIVGWQTAYIIALLVVSVFFLALFFTYEVKYAESPLLPVEVTKNRHIIMILAA 340

Query: 347 LFCGWGSFGIWTFYYFSFELNLRHYSPLWAGSSYFIFVISGSTVAIVCGLTIKKIKPSVL 406
           LF GWGSFGI++FYYFSF LNLRHYS LWAG++YF+F I G+  A++ G  IKKI  + +
Sbjct: 341 LFLGWGSFGIFSFYYFSFLLNLRHYSALWAGTTYFMFAIWGTVAAVIVGAFIKKISAAFI 400

Query: 407 FCCSMMGFLGGNIIFAATPVNQTFFRNMLGCMFLLPLGMDFSFPASSIILSDSLPMQYQG 466
              SM+ F  G I+ + TPV+QT+FR  LG M +L  GMD SFPA++IILSD L MQYQG
Sbjct: 401 LFMSMVAFNIGIIMLSVTPVDQTYFRMNLGTMIILSFGMDMSFPAAAIILSDGLTMQYQG 460

Query: 467 MAGSLVNTVINYSTSICLGMAGTVEMKHNSHGKDLLNGYRAAIYFAIGLAGLAVCVSGGY 526
           MAGSL NT++NYS S+CLGM  TVE + N  G DLL GYR A Y  IGLAGL + ++  Y
Sbjct: 461 MAGSLANTMVNYSMSLCLGMGTTVERQINKSGNDLLKGYRGAEYLGIGLAGLGIIITAIY 520

Query: 527 MIECLWKDRVLSLEENKQTDI 547
           + E LW  R   L  N   D+
Sbjct: 521 LGEILWGKRKQHLAANVVPDL 541

>TDEL0B00550 Chr2 (105483..107096) [1614 bp, 537 aa] {ON} Anc_8.843
           YMR279C
          Length = 537

 Score =  560 bits (1444), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 267/524 (50%), Positives = 373/524 (71%), Gaps = 6/524 (1%)

Query: 25  KNPEQQSLKNIDSRSSLNSSLTQVLSTDTADNDESSSYQNPDYFKNKYQEFGFIFSGMIG 84
           K+  +  ++   SR   +  LT          +  S +Q+P+YFK K+ E  F+ S M+G
Sbjct: 16  KSSHENEIERNLSRE--DKMLTTEKEAPVFVEEPESPWQDPNYFKGKWDEVLFVLSCMMG 73

Query: 85  QLLSQAGLTQTLSIMNVLAKELDSTSSRQAWLMSSFPLALGSFILVSGRLGDIYGLKKIL 144
           QLL+QAG T TLS M VL +ELDS+S++ +WLM+SFPL  GSFIL+SGRLGDIYGLKK+L
Sbjct: 74  QLLNQAGSTMTLSTMKVLERELDSSSAKSSWLMASFPLVSGSFILISGRLGDIYGLKKML 133

Query: 145 LGGYIITTVWSIICGLSSYAHNDAFFITARAFQGLGLAFALPNMIGLIGTIYRPGCFRKN 204
           L GYI  T+WS+ICGLSS++HND FFIT+RAFQGLG++F LPN++G++G IY+PG  RKN
Sbjct: 134 LLGYIWLTIWSLICGLSSFSHNDTFFITSRAFQGLGISFVLPNLLGIVGNIYKPGTRRKN 193

Query: 205 MIISIIGAMSPXXXXXXXXXXXXXVKYDKSNWPWSFYAFGLISFVNLIISWYCIPNSIPT 264
           ++IS+IG  +P             V    S+WPW+FYA+ + +F+  IIS++ IPNSIP 
Sbjct: 194 IVISLIGMCAPIGATFGGLFAGVVVIRKDSDWPWAFYAYTIAAFLTTIISYFVIPNSIPV 253

Query: 265 NIHGLKMDWLGSVLGVFGLIILNFVFNQAPIVGWQSAYIIVLLVLSFCALVIFVVYEVKY 324
           N++   MDW+GS LGV GL++ NFV+NQ+ +VGW + YII LL++S   + +F ++E+KY
Sbjct: 254 NVNKFAMDWIGSALGVSGLVLFNFVWNQSTVVGWATGYIIALLIVSIFLIALFFIFEIKY 313

Query: 325 AKTPLIPKAISSNRGMLMILFSLFCGWGSFGIWTFYYFSFELNLRHYSPLWAGSSYFIFV 384
           AK PL+PK ++ +R ++MIL SL  GWGSFGIW FYYF F L LR+YSP+WAG ++F+  
Sbjct: 314 AKVPLLPKEVTESRSIIMILASLMAGWGSFGIWIFYYFQFVLTLRNYSPVWAGGTFFMVS 373

Query: 385 ISGSTVAIVCGLTIKKIKPSVLFCCSMMGFLGGNIIFAATPVNQTFFRNMLGCMFLLPLG 444
           I G   A+  G +IK++ P+VL   SM+ F  G+II + TPV++T+FR+ LG M +L  G
Sbjct: 374 IVGCIAALTVGFSIKRVGPAVLLFFSMIAFTCGSIILSVTPVHETYFRSCLGAMVILSFG 433

Query: 445 MDFSFPASSIILSDSLPMQYQGMAGSLVNTVINYSTSICLGMAGTVEMKHNSHGKDLLNG 504
           MD SFPA+SIILSD L MQYQGMAGSLVNTV+NYS S+ LG+ GT+E + N  G  LL G
Sbjct: 434 MDLSFPAASIILSDELSMQYQGMAGSLVNTVVNYSMSLFLGIGGTIERQINKSGDRLLEG 493

Query: 505 YRAAIYFAIGLAGLAVCVSGGYMIECLWKDRVLSLEENKQTDIE 548
           +RAA+YFAIG+  L + +SG ++++      ++  +  K+ ++E
Sbjct: 494 FRAALYFAIGVGSLGILISGVFVLQ----KELMRSKSRKENELE 533

>NDAI0K00400 Chr11 (90040..91701) [1662 bp, 553 aa] {ON} 
          Length = 553

 Score =  556 bits (1433), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 264/480 (55%), Positives = 355/480 (73%)

Query: 56  NDESSSYQNPDYFKNKYQEFGFIFSGMIGQLLSQAGLTQTLSIMNVLAKELDSTSSRQAW 115
            + +SS+QNPDYF + ++E+ F+ + MI  LL+QAG +Q LS MNV++    S++  Q W
Sbjct: 57  QENNSSWQNPDYFSSSFKEYIFVATCMIANLLNQAGQSQVLSAMNVISDSFHSSTGGQTW 116

Query: 116 LMSSFPLALGSFILVSGRLGDIYGLKKILLGGYIITTVWSIICGLSSYAHNDAFFITARA 175
           LM+SFPL  GSFIL+SGRLGDIYGLK++++GG+I   +WS+ICG ++YAH+D FFI ARA
Sbjct: 117 LMASFPLVSGSFILISGRLGDIYGLKRMMIGGFIFMIIWSLICGFTNYAHSDTFFIVARA 176

Query: 176 FQGLGLAFALPNMIGLIGTIYRPGCFRKNMIISIIGAMSPXXXXXXXXXXXXXVKYDKSN 235
           FQGLG++F LPN++GL+G IY+ G  RKN++IS+IG M+P             V  +   
Sbjct: 177 FQGLGISFILPNVMGLVGNIYKVGTLRKNVVISLIGIMAPTGSCFGALWGGLIVTENPKQ 236

Query: 236 WPWSFYAFGLISFVNLIISWYCIPNSIPTNIHGLKMDWLGSVLGVFGLIILNFVFNQAPI 295
           WPW FYA+ + + V L++ +Y +P++IPTN++G  MDW+GSVLGV GLI+ NFV+NQ PI
Sbjct: 237 WPWIFYAYAVAAAVCLVMGYYTVPDNIPTNVNGFTMDWIGSVLGVIGLILFNFVWNQGPI 296

Query: 296 VGWQSAYIIVLLVLSFCALVIFVVYEVKYAKTPLIPKAISSNRGMLMILFSLFCGWGSFG 355
           VGW+ AYIIVLL++S   L+ F VYE+KYAK PL+PKA++ N  +L IL  LF GWGSFG
Sbjct: 297 VGWEKAYIIVLLIVSVIFLIAFFVYEIKYAKVPLLPKAVTQNGHILTILTVLFLGWGSFG 356

Query: 356 IWTFYYFSFELNLRHYSPLWAGSSYFIFVISGSTVAIVCGLTIKKIKPSVLFCCSMMGFL 415
           IWTFYYF+F+LNLR YSP+W+G ++F+F+I G+  A    LTIKK+ P++L   S +GF 
Sbjct: 357 IWTFYYFAFQLNLREYSPVWSGGTFFVFIIFGTVAATTVALTIKKVGPAILLFFSAIGFT 416

Query: 416 GGNIIFAATPVNQTFFRNMLGCMFLLPLGMDFSFPASSIILSDSLPMQYQGMAGSLVNTV 475
            G+II + TPV+QT++RN  G   +L  GMD  FPASSIILSD LPMQYQGMA SLVNT+
Sbjct: 417 CGSIIMSVTPVHQTYWRNTFGMQIILVFGMDLPFPASSIILSDYLPMQYQGMAVSLVNTI 476

Query: 476 INYSTSICLGMAGTVEMKHNSHGKDLLNGYRAAIYFAIGLAGLAVCVSGGYMIECLWKDR 535
           +NYSTS+CLGM  TVE + N  G DLL GYRAA+YF +G+AGL  C++   +   +W  R
Sbjct: 477 VNYSTSLCLGMGTTVERQINKSGDDLLKGYRAALYFGVGIAGLGACIAFLNVCHDIWSKR 536

>Kwal_27.10245 s27 (259090..260637) [1548 bp, 515 aa] {ON} YML116W
           (ATR1) - predicted protein is very hydrophobic, has many
           membrane-spanning regions, several potential
           glycosylation sites, potential ATP-binding site [contig
           38] FULL
          Length = 515

 Score =  555 bits (1429), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 269/511 (52%), Positives = 364/511 (71%), Gaps = 5/511 (0%)

Query: 25  KNPEQQSLKNIDSRSSLNSSLTQVLSTDTADNDESSSYQNPDYFKNKYQEFGFIFSGMIG 84
           +N ++++ + + S S+            T      S  QNPDYF   ++E+ F+ S M+ 
Sbjct: 5   ENDDEENWEKLQSSSAAGEER----DGQTEAIGPKSRLQNPDYFDKPWKEYIFVLSSMLS 60

Query: 85  QLLSQAGLTQTLSIMNVLAKELDSTSSRQAWLMSSFPLALGSFILVSGRLGDIYGLKKIL 144
           QLL+QA  TQT  + +VL+K+L++  S+Q WLM+SFPL  GSFILVSG++GDIYGLKK L
Sbjct: 61  QLLNQAATTQTNPLFDVLSKDLNAKVSQQPWLMASFPLVSGSFILVSGKVGDIYGLKKTL 120

Query: 145 LGGYIITTVWSIICGLSSYAHNDAFFITARAFQGLGLAFALPNMIGLIGTIYRPGCFRKN 204
           LGGY++  +WS+ICGLSSYAHN  FF+ AR+FQGLG+AF LPN++G++G IY+P    KN
Sbjct: 121 LGGYVVVVIWSLICGLSSYAHNVDFFVVARSFQGLGIAFVLPNVMGIVGNIYKPNTEAKN 180

Query: 205 MIISIIGAMSPXXXXXXXXXXXXXVKYDKSNWPWSFYAFGLISFVNLIISWYCIPNSIPT 264
           ++ S+IGA +P             +      W W+FYA+ + + +N +++ + IPN+IPT
Sbjct: 181 LVFSLIGACAPIGATLGCVFSGL-IGARTDLWGWTFYAYAITAALNGLVALWIIPNNIPT 239

Query: 265 NIHGLKMDWLGSVLGVFGLIILNFVFNQAPIVGWQSAYIIVLLVLSFCALVIFVVYEVKY 324
           N++  KMDW+GS +GVFGLI+ NFV+NQAPI GW SAYIIVLL+++  AL+ F+ YE+++
Sbjct: 240 NVNEYKMDWIGSAIGVFGLILFNFVWNQAPIAGWGSAYIIVLLIVAVVALIAFITYEIRF 299

Query: 325 AKTPLIPKAISSNRGMLMILFSLFCGWGSFGIWTFYYFSFELNLRHYSPLWAGSSYFIFV 384
           AK PL+P ++  NR ++MIL SLF GWGSFGIWTFYY SF LNLRHYSPLWAG +YF+F 
Sbjct: 300 AKQPLLPHSVLFNRKLMMILSSLFFGWGSFGIWTFYYMSFMLNLRHYSPLWAGGTYFMFA 359

Query: 385 ISGSTVAIVCGLTIKKIKPSVLFCCSMMGFLGGNIIFAATPVNQTFFRNMLGCMFLLPLG 444
           I G   +++ G TI K  P+V+   SM+ F  G I+ A TPV+QT+FR  LG M +L  G
Sbjct: 360 IWGIVASLLVGYTIHKTGPAVILFLSMVAFDCGCIMLAVTPVHQTYFRMTLGIMIILSFG 419

Query: 445 MDFSFPASSIILSDSLPMQYQGMAGSLVNTVINYSTSICLGMAGTVEMKHNSHGKDLLNG 504
           MD SFPA+SIILSD LP QYQGMAGSLV+T+I+YS S+CLG++GT E + N +G DLL G
Sbjct: 420 MDLSFPAASIILSDQLPSQYQGMAGSLVSTMISYSMSLCLGISGTAEHQVNKNGIDLLKG 479

Query: 505 YRAAIYFAIGLAGLAVCVSGGYMIECLWKDR 535
           Y+AA+Y  IGLA L V +SG +MIE  W  R
Sbjct: 480 YQAALYVGIGLASLGVVISGAFMIEDWWTSR 510

>KNAG0G03430 Chr7 complement(734828..736456) [1629 bp, 542 aa] {ON}
           Anc_8.843 YMR279C
          Length = 542

 Score =  555 bits (1429), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 273/518 (52%), Positives = 364/518 (70%), Gaps = 3/518 (0%)

Query: 31  SLKNIDSRSSLNSSLTQVLSTDTADNDESSSYQNPDYFKNKYQEFGFIFSGMIGQLLSQA 90
           +++N DS    + + T   ST  A  D +  +Q+  YF+N++QE+ F+ + M+ QLL+QA
Sbjct: 28  TVENTDSDKLGSGNET---STHVATTDPNCKWQDTTYFQNRWQEYIFVGTCMMSQLLNQA 84

Query: 91  GLTQTLSIMNVLAKELDSTSSRQAWLMSSFPLALGSFILVSGRLGDIYGLKKILLGGYII 150
            + QTLS+MN+L K   S +  Q WLM+SFPL  GSFIL+SGR+GDIYGLK  L+GG I 
Sbjct: 85  CIPQTLSLMNILTKSFHSNAKNQTWLMASFPLVSGSFILISGRVGDIYGLKWSLVGGNIF 144

Query: 151 TTVWSIICGLSSYAHNDAFFITARAFQGLGLAFALPNMIGLIGTIYRPGCFRKNMIISII 210
             +W++I G ++Y H+D FFI +R+FQGLG+AF LPN++G +G IY+P  FRKN++IS+I
Sbjct: 145 FIIWALISGFTNYTHSDTFFIVSRSFQGLGVAFILPNVMGCVGNIYKPNTFRKNIVISLI 204

Query: 211 GAMSPXXXXXXXXXXXXXVKYDKSNWPWSFYAFGLISFVNLIISWYCIPNSIPTNIHGLK 270
           GA +P                +  +WPWSFYA  + S + L+ + Y IPN IPTN+HG  
Sbjct: 205 GACAPVGAFMGAFFAGLIGTKNPDDWPWSFYAMAIASTLTLLGALYSIPNHIPTNVHGFS 264

Query: 271 MDWLGSVLGVFGLIILNFVFNQAPIVGWQSAYIIVLLVLSFCALVIFVVYEVKYAKTPLI 330
           MDW+GS L V GLI+LNFV+NQ PI GW  AYIIVLL++S   L +F +YEV YA +PL+
Sbjct: 265 MDWIGSGLAVVGLILLNFVWNQGPIDGWGKAYIIVLLIVSVFVLTLFFIYEVHYAASPLL 324

Query: 331 PKAISSNRGMLMILFSLFCGWGSFGIWTFYYFSFELNLRHYSPLWAGSSYFIFVISGSTV 390
           P+ I+ NR M+MIL +LF GWGSFGI++FYYF+F LNLRHYS +WAG +YF+F I G   
Sbjct: 325 PRVITQNRHMVMILMALFLGWGSFGIFSFYYFAFLLNLRHYSTVWAGGTYFMFAIWGVVA 384

Query: 391 AIVCGLTIKKIKPSVLFCCSMMGFLGGNIIFAATPVNQTFFRNMLGCMFLLPLGMDFSFP 450
           ++V GL+I+KI  S++   SM+ F  G I+ + TPV QT+FR  LG M +L  GMD SFP
Sbjct: 385 SVVVGLSIRKISASIILFFSMIAFDVGIIMLSVTPVKQTYFRMNLGTMIILSFGMDMSFP 444

Query: 451 ASSIILSDSLPMQYQGMAGSLVNTVINYSTSICLGMAGTVEMKHNSHGKDLLNGYRAAIY 510
           A++IILSDSLP QYQGMAGSL NT++NYS S+CLGM  TVE + N +GKDLL GYRAA Y
Sbjct: 445 AAAIILSDSLPNQYQGMAGSLANTMVNYSMSLCLGMGSTVESQINQNGKDLLKGYRAAEY 504

Query: 511 FAIGLAGLAVCVSGGYMIECLWKDRVLSLEENKQTDIE 548
             IG+A LAV +S  YM E LW DR   +E   +T++ 
Sbjct: 505 LGIGIASLAVILSLIYMCERLWIDRKERMESTSETNLS 542

>Smik_13.18 Chr13 (34422..36059) [1638 bp, 545 aa] {ON} YML116W
           (REAL)
          Length = 545

 Score =  552 bits (1423), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 274/509 (53%), Positives = 365/509 (71%), Gaps = 2/509 (0%)

Query: 27  PEQQSLKNIDSRSSLNSSLTQVLSTDTADNDESSSYQNPDYFKNKYQEFGFIFSGMIGQL 86
           P ++S ++  S  +L  +    L  +  + ++   +QNP YFK  +QE+ FIF+ MI QL
Sbjct: 26  PPKKSSRDNGSEETLRGTAFTNLEDEMVECNQK--WQNPKYFKYAWQEYLFIFTCMISQL 83

Query: 87  LSQAGLTQTLSIMNVLAKELDSTSSRQAWLMSSFPLALGSFILVSGRLGDIYGLKKILLG 146
           L+QAG TQTLSIMN+L+    S  + ++WLM+SFPL  GSFIL+SGRLGDIYGLKK+LL 
Sbjct: 84  LNQAGTTQTLSIMNILSDSFGSEGNSKSWLMASFPLVSGSFILISGRLGDIYGLKKMLLV 143

Query: 147 GYIITTVWSIICGLSSYAHNDAFFITARAFQGLGLAFALPNMIGLIGTIYRPGCFRKNMI 206
           GY++  +WS+ICG+++Y+ +D FFI  RAFQGLG+AF LPN++G+IG IY  G FRKN++
Sbjct: 144 GYVLVIIWSLICGITNYSGSDTFFIICRAFQGLGIAFVLPNVLGIIGNIYVGGTFRKNIV 203

Query: 207 ISIIGAMSPXXXXXXXXXXXXXVKYDKSNWPWSFYAFGLISFVNLIISWYCIPNSIPTNI 266
           IS +GAM+P                + + WPW+FYAF + S +N  +S Y IPN+IPTNI
Sbjct: 204 ISFVGAMAPIGATLGCLFAGLIGTENPNQWPWAFYAFSIASLINFGLSIYAIPNNIPTNI 263

Query: 267 HGLKMDWLGSVLGVFGLIILNFVFNQAPIVGWQSAYIIVLLVLSFCALVIFVVYEVKYAK 326
           H   MDW+GSVLGV GLI+LNFV+NQAPI GW  AYIIV+L++S   L +F++YE+ +AK
Sbjct: 264 HHFSMDWIGSVLGVIGLILLNFVWNQAPISGWSQAYIIVILIISVIFLAVFIIYEMWFAK 323

Query: 327 TPLIPKAISSNRGMLMILFSLFCGWGSFGIWTFYYFSFELNLRHYSPLWAGSSYFIFVIS 386
           +PL+P A+  +  M+ I+ +LF GWGSFGI+TFYYF F+LN+RHY+ LWAG +YF+F+I 
Sbjct: 324 SPLLPHAVIKDYHMIQIMLALFFGWGSFGIFTFYYFQFQLNIRHYTALWAGGTYFMFLIW 383

Query: 387 GSTVAIVCGLTIKKIKPSVLFCCSMMGFLGGNIIFAATPVNQTFFRNMLGCMFLLPLGMD 446
           G   A++ G TIK + PSV    SM+ F  G+I+ + TPV++T+FR  LG M +L  GMD
Sbjct: 384 GIIAALLVGFTIKNVSPSVYLFFSMVAFNVGSIMASVTPVHETYFRTQLGTMIILSFGMD 443

Query: 447 FSFPASSIILSDSLPMQYQGMAGSLVNTVINYSTSICLGMAGTVEMKHNSHGKDLLNGYR 506
            SFPASSII SD+LPM+YQGMAGSLVNTV+NYS S+CLGM  TVE + +  GK LL GYR
Sbjct: 444 LSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVETQLDPDGKHLLKGYR 503

Query: 507 AAIYFAIGLAGLAVCVSGGYMIECLWKDR 535
            A Y  IGLA LA  +SG YM+E    D 
Sbjct: 504 GAQYLGIGLASLACMISGLYMVESFINDH 532

>SAKL0D01386g Chr4 (109619..111184) [1566 bp, 521 aa] {ON}
           uniprot|Q875S7 Saccharomyces kluyveri ATR1
          Length = 521

 Score =  551 bits (1419), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 269/488 (55%), Positives = 357/488 (73%), Gaps = 1/488 (0%)

Query: 55  DNDESSSYQNPDYFKNKYQEFGFIFSGMIGQLLSQAGLTQTLSIMNVLAKELDSTSSRQA 114
           D+ +  S Q+P YF   ++E+ FIF+ M+ QLL+QAG TQTLS++N+L+K  DS++S+Q 
Sbjct: 34  DDKKWPSIQDPTYFSAPWKEYLFIFASMMSQLLNQAGTTQTLSLINILSKNFDSSTSQQT 93

Query: 115 WLMSSFPLALGSFILVSGRLGDIYGLKKILLGGYIITTVWSIICGLSSYAHNDAFFITAR 174
           WLM+SFPL  GSFILVSG++GDIYGLKK LL GY++T +WS+ICGL+SY  +  FFI +R
Sbjct: 94  WLMASFPLVSGSFILVSGKIGDIYGLKKTLLVGYVVTIIWSLICGLTSYTSSVEFFIISR 153

Query: 175 AFQGLGLAFALPNMIGLIGTIYRPGCFRKNMIISIIGAMSPXXXXXXXXXXXXXVKYDKS 234
           AFQGLG+AF LPN++G++G IY  G  RKNM+IS+IGA +P             +     
Sbjct: 154 AFQGLGIAFILPNIMGIVGNIYVAGTTRKNMVISLIGACAPIGATMGVLFSGL-IGTLSE 212

Query: 235 NWPWSFYAFGLISFVNLIISWYCIPNSIPTNIHGLKMDWLGSVLGVFGLIILNFVFNQAP 294
            W W+FYA+ + + +N+ +S + IPN+IPTN+ G  MDW+GS +G+ G+I+ NFV+NQ P
Sbjct: 213 RWAWTFYAYTITAAINMGLSIWVIPNTIPTNVRGSSMDWIGSGIGLLGMILFNFVWNQGP 272

Query: 295 IVGWQSAYIIVLLVLSFCALVIFVVYEVKYAKTPLIPKAISSNRGMLMILFSLFCGWGSF 354
           IVGW +AYIIVLL++S  A+V F +YE KYA  PLIP+    N  +LM L ++F GWGSF
Sbjct: 273 IVGWDTAYIIVLLIVSVAAIVAFFLYETKYANDPLIPRPAMHNHRLLMTLLAVFFGWGSF 332

Query: 355 GIWTFYYFSFELNLRHYSPLWAGSSYFIFVISGSTVAIVCGLTIKKIKPSVLFCCSMMGF 414
           GIWTFYYF F LNLR Y+PLWAG SYF+F+I G   AI  G TIK+I PS++   SM+ F
Sbjct: 333 GIWTFYYFCFVLNLREYTPLWAGGSYFMFLIWGIIAAISVGYTIKRIPPSLILFLSMLAF 392

Query: 415 LGGNIIFAATPVNQTFFRNMLGCMFLLPLGMDFSFPASSIILSDSLPMQYQGMAGSLVNT 474
             G I+ + TPV+QT+FR +LG M +L  GMD SFPASSIILSD LPM+ QGMAGSLV+T
Sbjct: 393 DCGCIMLSVTPVDQTYFRMILGMMIILSFGMDLSFPASSIILSDELPMENQGMAGSLVST 452

Query: 475 VINYSTSICLGMAGTVEMKHNSHGKDLLNGYRAAIYFAIGLAGLAVCVSGGYMIECLWKD 534
           +INYS S+CLG+AGTVE + N +G DLL GYRAA+Y  IGLA L V +S  +M+E   + 
Sbjct: 453 MINYSMSMCLGIAGTVEHQINKNGDDLLKGYRAALYLGIGLASLGVFISALFMLENYLRM 512

Query: 535 RVLSLEEN 542
           R  +++E 
Sbjct: 513 RRRNVKEE 520

>KNAG0J00260 Chr10 (37950..39602) [1653 bp, 550 aa] {ON} Anc_8.843
           YMR279C
          Length = 550

 Score =  551 bits (1421), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 258/511 (50%), Positives = 355/511 (69%), Gaps = 4/511 (0%)

Query: 26  NPEQQSLKN----IDSRSSLNSSLTQVLSTDTADNDESSSYQNPDYFKNKYQEFGFIFSG 81
           N E +  KN    ++ + + ++       +++   D  + +QNP YF N++QE+ FI + 
Sbjct: 22  NQEAEYTKNDQTNVEEKKNCSTESEAEWCSESEFTDNDTPWQNPTYFANRWQEYAFISTC 81

Query: 82  MIGQLLSQAGLTQTLSIMNVLAKELDSTSSRQAWLMSSFPLALGSFILVSGRLGDIYGLK 141
           M+ QLL+QAG  Q  + MN+LA   +S++ +Q WLM+SFPL  GSFILVSGR+GDIYGLK
Sbjct: 82  MLAQLLNQAGQAQATAPMNILADAFNSSAKKQTWLMASFPLVSGSFILVSGRIGDIYGLK 141

Query: 142 KILLGGYIITTVWSIICGLSSYAHNDAFFITARAFQGLGLAFALPNMIGLIGTIYRPGCF 201
           K L+GGY++  +WS+ICG ++Y HNDAFFI  RAFQGLG+AF LPN++GLIG IY+    
Sbjct: 142 KTLIGGYLVVLIWSLICGFANYTHNDAFFILCRAFQGLGIAFILPNVMGLIGNIYKANTL 201

Query: 202 RKNMIISIIGAMSPXXXXXXXXXXXXXVKYDKSNWPWSFYAFGLISFVNLIISWYCIPNS 261
           RKN +IS +G  +P                +   WPW FYA+ ++  +N++++ Y IP++
Sbjct: 202 RKNFVISFVGMCAPIGAALGGVWSGLIAHENPKQWPWIFYAYAIVVAINMVMAIYSIPST 261

Query: 262 IPTNIHGLKMDWLGSVLGVFGLIILNFVFNQAPIVGWQSAYIIVLLVLSFCALVIFVVYE 321
           +PTNIHG  MDW GS +GV G+I+ NFV+NQ PI GW   YII LL++S   L+ F +YE
Sbjct: 262 VPTNIHGFGMDWTGSAIGVVGMILFNFVWNQGPIDGWNKGYIIALLIVSVFLLIAFFIYE 321

Query: 322 VKYAKTPLIPKAISSNRGMLMILFSLFCGWGSFGIWTFYYFSFELNLRHYSPLWAGSSYF 381
           +K+AK+PL+P  +  NR + MIL ++F GWGSFGIWTFYY++F+LNLRHYS +WAG ++F
Sbjct: 322 IKFAKSPLLPPEVIKNRHIGMILLAVFMGWGSFGIWTFYYYAFQLNLRHYSAVWAGGTFF 381

Query: 382 IFVISGSTVAIVCGLTIKKIKPSVLFCCSMMGFLGGNIIFAATPVNQTFFRNMLGCMFLL 441
           +FVI G+  A +  LTIK++ PSVL C SM GF  G I+ + TPV+Q++++  LG   +L
Sbjct: 382 MFVIWGTIAAFLVALTIKRVGPSVLLCFSMTGFTVGCIMLSVTPVHQSYWKMNLGMQIIL 441

Query: 442 PLGMDFSFPASSIILSDSLPMQYQGMAGSLVNTVINYSTSICLGMAGTVEMKHNSHGKDL 501
             GMD SFPASSIILSD LP QYQGMAGSLVNT++NYSTS+CLG+  T E + N +G D 
Sbjct: 442 SFGMDLSFPASSIILSDFLPSQYQGMAGSLVNTMVNYSTSLCLGVGSTAEAQVNKNGTDK 501

Query: 502 LNGYRAAIYFAIGLAGLAVCVSGGYMIECLW 532
           L GYRAA+Y  IGL    + V+  Y+ E LW
Sbjct: 502 LKGYRAALYVGIGLGACGMLVAFCYLFEVLW 532

>CAGL0M03003g Chr13 complement(337942..339618) [1677 bp, 558 aa]
           {ON} similar to uniprot|Q03263 Saccharomyces cerevisiae
           YMR279c or uniprot|P13090 Saccharomyces cerevisiae
           YML116w ATR1
          Length = 558

 Score =  551 bits (1421), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/484 (59%), Positives = 368/484 (76%), Gaps = 2/484 (0%)

Query: 52  DTADNDESSSYQNPDYFKNKYQEFGFIFSGMIGQLLSQAGLTQTLSIMNVLAKELDSTSS 111
           D  +ND  S +QNP+YF+  ++E  FI S M+ QLL+QAG TQ+LS MNVLA    S SS
Sbjct: 65  DCHEND--SPFQNPEYFETGFKEVMFIISCMVAQLLNQAGQTQSLSTMNVLADYFKSNSS 122

Query: 112 RQAWLMSSFPLALGSFILVSGRLGDIYGLKKILLGGYIITTVWSIICGLSSYAHNDAFFI 171
           +Q WLM+SFPL  GSFIL+SGRLGDIYGLKK L  GYII T+WSIICGL+ Y ++DAFFI
Sbjct: 123 KQPWLMASFPLVSGSFILISGRLGDIYGLKKALSVGYIIMTLWSIICGLAKYTNSDAFFI 182

Query: 172 TARAFQGLGLAFALPNMIGLIGTIYRPGCFRKNMIISIIGAMSPXXXXXXXXXXXXXVKY 231
             R+FQGLG+AF LPN++GL+G IY+ G  RKN++IS IG M+P             V  
Sbjct: 183 VCRSFQGLGIAFILPNIMGLVGNIYKVGTLRKNIVISCIGCMAPAGAALGALFGGLIVTE 242

Query: 232 DKSNWPWSFYAFGLISFVNLIISWYCIPNSIPTNIHGLKMDWLGSVLGVFGLIILNFVFN 291
           D   WPW FYAFG+ SFVN++++ Y IPN++PTN++ L MDW+GS+LGV GL++LN V+N
Sbjct: 243 DAEQWPWVFYAFGIASFVNMLLALYSIPNNVPTNLNNLNMDWIGSLLGVSGLLLLNIVWN 302

Query: 292 QAPIVGWQSAYIIVLLVLSFCALVIFVVYEVKYAKTPLIPKAISSNRGMLMILFSLFCGW 351
           QAPIVGW  AYIIVLL++S   L+IFVVYE+KYA +PL+P ++  N+ +LMIL +LF GW
Sbjct: 303 QAPIVGWGEAYIIVLLIISIILLLIFVVYEIKYATSPLLPPSVLENKKILMILAALFFGW 362

Query: 352 GSFGIWTFYYFSFELNLRHYSPLWAGSSYFIFVISGSTVAIVCGLTIKKIKPSVLFCCSM 411
           GSFGIWT+YY++F+LNLR Y+PLWAG ++F+FVI G+  A V  LTIKK+ P+VL C SM
Sbjct: 363 GSFGIWTYYYYAFQLNLRKYTPLWAGGTHFMFVIWGTVAAFVVALTIKKVGPAVLLCFSM 422

Query: 412 MGFLGGNIIFAATPVNQTFFRNMLGCMFLLPLGMDFSFPASSIILSDSLPMQYQGMAGSL 471
           + F  G+I+ + TPV+QT++R  +G   +L  GMD SFPASSIILSD LPMQYQGMAGSL
Sbjct: 423 VAFDCGSIMLSVTPVHQTYWRMNVGMQIILSFGMDLSFPASSIILSDFLPMQYQGMAGSL 482

Query: 472 VNTVINYSTSICLGMAGTVEMKHNSHGKDLLNGYRAAIYFAIGLAGLAVCVSGGYMIECL 531
           VNTV+NYSTS+CLGM  TVE ++N+HG DLL GYR+A+Y AIGLA   VCVS  +++  +
Sbjct: 483 VNTVVNYSTSLCLGMGNTVEQQYNAHGADLLKGYRSALYLAIGLASAGVCVSLVFLVTDI 542

Query: 532 WKDR 535
              R
Sbjct: 543 IAKR 546

>KLTH0C03806g Chr3 (332195..333772) [1578 bp, 525 aa] {ON} similar
           to uniprot|P13090 Saccharomyces cerevisiae YML116W ATR1
           Multidrug efflux pump of the major facilitator
           superfamily required for resistance to aminotriazole and
           4-nitroquinoline-N-oxide
          Length = 525

 Score =  549 bits (1415), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 275/517 (53%), Positives = 366/517 (70%), Gaps = 10/517 (1%)

Query: 37  SRSSLNSSLTQVLSTDTADND----ESSSYQNPDYFKNKYQEFGFIFSGMIGQLLSQAGL 92
           S+    S +++ +  +  D+D      S  QNPDYF  +++E+ F+ S M+ QLL+QA  
Sbjct: 9   SKQRTGSDISRKVVDNHEDSDMLLASRSRLQNPDYFDKQWKEYLFVISSMLSQLLNQAAA 68

Query: 93  TQTLSIMNVLAKELDSTSSRQAWLMSSFPLALGSFILVSGRLGDIYGLKKILLGGYIITT 152
            Q   + ++L+++L + +S+QAWLM+SFPL  GSFILVSG++GDIYGLKK LLGGY +  
Sbjct: 69  LQANPLFDLLSEDLKAKASQQAWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYAVVV 128

Query: 153 VWSIICGLSSYAHNDAFFITARAFQGLGLAFALPNMIGLIGTIYRPGCFRKNMIISIIGA 212
           +WS+ICGLSSYAHN  FFI AR+FQGLG+AF LPN+ G++G IY+P    KNM+ S+IGA
Sbjct: 129 IWSLICGLSSYAHNVDFFIVARSFQGLGIAFVLPNVTGIVGNIYKPNTKAKNMVFSMIGA 188

Query: 213 MSPXXXXXXXXXXXXXVKYDKSNWPWSFYAFGLISFVNLIISWYCIPNSIPTNIHGLKMD 272
            +P             +  +   W W+FYA+ +++ +N +I+WY IP++IPTN+H  KMD
Sbjct: 189 CAPIGATLGCLFSGL-IGTESEAWAWTFYAYTIVAALNGLIAWYVIPDNIPTNVHKFKMD 247

Query: 273 WLGSVLGVFGLIILNFVFNQAPIVGWQSAYIIVLLVLSFCALVIFVVYEVKYAKTPLIPK 332
           WLGS LGV GLI+ NFV+NQAP  GW SAYIIVLLV+S   L+IF+++E ++AK PL+P+
Sbjct: 248 WLGSFLGVCGLIMFNFVWNQAPTDGWDSAYIIVLLVISVILLLIFIIFEARFAKEPLLPR 307

Query: 333 AISSNRGMLMILFSLFCGWGSFGIWTFYYFSFELNLRHYSPLWAGSSYFIFVISGSTVAI 392
           A+  NR ++MIL SLF GWGSFGIWT+YY +F LNLRHY+PLWAG SYF+F I G+  A 
Sbjct: 308 AVLFNRKLMMILASLFLGWGSFGIWTYYYMAFVLNLRHYTPLWAGGSYFMFAIFGTIAAF 367

Query: 393 VCGLTIKKIKPSVLFCCSMMGFLGGNIIFAATPVNQTFFRNMLGCMFLLPLGMDFSFPAS 452
           + G TI K  P+++   S++ F  G I+ + TPV+QT+FR  LG M +L  GMD SFPAS
Sbjct: 368 LVGHTIHKTGPAIILLASVIAFDVGCIMLSVTPVDQTYFRMSLGTMVILSFGMDLSFPAS 427

Query: 453 SIILSDSLPMQYQGMAGSLVNTVINYSTSICLGMAGTVEMKHNSHGKDLLNGYRAAIYFA 512
           SIILSD LP QYQGMAGSLVNT+INYS S+CLG++GT E + N  G DLL GYRAA+Y  
Sbjct: 428 SIILSDQLPSQYQGMAGSLVNTMINYSMSLCLGVSGTAERQVNKDGTDLLKGYRAALYVG 487

Query: 513 IGLAGLAVCVSGGYMIECLWKDR-----VLSLEENKQ 544
           IGLA + + VSG Y IE  W  R      + L+E  Q
Sbjct: 488 IGLASVGIFVSGAYAIEDWWTRRRERSVRIKLDEKHQ 524

>CAGL0B02343g Chr2 complement(222130..223743) [1614 bp, 537 aa] {ON}
           similar to uniprot|P13090 Saccharomyces cerevisiae
           YML116w ATR1 Aminotriazole resistance protein or
           uniprot|Q03263 Saccharomyces cerevisiae YMR279c
          Length = 537

 Score =  545 bits (1405), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 266/495 (53%), Positives = 361/495 (72%), Gaps = 1/495 (0%)

Query: 42  NSSLTQVLSTDTADNDESSSYQNPDYFKNKYQEFGFIFSGMIGQLLSQAGLTQTLSIMNV 101
           N+ +      DT   D +  +QNP+YF +  +E+ F+ S  + QLL+QAG  QT  IMN+
Sbjct: 30  NNDIVDEKQCDTQAIDGNQKWQNPEYFDSTLKEYLFLCSCFVSQLLNQAGAIQTQPIMNI 89

Query: 102 LAKELDSTSSRQAWLMSSFPLALGSFILVSGRLGDIYGLKKILLGGYIITTVWSIICGLS 161
           +A  LDS + +QAWLM++FPL  GSFIL+SGR+GDIYGLKK LL GY+   VWS+ICGL+
Sbjct: 90  VADSLDSQNGKQAWLMAAFPLISGSFILISGRIGDIYGLKKTLLVGYLFLIVWSLICGLT 149

Query: 162 SYAHNDAFFITARAFQGLGLAFALPNMIGLIGTIYRPGCFRKNMIISIIGAMSPXXXXXX 221
            YAH+D+FFI +RAFQGLG++  LPN++G++G+IY  G  RKNM+IS+IG M+P      
Sbjct: 150 KYAHSDSFFIVSRAFQGLGISLILPNILGIVGSIYIAGSKRKNMVISLIGCMAPIGATLG 209

Query: 222 XXXXXXXVKYDKSNWPWSFYAFGLISFVNLIISWYCIPNSIPTNIHGLKMDWLGSVLGVF 281
                     D + WPW+FY++ + + +N ++S + IPN+IPTN+HG KMDW+GS LGV 
Sbjct: 210 AVFSGLIGTEDANQWPWAFYSYAITAAINFVLSIWLIPNTIPTNVHGHKMDWIGSGLGVV 269

Query: 282 GLIILNFVFNQAPIVGWQSAYIIVLLVLSFCALVIFVVYEVKYAK-TPLIPKAISSNRGM 340
           GLI+LNFV+NQAPI GW SAY+IVLL++S   L+ F +YE+ +    PL+PK +  +   
Sbjct: 270 GLIMLNFVWNQAPIDGWDSAYLIVLLIISVLLLIAFFIYELHFVNGNPLLPKEVLKSPKT 329

Query: 341 LMILFSLFCGWGSFGIWTFYYFSFELNLRHYSPLWAGSSYFIFVISGSTVAIVCGLTIKK 400
           +++LF+LF GWGSFGI++FYYF+F+LNLRHY+PLWAG +YF+F+I G   A+V G TIKK
Sbjct: 330 IIVLFALFFGWGSFGIFSFYYFTFQLNLRHYTPLWAGGTYFMFLIWGIVAALVVGFTIKK 389

Query: 401 IKPSVLFCCSMMGFLGGNIIFAATPVNQTFFRNMLGCMFLLPLGMDFSFPASSIILSDSL 460
           + PS++   SM+ F  G+II + TP++QT+FRN LG M +L  GMD SFPASSI+LSD L
Sbjct: 390 VYPSIILFLSMVAFNCGSIIMSVTPIHQTYFRNHLGMMIILSFGMDLSFPASSILLSDKL 449

Query: 461 PMQYQGMAGSLVNTVINYSTSICLGMAGTVEMKHNSHGKDLLNGYRAAIYFAIGLAGLAV 520
           P+QYQGMAGSLVNT++NYS S CLG+AG VE   N+HGKD+L GYR A Y  IGLA +A 
Sbjct: 450 PLQYQGMAGSLVNTMVNYSMSFCLGVAGVVEQHVNNHGKDVLKGYRGAFYLGIGLASMAC 509

Query: 521 CVSGGYMIECLWKDR 535
            +SG  M+  + + R
Sbjct: 510 IISGALMLSEIIQGR 524

>NCAS0C00400 Chr3 (61257..62810) [1554 bp, 517 aa] {ON} Anc_8.843
          Length = 517

 Score =  530 bits (1364), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 257/510 (50%), Positives = 360/510 (70%), Gaps = 1/510 (0%)

Query: 41  LNSSLTQVLSTDTADNDESSSYQNPDYFKNKYQEFGFIFSGMIGQLLSQAGLTQTLSIMN 100
           ++SS  + LS D+   + S+ +QN  YF++  +E+ FIF+ M   LL+QAG TQ LS MN
Sbjct: 8   VSSSQKKTLSCDSLL-ENSTPWQNEQYFQSHLKEYFFIFTCMFANLLNQAGQTQVLSTMN 66

Query: 101 VLAKELDSTSSRQAWLMSSFPLALGSFILVSGRLGDIYGLKKILLGGYIITTVWSIICGL 160
           V+++   S    Q WLM+SFPL  GSFIL+SGR+GDIYGLKK ++GGYI   +W+++CG 
Sbjct: 67  VISESFHSDVGTQTWLMASFPLVSGSFILISGRIGDIYGLKKTMIGGYIFMIIWTLLCGF 126

Query: 161 SSYAHNDAFFITARAFQGLGLAFALPNMIGLIGTIYRPGCFRKNMIISIIGAMSPXXXXX 220
           + Y H+D FFI  RAFQGLG++F LPN++GL+G IY+ G  RKN++IS+IG  +P     
Sbjct: 127 ADYTHSDTFFIVCRAFQGLGISFILPNIMGLVGNIYKVGTLRKNIVISLIGITAPTGACM 186

Query: 221 XXXXXXXXVKYDKSNWPWSFYAFGLISFVNLIISWYCIPNSIPTNIHGLKMDWLGSVLGV 280
                          WPW FYA+ L +FVNLI++ Y +P ++PTN+H   MDW+G+++GV
Sbjct: 187 GALWGGLIATESSRQWPWIFYAYALAAFVNLIMAIYSVPENVPTNVHNFAMDWMGAIIGV 246

Query: 281 FGLIILNFVFNQAPIVGWQSAYIIVLLVLSFCALVIFVVYEVKYAKTPLIPKAISSNRGM 340
            GLI+ NFV+NQ P+ GW   YIIVLL++S   LV F++YE+K+  +PL+P+ ++ N  +
Sbjct: 247 VGLILFNFVWNQGPVNGWAKPYIIVLLIISIIFLVAFIIYELKFPISPLLPREVTKNGQI 306

Query: 341 LMILFSLFCGWGSFGIWTFYYFSFELNLRHYSPLWAGSSYFIFVISGSTVAIVCGLTIKK 400
           L IL  LF GWGSFGIWTFYY++F+LNLR+YSPLWAG+++F+F+I GS  A + G TI +
Sbjct: 307 LTILGILFLGWGSFGIWTFYYYAFQLNLRNYSPLWAGATHFMFIIWGSIAAFIVGFTINR 366

Query: 401 IKPSVLFCCSMMGFLGGNIIFAATPVNQTFFRNMLGCMFLLPLGMDFSFPASSIILSDSL 460
           + P+VL   S +GF  G+++ + TP++QT++R  +G   +L  GMD SFPASSIILSD L
Sbjct: 367 VGPAVLLFFSALGFTMGSLMLSVTPIHQTYWRMNVGMQIILSFGMDLSFPASSIILSDHL 426

Query: 461 PMQYQGMAGSLVNTVINYSTSICLGMAGTVEMKHNSHGKDLLNGYRAAIYFAIGLAGLAV 520
           PMQYQGMAGSLVNT+INYSTS+CLGM  TVE + N  G++LL GYR+A+Y A+GL GL  
Sbjct: 427 PMQYQGMAGSLVNTIINYSTSLCLGMGTTVERQINKTGEELLRGYRSALYLAVGLGGLGA 486

Query: 521 CVSGGYMIECLWKDRVLSLEENKQTDIESS 550
           CV+   +   LW+ R   L++ +  +   S
Sbjct: 487 CVAFLNLCYDLWRKRKSRLDDIRSLNTNDS 516

>KAFR0B03930 Chr2 complement(816351..818018) [1668 bp, 555 aa] {ON} 
          Length = 555

 Score =  531 bits (1367), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 255/521 (48%), Positives = 364/521 (69%), Gaps = 6/521 (1%)

Query: 34  NIDSRSSLN--SSLTQVLSTDTAD----NDESSSYQNPDYFKNKYQEFGFIFSGMIGQLL 87
           N DS +S++  +S   V    + D    +D ++ +QNP YF ++++E+ FI + M+  LL
Sbjct: 35  NYDSSTSVSEKTSAISVFEGTSPDAEKFSDNNTPWQNPSYFSSRWKEYLFILTCMLSNLL 94

Query: 88  SQAGLTQTLSIMNVLAKELDSTSSRQAWLMSSFPLALGSFILVSGRLGDIYGLKKILLGG 147
           +QAG TQ  S MNV+    ++ SS + WLM+SFPL  GSFILVSGR+GDIYGLK+ ++GG
Sbjct: 95  NQAGQTQATSTMNVIGSAFNADSSSKTWLMASFPLVSGSFILVSGRIGDIYGLKRTMIGG 154

Query: 148 YIITTVWSIICGLSSYAHNDAFFITARAFQGLGLAFALPNMIGLIGTIYRPGCFRKNMII 207
            I+  +WS+ICG ++Y+ +  FFI  RAFQGLG+AF LPN++GL+G IY+ G  RKN++I
Sbjct: 155 LIVMIIWSLICGFANYSSSVTFFIICRAFQGLGIAFVLPNVMGLVGNIYKVGSLRKNIVI 214

Query: 208 SIIGAMSPXXXXXXXXXXXXXVKYDKSNWPWSFYAFGLISFVNLIISWYCIPNSIPTNIH 267
           S IG  +P                 +  WPW FYA+     +NL+++ Y IP+++P N+H
Sbjct: 215 SCIGMCAPTGAAFGAFWAGLIATKAEKQWPWIFYAYAFAGILNLVLAIYSIPDTVPVNVH 274

Query: 268 GLKMDWLGSVLGVFGLIILNFVFNQAPIVGWQSAYIIVLLVLSFCALVIFVVYEVKYAKT 327
           G  MDW GSV+GV GLI+ NFV+N+APIVGW+ AYIIVLL+ S   +V+F +YE+K+AK+
Sbjct: 275 GFSMDWTGSVVGVIGLILFNFVWNEAPIVGWEKAYIIVLLIFSLLIIVVFFIYEIKFAKS 334

Query: 328 PLIPKAISSNRGMLMILFSLFCGWGSFGIWTFYYFSFELNLRHYSPLWAGSSYFIFVISG 387
           PL+P+A++ N  ++MIL ++F GWGSFGIWTFYY++F LNLR Y+PL AG+S+ +F++ G
Sbjct: 335 PLLPQAVTHNHNIIMILSAMFMGWGSFGIWTFYYYAFLLNLRGYTPLEAGASHCMFILWG 394

Query: 388 STVAIVCGLTIKKIKPSVLFCCSMMGFLGGNIIFAATPVNQTFFRNMLGCMFLLPLGMDF 447
           +  A     TIK++ PSVL  CSM+ F  G+I+ + TPV+QT+++   G   +L  GMD 
Sbjct: 395 TIAAFTVAFTIKRVGPSVLLFCSMVAFTVGSIMLSITPVHQTYWKMTFGMQIILAFGMDL 454

Query: 448 SFPASSIILSDSLPMQYQGMAGSLVNTVINYSTSICLGMAGTVEMKHNSHGKDLLNGYRA 507
           SFPASSIILSD+LPM+YQGMAGSLVNT++NYSTS+CLGM  T E++ N +G DLL GYRA
Sbjct: 455 SFPASSIILSDALPMEYQGMAGSLVNTIVNYSTSLCLGMGTTAEIQVNKNGTDLLKGYRA 514

Query: 508 AIYFAIGLAGLAVCVSGGYMIECLWKDRVLSLEENKQTDIE 548
           A+Y  IGL  + V ++  ++ E L + R  +     + D+ 
Sbjct: 515 ALYVGIGLGVVGVIIAALFLFESLRQKRGRTAALTAKKDMS 555

>KAFR0A02840 Chr1 complement(588197..589759) [1563 bp, 520 aa] {ON}
           Anc_8.843 YMR279C
          Length = 520

 Score =  502 bits (1293), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 255/483 (52%), Positives = 337/483 (69%), Gaps = 8/483 (1%)

Query: 36  DSR-SSLNSSLTQVLSTDTADND-------ESSSYQNPDYFKNKYQEFGFIFSGMIGQLL 87
           +SR SS+   +   +S D + N+       E S +Q+P YFKN +QE+ F+ S M  QLL
Sbjct: 3   ESRTSSIKEHIQSDISIDKSSNEKCEVIVREKSKWQDPGYFKNSFQEYLFVGSCMTTQLL 62

Query: 88  SQAGLTQTLSIMNVLAKELDSTSSRQAWLMSSFPLALGSFILVSGRLGDIYGLKKILLGG 147
           +QA   QTLSIMNVL+   +S+ S Q WL++SFPL  GSFIL+SGR+GDIYGLKK L+GG
Sbjct: 63  NQATTPQTLSIMNVLSDSFNSSRSNQTWLVASFPLVAGSFILISGRIGDIYGLKKTLIGG 122

Query: 148 YIITTVWSIICGLSSYAHNDAFFITARAFQGLGLAFALPNMIGLIGTIYRPGCFRKNMII 207
           YI   +WS+ICG + Y+ +D F I ARAFQGLG+AF LPN++G IG IY  G  RKNM+I
Sbjct: 123 YIFLIIWSLICGFTYYSKSDTFLIIARAFQGLGIAFTLPNVVGTIGNIYHVGSLRKNMVI 182

Query: 208 SIIGAMSPXXXXXXXXXXXXXVKYDKSNWPWSFYAFGLISFVNLIISWYCIPNSIPTNIH 267
           S+I A +P             V    S WPWSFYAF +    NL+IS Y IP++IPTN++
Sbjct: 183 SLIAASAPVGAAIGGAFAGLIVTESPSQWPWSFYAFAIACSFNLLISIYSIPSNIPTNVN 242

Query: 268 GLKMDWLGSVLGVFGLIILNFVFNQAPIVGWQSAYIIVLLVLSFCALVIFVVYEVKYAKT 327
           G KMDW+GS L V GLI+ NF +NQ PIVGW  AYIIVLL++S   ++ F+ YE+ +A +
Sbjct: 243 GFKMDWIGSALIVTGLILFNFAWNQGPIVGWDIAYIIVLLIISVIFILAFLTYEINFAPS 302

Query: 328 PLIPKAISSNRGMLMILFSLFCGWGSFGIWTFYYFSFELNLRHYSPLWAGSSYFIFVISG 387
           PLI + I+ +R M++ +F+LF GWGS+GIW+FYYFSF LNLRHYSP+WAG SYFIF I G
Sbjct: 303 PLIAREITHSRNMIITIFTLFLGWGSYGIWSFYYFSFVLNLRHYSPVWAGGSYFIFGIFG 362

Query: 388 STVAIVCGLTIKKIKPSVLFCCSMMGFLGGNIIFAATPVNQTFFRNMLGCMFLLPLGMDF 447
              +   G++IKKI   V+   SM+ F  G  + +  PV+Q++F+  L  M +L +G+D 
Sbjct: 363 VLASAFVGISIKKITAPVILLFSMVLFCVGTTLLSVAPVDQSYFKLTLAGMAILGVGLDT 422

Query: 448 SFPASSIILSDSLPMQYQGMAGSLVNTVINYSTSICLGMAGTVEMKHNSHGKDLLNGYRA 507
           SFPA++IILSD LPM+YQGMAGSL  T++NYS S+CLGM  TVE + N  G+D+L GYR+
Sbjct: 423 SFPAATIILSDGLPMEYQGMAGSLALTMVNYSMSLCLGMGNTVERQINKDGQDVLKGYRS 482

Query: 508 AIY 510
           A Y
Sbjct: 483 AEY 485

>YOR378W Chr15 (1049511..1051058) [1548 bp, 515 aa] {ON} Putative
           paralog of ATR1, but not required for boron tolerance;
           member of the DHA2 family of drug:H+ antiporters;
           YOR378W is not an essential gene
          Length = 515

 Score =  325 bits (833), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 194/524 (37%), Positives = 295/524 (56%), Gaps = 26/524 (4%)

Query: 33  KNIDSRSSLNSSLTQVLSTDTADNDESSSYQNPDYFKNKYQEFGFIFSGMIGQLLSQAGL 92
           KN+D+ +       +VLS     ++           K+   E  F+      QL++QAGL
Sbjct: 10  KNLDTNAEALKKEDKVLSEFDIQDERP---------KSLLWESAFVGVLCSAQLMTQAGL 60

Query: 93  TQTLSIMNVLAKELDSTSSRQ-AWLMSSFPLALGSFILVSGRLGDIYGLKKILLGGYIIT 151
            Q+L+ ++++     +T++ Q +W  S++ L +G+FIL++GRLGDI+G KK  + G+   
Sbjct: 61  GQSLAPLHIIGNSFGTTNAGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWY 120

Query: 152 TVWSIICGLSSYAHNDAFFITARAFQGLGLAFALPNMIGLIGTIYRPGCFRKNMIISIIG 211
            +WS++ G S Y+ N  FF   RAFQG+G AF LPN I ++G  Y+PG  RKNM+ S+ G
Sbjct: 121 ALWSLLAGFSVYS-NQIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGR-RKNMVFSLFG 178

Query: 212 AMSPXXXXXXXXXXXXXVKYDKSNWPWSFYAFGLISFVNLIISWYCIPNS-IPTNIHG-- 268
           A +P              +   + WPW+++  G+  FV  +  ++ IP++ +P+      
Sbjct: 179 ASAPGGFFLGAVFSSMLGQL--AWWPWAYWIMGIACFVLAVAGYFVIPHTPMPSRDASSF 236

Query: 269 ---LKMDWLGSVLGVFGLIILNFVFNQAPIVGWQSAYIIVLLVLSFCALVIFVVYEVKYA 325
               ++D+ GSV GV GLI+ NF +NQ P+VGWQ+ Y   LL++    LVIF   E + A
Sbjct: 237 KLLERIDFAGSVTGVVGLILFNFAWNQGPVVGWQTPYTYALLIVGTFFLVIFAYIESR-A 295

Query: 326 KTPLIP-KAISSNRGMLMILFSLFCGWGSFGIWTFYYFSFELNLRHYSPLWAGSSYFIFV 384
             PL+P  A+SS+     +L  +  GW SFGIW FY + F  + R  +PL + + +    
Sbjct: 296 AFPLLPFAALSSDTAF--VLSCIAAGWASFGIWIFYTWQFMEDSRGQTPLLSSAQFSPVA 353

Query: 385 ISGSTVAIVCGLTIKKIKPSVLFCCSMMGFLGGNIIFAATPVNQTFFRNMLGCMFLLPLG 444
           ISG   A+  G  +    PS +   +M  F  G I+ A  PV+QT++      + ++P G
Sbjct: 354 ISGFCAAVTTGFLLSHTPPSTVMLFAMTAFTVGTILIATAPVHQTYWAQTFVSIIVMPWG 413

Query: 445 MDFSFPASSIILSDSLPMQYQGMAGSLVNTVINYSTSICLGMAGTVEMKHNSHGKDLLNG 504
           MD SFPA++I+LSDS+P ++QG+A SLVNTV+NYS SI LG+AGT+E + N  G   L G
Sbjct: 414 MDMSFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESRVNDGGAKPLKG 473

Query: 505 YRAAIYFAIGLAGLAVCVSGGYMIECLWKDRVLSLEENKQTDIE 548
           YR + Y  IGL+GL + V+  Y      K +    E  KQ  IE
Sbjct: 474 YRCSWYMGIGLSGLGIFVAATYAWSTFMKSKKRISE--KQHFIE 515

>Smik_15.560 Chr15 (995453..997003) [1551 bp, 516 aa] {ON} YOR378W
           (REAL)
          Length = 516

 Score =  322 bits (825), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 192/524 (36%), Positives = 299/524 (57%), Gaps = 24/524 (4%)

Query: 40  SLNSSLTQV---LSTDTADNDESSSYQNPDYFKNKYQ----EFGFIFSGMIGQLLSQAGL 92
           +L+S +T+    ++ +T   D+       D  + K +    E  F+      QL++QAGL
Sbjct: 2   TLSSPVTEENLDMNVETLKKDDEVLSDEFDVQEEKPESLLWESAFVGVLCSAQLMTQAGL 61

Query: 93  TQTLSIMNVLAKELDSTSSRQ-AWLMSSFPLALGSFILVSGRLGDIYGLKKILLGGYIIT 151
            Q+L+ ++++     + +  Q +W  S++ L +G+FIL++GRLGDI+G KK  + G+   
Sbjct: 62  GQSLAPLHIIGDSFGTANPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWY 121

Query: 152 TVWSIICGLSSYAHNDAFFITARAFQGLGLAFALPNMIGLIGTIYRPGCFRKNMIISIIG 211
            +WS++ G S Y+ N  FF   RAFQG+G AF LPN I ++G  Y+PG  RKNM+ S+ G
Sbjct: 122 ALWSLLAGFSVYS-NQIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGR-RKNMVFSLFG 179

Query: 212 AMSPXXXXXXXXXXXXXVKYDKSNWPWSFYAFGLISFVNLIISWYCIPNS-IPT-NIHGL 269
           A +P              +   + WPW+++  G+  F+  +  +Y IP++ +P  ++   
Sbjct: 180 ASAPGGFVLGAVFSSMLGQL--AWWPWAYWLMGIACFLLAVAGYYLIPHTPMPNRDVASF 237

Query: 270 KM----DWLGSVLGVFGLIILNFVFNQAPIVGWQSAYIIVLLVLSFCALVIFVVYEVKYA 325
           K+    D+ GSV GV GLI+ NF +NQ P+VGWQ+ Y   LL++    L+IF   E + A
Sbjct: 238 KLLERIDFAGSVTGVVGLILFNFAWNQGPVVGWQTPYTYALLIVGTVFLIIFAFIESR-A 296

Query: 326 KTPLIP-KAISSNRGMLMILFSLFCGWGSFGIWTFYYFSFELNLRHYSPLWAGSSYFIFV 384
             PL+P  A+SS+     +L  +  GW SFGIW FY + F  + R  +PL + + +    
Sbjct: 297 AFPLLPFAALSSDTAF--VLSCIAAGWASFGIWIFYTWQFMEDSRGQTPLLSSAQFSPVA 354

Query: 385 ISGSTVAIVCGLTIKKIKPSVLFCCSMMGFLGGNIIFAATPVNQTFFRNMLGCMFLLPLG 444
           ISG   A++ G  +    PS +   +M  F  G I+ A  PV+QT++      + ++P G
Sbjct: 355 ISGFCAALMTGFLLSHTPPSTVMFFAMTAFTVGTILIATAPVHQTYWAQTFVSIIVMPWG 414

Query: 445 MDFSFPASSIILSDSLPMQYQGMAGSLVNTVINYSTSICLGMAGTVEMKHNSHGKDLLNG 504
           MD SFPA++I+LSDS+P ++QG+A SLVNTV+NYS SI LG+AGT+E   N  G ++L G
Sbjct: 415 MDMSFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESNVNDGGANVLKG 474

Query: 505 YRAAIYFAIGLAGLAVCVSGGYMIECLWKDRVLSLEENKQTDIE 548
           YR + Y  IGL+G  + V+  Y +    K +    E  KQ  IE
Sbjct: 475 YRCSWYLGIGLSGFGIFVAATYAVSTFMKSKKRVSE--KQHFIE 516

>Skud_15.545 Chr15 (988549..990099) [1551 bp, 516 aa] {ON} YOR378W
           (REAL)
          Length = 516

 Score =  321 bits (823), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 183/472 (38%), Positives = 276/472 (58%), Gaps = 17/472 (3%)

Query: 85  QLLSQAGLTQTLSIMNVLAKELDSTSSRQ-AWLMSSFPLALGSFILVSGRLGDIYGLKKI 143
           QL++QAGL Q+L+ ++++ K   +T+  Q +W  S++ L +G+FIL++GRLGDI+G KK 
Sbjct: 54  QLMTQAGLGQSLAPLHIIGKSFGTTNPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKF 113

Query: 144 LLGGYIITTVWSIICGLSSYAHNDAFFITARAFQGLGLAFALPNMIGLIGTIYRPGCFRK 203
            + G+    +WS++ G S Y+ N  FF   RAFQG+G AF LPN I ++G  Y+ G  RK
Sbjct: 114 FVLGFFWYALWSLLAGFSVYS-NKIFFDCCRAFQGMGPAFLLPNAIAILGRTYKSGK-RK 171

Query: 204 NMIISIIGAMSPXXXXXXXXXXXXXVKYDKSNWPWSFYAFGLISFVNLIISWYCIPNSIP 263
           NM+ S+ GA +P              +   + WPW+++  G+  F   I  ++ IP++  
Sbjct: 172 NMVFSLFGACAPGGFVLGAVFSSLLGQL--AWWPWAYWIMGIACFFLAIAGYFIIPHTAM 229

Query: 264 TNIHG------LKMDWLGSVLGVFGLIILNFVFNQAPIVGWQSAYIIVLLVLSFCALVIF 317
            + H        ++D+ GSV GV GLI+ NF +NQ P+VGWQ+ Y  +LL++    L IF
Sbjct: 230 PSRHASSFKLLERVDFAGSVTGVIGLILFNFAWNQGPVVGWQTPYTYILLIVGTVFLAIF 289

Query: 318 VVYEVKYAKTPLIP-KAISSNRGMLMILFSLFCGWGSFGIWTFYYFSFELNLRHYSPLWA 376
              E + A  PL+P  A+SS+     +L  +  GW SFGIW FY + F  + R  +PL +
Sbjct: 290 AFIESR-AAFPLLPFAALSSDTAF--VLSCIAAGWASFGIWIFYTWQFMEDSRGQTPLLS 346

Query: 377 GSSYFIFVISGSTVAIVCGLTIKKIKPSVLFCCSMMGFLGGNIIFAATPVNQTFFRNMLG 436
            + +    +SG   A+  G  + +  PS +   +M  F  G I+ A  PV+QT++     
Sbjct: 347 SAQFSPVAVSGFCAALTTGYLLSRTPPSTVMLFAMTAFTAGTILIATAPVHQTYWAQTFV 406

Query: 437 CMFLLPLGMDFSFPASSIILSDSLPMQYQGMAGSLVNTVINYSTSICLGMAGTVEMKHNS 496
            + ++P GMD SFPA++I+LSDS+P ++QG+A SLVNTV+NYS SI LG+AGT+E   N 
Sbjct: 407 SIIVMPWGMDMSFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESNVND 466

Query: 497 HGKDLLNGYRAAIYFAIGLAGLAVCVSGGYMIECLWKDRVLSLEENKQTDIE 548
            G   L GYR + Y  IGL+GL + V+  Y      K +  + E  KQ  IE
Sbjct: 467 GGAKPLKGYRCSWYMGIGLSGLGIFVAAIYAWSTFKKSKKRTSE--KQHFIE 516

>Suva_8.435 Chr8 (786917..788464) [1548 bp, 515 aa] {ON} YOR378W
           (REAL)
          Length = 515

 Score =  315 bits (807), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 187/526 (35%), Positives = 294/526 (55%), Gaps = 25/526 (4%)

Query: 27  PEQQSL--KNIDSRSSLNSSLTQVLSTDTADNDESSSYQNPDYFKNKYQEFGFIFSGMIG 84
           P + S+  KN+++ +    +  +VL       DE+          +   E  F+      
Sbjct: 2   PRRPSVTQKNLETSAETTKTDDEVLLNQFELQDETPG--------SLVWEAAFVGVLCSA 53

Query: 85  QLLSQAGLTQTLSIMNVLAKELDSTSSRQ-AWLMSSFPLALGSFILVSGRLGDIYGLKKI 143
           QL++QAGL Q+++ ++++     +T+  Q +W  SS+ L +G+FIL++GRLGDI+G +K 
Sbjct: 54  QLMTQAGLGQSIAPLHIIGDSFGTTNPGQLSWFASSYSLTVGTFILIAGRLGDIFGHRKF 113

Query: 144 LLGGYIITTVWSIICGLSSYAHNDAFFITARAFQGLGLAFALPNMIGLIGTIYRPGCFRK 203
            + G+    +WS++ G S Y+ N  FF   RAFQG+G AF LPN I ++G  Y+PG  RK
Sbjct: 114 FILGFFWYALWSLLAGFSVYS-NKIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGK-RK 171

Query: 204 NMIISIIGAMSPXXXXXXXXXXXXXVKYDKSNWPWSFYAFGLISFVNLIISWYCIPN--- 260
           NM+ S+ GA +P              +   + WPW+++  G+  F+  +  ++ IP+   
Sbjct: 172 NMVFSLFGASAPGGFVLGAVFSSMLGQL--AWWPWAYWIMGIACFLLAVAGYFVIPHVQM 229

Query: 261 ---SIPTNIHGLKMDWLGSVLGVFGLIILNFVFNQAPIVGWQSAYIIVLLVLSFCALVIF 317
                P+     ++D+ GSV GV GLI+ NF +NQ P+VGW++ Y  VLL++    L +F
Sbjct: 230 PSRDSPSFNMLERVDFAGSVTGVIGLILFNFAWNQGPVVGWETPYTYVLLIVGTVFLGVF 289

Query: 318 VVYEVKYAKTPLIP-KAISSNRGMLMILFSLFCGWGSFGIWTFYYFSFELNLRHYSPLWA 376
           V  E + A  PL+P  A+SS+     +L  +  GW SFGIW FY + F    R  SPL +
Sbjct: 290 VFIESR-AAYPLLPFAALSSDAAF--VLGCIAAGWSSFGIWIFYTWQFMEESRKQSPLLS 346

Query: 377 GSSYFIFVISGSTVAIVCGLTIKKIKPSVLFCCSMMGFLGGNIIFAATPVNQTFFRNMLG 436
            + +    ISG   A+  G  +     S +   +M  F  G I+ A  PV+QT++     
Sbjct: 347 SAQFAPVAISGFCAAVTTGFLLSHTPASTVMLFAMTAFTVGIILIATAPVHQTYWAQTFV 406

Query: 437 CMFLLPLGMDFSFPASSIILSDSLPMQYQGMAGSLVNTVINYSTSICLGMAGTVEMKHNS 496
            + ++P GMD SFPA++I+LS+S+P ++QG+A SLVNTV+NYS SI LG+AGT+E + N 
Sbjct: 407 SIIVMPWGMDMSFPAATIMLSNSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESQVND 466

Query: 497 HGKDLLNGYRAAIYFAIGLAGLAVCVSGGYMIECLWKDRVLSLEEN 542
            G + L GYR + Y  IGL+GL + V+  Y      K +  + E+ 
Sbjct: 467 GGANALKGYRCSWYMGIGLSGLGIFVAAVYASSTFLKSKKKASEKQ 512

>KLTH0C10560g Chr3 (875216..876763) [1548 bp, 515 aa] {ON} similar
           to uniprot|Q08902 Saccharomyces cerevisiae YOR378W
           Hypothetical ORF
          Length = 515

 Score =  314 bits (805), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 182/518 (35%), Positives = 288/518 (55%), Gaps = 14/518 (2%)

Query: 31  SLKNIDSRSSLNSSLTQVLSTDTADNDESSSYQNPDYFKNKYQEFGFIFSGMIGQLLSQA 90
           S  + +     +  LT+  + D         +      ++   E  F+      QL++QA
Sbjct: 2   SFTDKEENQKKDDGLTRESTHDQGQELSQPHHNGIQKPESLLGEAAFVGVICGAQLMTQA 61

Query: 91  GLTQTLSIMNVLAKELDSTSSRQ-AWLMSSFPLALGSFILVSGRLGDIYGLKKILLGGYI 149
           GL Q+++ ++++     + +  Q +W  +++ L +G+FIL++GRLGD+YG KK  + G+ 
Sbjct: 62  GLGQSIAPLHIIGDSFGTRNPGQLSWFAAAYSLTVGTFILIAGRLGDVYGHKKFFIIGFF 121

Query: 150 ITTVWSIICGLSSYAHNDAFFITARAFQGLGLAFALPNMIGLIGTIYRPGCFRKNMIISI 209
              +WS++ G S Y+ N  FF   RAFQG+G A  LPN I ++G  Y PG  RK MI+S+
Sbjct: 122 WYALWSLLAGFSVYS-NQIFFDCCRAFQGIGPALLLPNAIAILGRTYVPGR-RKAMILSL 179

Query: 210 IGAMSPXXXXXXXXXXXXXVKYDKSNWPWSFYAFGLISFVNLIISWYCIPN----SIPTN 265
            GA +P              +   + WPW+++A G++ F   +     IP      + T+
Sbjct: 180 FGATAPAGFVLGAVFSSIFGQL--TWWPWAYWAMGIVCFFLAVAGILVIPRMPLPELDTS 237

Query: 266 IHGL-KMDWLGSVLGVFGLIILNFVFNQAPIVGWQSAYIIVLLVLSFCALVIFVVYEVKY 324
           +    ++D  GSV GV GL++LNF +NQ P+VGWQ+ Y   LL++S   L +F   E + 
Sbjct: 238 VSTYQRLDIPGSVTGVIGLVLLNFAWNQGPVVGWQTPYTYSLLIVSAVFLCVFAFIESR- 296

Query: 325 AKTPLIP-KAISSNRGMLMILFSLFCGWGSFGIWTFYYFSFELNLRHYSPLWAGSSYFIF 383
           A  PL+P  A+SS+     +L  +  GW SFGIW +Y++ F   LR +SPL   + +   
Sbjct: 297 APHPLLPLSALSSDAAF--VLGCVGAGWSSFGIWIYYFWLFLEELRGHSPLLTSAQFAPV 354

Query: 384 VISGSTVAIVCGLTIKKIKPSVLFCCSMMGFLGGNIIFAATPVNQTFFRNMLGCMFLLPL 443
            ISG   A+  G  I +++ S++   +M  F  G I+ A  PV Q ++      + ++P 
Sbjct: 355 AISGLCAALTTGFVITRVRASLVMLFAMTAFTVGGILIATAPVKQVYWAQAFVSIIVMPW 414

Query: 444 GMDFSFPASSIILSDSLPMQYQGMAGSLVNTVINYSTSICLGMAGTVEMKHNSHGKDLLN 503
           GMD SFPA++I+LSDS+P ++QG+A SLVN V+NYS SI LG+AGTVE + N+ G +LL 
Sbjct: 415 GMDMSFPAATIMLSDSMPHEHQGLAASLVNVVVNYSISIGLGLAGTVEGRVNNGGANLLK 474

Query: 504 GYRAAIYFAIGLAGLAVCVSGGYMIECLWKDRVLSLEE 541
           GYR A Y  IGL+G  + ++  Y      K + +  E+
Sbjct: 475 GYRGAWYMGIGLSGFGILIAFMYEYHTFKKSKKMPSEK 512

>Kwal_23.6547 s23 (1635677..1637212) [1536 bp, 511 aa] {ON} YOR378W
           - Hypothetical ORF [contig 358] FULL
          Length = 511

 Score =  311 bits (797), Expect = 3e-99,   Method: Compositional matrix adjust.
 Identities = 178/502 (35%), Positives = 283/502 (56%), Gaps = 16/502 (3%)

Query: 55  DNDESSSYQNPDYFKNKYQEF--GFIFSGMI--GQLLSQAGLTQTLSIMNVLAKELDSTS 110
            N+E  S Q       K Q      +F G++   QL++QAGL Q+++ + ++      ++
Sbjct: 16  KNEEGESLQLVQSHVEKPQSLMREALFVGILSCAQLMTQAGLAQSIAPVRIIGNSFGISN 75

Query: 111 SRQ-AWLMSSFPLALGSFILVSGRLGDIYGLKKILLGGYIITTVWSIICGLSSYAHNDAF 169
             Q +W  +++ L +G+FIL++GRLGD++G KK+ + G++  ++WS++ G S Y+ N  F
Sbjct: 76  PGQLSWFSAAYSLTVGTFILIAGRLGDLFGHKKLFVVGFLWYSLWSLLAGFSVYS-NQIF 134

Query: 170 FITARAFQGLGLAFALPNMIGLIGTIYRPGCFRKNMIISIIGAMSPXXXXXXXXXXXXXV 229
           F   RA QG+G AF LPN I ++G  Y PG  RK M+ SI GA +P              
Sbjct: 135 FDCCRALQGIGPAFLLPNSIAILGRTYTPGK-RKQMVFSIFGATAPGGFVLGSVFSSIFS 193

Query: 230 KYDKSNWPWSFYAFGLISFVNLIISWYCIPNSIPTNIH---GL--KMDWLGSVLGVFGLI 284
           +   + WPW+++A G    V  +     IP + P  I    G+  ++D  G+  G+ GL 
Sbjct: 194 QL--AWWPWAYWAMGTACLVLGVAGIIVIPQAPPPKIDISAGILERIDAAGATTGILGLA 251

Query: 285 ILNFVFNQAPIVGWQSAYIIVLLVLSFCALVIFVVYEVKYAKTPLIPKAISSNRGMLMIL 344
           ++NF +NQ P+VGWQ+ Y   LL++ F  L++F + E + A+ PL+P A  S   +  +L
Sbjct: 252 LVNFAWNQGPVVGWQTPYTYALLIVGFVFLLVFSLIESR-ARFPLLPFAALSTD-LAYVL 309

Query: 345 FSLFCGWGSFGIWTFYYFSFELNLRHYSPLWAGSSYFIFVISGSTVAIVCGLTIKKIKPS 404
             +  GW SFGIW FY++ F  + R  SPL   + +    ISG   A+  G  +  +   
Sbjct: 310 GCIAAGWSSFGIWIFYFWQFLEDSRSQSPLLTSAQFVPVAISGLCAALTTGYILSHVPAC 369

Query: 405 VLFCCSMMGFLGGNIIFAATPVNQTFFRNMLGCMFLLPLGMDFSFPASSIILSDSLPMQY 464
            +   +M+ F  G ++ A  P+NQT++      + ++P GMD SFPA++I++S+++P ++
Sbjct: 370 AVMLIAMIAFTVGGVLVATAPINQTYWAQTFVSLIIMPWGMDMSFPAATIMISNAMPHEH 429

Query: 465 QGMAGSLVNTVINYSTSICLGMAGTVEMKHNSHGKDLLNGYRAAIYFAIGLAGLAVCVSG 524
           QG+A SLVNTV+NYS S+ LG AGT+E + N+ G + L GYR A Y  IGL+GL V V+ 
Sbjct: 430 QGLAASLVNTVVNYSISLALGFAGTIETRVNNKGANRLEGYRGAWYMGIGLSGLGVLVAI 489

Query: 525 GYMIECLWKDRVLSLEENKQTD 546
            Y    L K +   L E    +
Sbjct: 490 VYAWSTLKKFKEEQLSEKSSNN 511

>KLLA0B00352g Chr2 (22476..23972) [1497 bp, 498 aa] {ON} highly
           similar to uniprot|Q08902 Saccharomyces cerevisiae
           YOR378W
          Length = 498

 Score =  296 bits (759), Expect = 8e-94,   Method: Compositional matrix adjust.
 Identities = 170/466 (36%), Positives = 264/466 (56%), Gaps = 14/466 (3%)

Query: 52  DTADNDESSSYQNPDYFKNKYQEFGFIFSGMIGQLLSQAGLTQTLSIMNVLAKELDSTSS 111
           ++ +  +S   QN   + +  +E   I      QL++QAGL Q++  + ++       + 
Sbjct: 7   NSHEEQDSLLLQNSREWTSLLKEGFAIMVLCSAQLMTQAGLAQSIVPLQIIGDSFGIKNP 66

Query: 112 RQ-AWLMSSFPLALGSFILVSGRLGDIYGLKKILLGGYIITTVWSIICGLSSYAHNDAFF 170
            Q +W  S+F L +G+FIL++GRLGD +G KK  + G++   +WSI+ G S Y+ N  FF
Sbjct: 67  GQLSWFASAFSLTVGTFILIAGRLGDTFGHKKFFVMGFLWYALWSILAGFSVYS-NQIFF 125

Query: 171 ITARAFQGLGLAFALPNMIGLIGTIYRPGCFRKNMIISIIGAMSPXXXXXXXXXXXXXVK 230
              RAFQG+G AF LPN I +I   YRPG  ++NMI S+ GA +P              +
Sbjct: 126 DCCRAFQGIGPAFTLPNAIAIIARTYRPGR-KQNMIFSLFGACAPSGFVVGAVFSSLLSE 184

Query: 231 YDKSNWPWSFYAFGLISFVNLIISWYCIPNSIPTNIHGL-----KMDWLGSVLGVFGLII 285
           +  + WPW+++  G+  F+  +  +  IP+  P +         ++D  GSV GV GLI+
Sbjct: 185 F--AWWPWAYWIMGITCFLLGVAGYLVIPHHPPIHPDEKCSLVERIDVAGSVTGVVGLIL 242

Query: 286 LNFVFNQAPIVGWQSAYIIVLLVLSFCALVIFVVYEVKYAKTPLIP-KAISSNRGMLMIL 344
            NF +NQ P+VGW+++Y   LL++    L  F   E + AK PL+P + +SS+   + ++
Sbjct: 243 FNFAWNQGPVVGWETSYTYALLIVGSAFLAAFGFIESR-AKHPLLPVRKLSSDT--IFVM 299

Query: 345 FSLFCGWGSFGIWTFYYFSFELNLRHYSPLWAGSSYFIFVISGSTVAIVCGLTIKKIKPS 404
             +  GW SFGIW +Y +    NLR   PL + + +    ISG   A+     + +  PS
Sbjct: 300 GCIAAGWSSFGIWVYYTWQLMANLRDQPPLLSSAQFVPVAISGLCAAMSTEFLLTRTSPS 359

Query: 405 VLFCCSMMGFLGGNIIFAATPVNQTFFRNMLGCMFLLPLGMDFSFPASSIILSDSLPMQY 464
            +   +M+ F  G+I+ A  PV+QT++      + ++P GMD SFPA++IILS ++P  +
Sbjct: 360 TVMIIAMIAFTVGSILVATVPVSQTYWAQTFVSIIVMPWGMDMSFPAATIILSTAMPASH 419

Query: 465 QGMAGSLVNTVINYSTSICLGMAGTVEMKHNSHGKDLLNGYRAAIY 510
           QG+A SLVNT+INYS SI LG AGT+E + +    DLL GYR A Y
Sbjct: 420 QGLAASLVNTIINYSISIGLGFAGTIESQISDGEDDLLKGYRGAYY 465

>TDEL0G04950 Chr7 complement(922428..923966) [1539 bp, 512 aa] {ON} 
          Length = 512

 Score =  263 bits (672), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 174/482 (36%), Positives = 280/482 (58%), Gaps = 24/482 (4%)

Query: 56  NDESS--SYQNPDYFKNKY-----QEFGFIFSGMIGQLLSQAGLTQTLSIMNVLAKELDS 108
           N ESS  +Y    + K+       +E+ F+F+G++ Q  +QAG T  L ++NVL     S
Sbjct: 25  NQESSKEAYDRCSWLKSSNFHFLCKEYAFVFTGVMAQAFNQAGGTMILPLVNVL-----S 79

Query: 109 TSSRQAWLMSSFPLALGSFILVSGRLGDIYGLKKILLGGYIITTVWSIICGLSSYAHNDA 168
            S    +L++S+P+  GSF+L+ GRLG+++G K+ LLGGYII  + S++ GLS Y+ +  
Sbjct: 80  DSFHGKFLLNSYPMVCGSFMLIGGRLGEVHGYKETLLGGYIILILSSLLGGLSRYSKSSI 139

Query: 169 FFITARAFQGLGLAFALPNMIGLIGTIYR--PGCFRKNMIISIIGAMSPXXXXXXXXXXX 226
           F++  RAFQG+G+A  LPN        Y+      RK ++ +IIG  +            
Sbjct: 140 FYVICRAFQGVGMALILPNFSAAYDYRYQSQAKAHRKTILSTIIGCGASTGAFLGTFLSG 199

Query: 227 XXVKYDKSNWPWSFYAFGLISFVNLIISWYCIPNSIPTN----IHGLKMDWLGSVLGVFG 282
             V   +SNW W++Y + + + + L +S+Y +P++I       ++GL   W  +     G
Sbjct: 200 ICVTRSESNWSWAYYTYTIAATLTLALSYYSVPDNITKKNKPCLNGL--GWFSNR--SCG 255

Query: 283 LIILNFVFNQAPIVGWQSAYIIVLLVLSFCALVIFVVYEVKYAKTPLIPKAISSNRGMLM 342
           L++LN   N A +     ++IIVLLV+  C L++F+V+E+K+++ P+  K + +N  + +
Sbjct: 256 LLMLNVACNLAAVASSNWSHIIVLLVVFVCLLLLFLVFELKFSEDPVFSKELFTNASVSL 315

Query: 343 ILFSLFCGWGSFGIWTFYYFSFELNLRHYSPLWAGSSYFIFVISGSTVAIVCGLTIKKIK 402
           +L S+F GWG++GIW+ Y+F F LNLR+YSPL AGS+Y   VI G    I   + +K+  
Sbjct: 316 VLASIFFGWGTYGIWSGYFFRFLLNLRNYSPLAAGSTYLTLVIGGYVAEIGISMLVKRTG 375

Query: 403 PSVLFCCSMMGFLGGNIIFAATPVNQTFFRNMLGCMFLLPLGMDFSFPASSIILSDSLPM 462
           P +    S +GF    II + TP++Q++FR+ LG M  L LG+DFSFP+S+IIL + LP 
Sbjct: 376 PKLFLLFSSLGFTCSIIILSVTPIHQSYFRSTLGSMIFLALGLDFSFPSSAIILQNELPS 435

Query: 463 QYQGMAGSLVNTVINYSTSICLGMAGTVEMKHNSHGKDLLNGYRAAIYFAIGLAGLAVCV 522
           +Y  M   L N + NY+ S   G+  +     +S   +L+  YR   YFAIGL+ + +  
Sbjct: 436 KYHEMTAVLTNGIFNYAISFWPGICNSALRSLSS--IELIKYYRYVYYFAIGLSAIGLFA 493

Query: 523 SG 524
           +G
Sbjct: 494 AG 495

>KNAG0D00130 Chr4 complement(6264..7961) [1698 bp, 565 aa] {ON}
           YOR378W
          Length = 565

 Score =  185 bits (470), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 131/452 (28%), Positives = 220/452 (48%), Gaps = 21/452 (4%)

Query: 85  QLLSQAGLTQTLSIMNVLAKELDSTS-SRQAWLMSSFPLALGSFILVSGRLGDIYGLKKI 143
           Q+L  AG  Q +  M+V+ +    T  S   W    +    GSF+L++G++GD+ G K +
Sbjct: 89  QVLGLAGAVQGIPQMDVIVEWFKLTHPSDSGWCNGGYATTYGSFVLIAGKMGDMNGHKSM 148

Query: 144 LLGGYIITTVWSIICGLSSYAHNDAFFITARAFQGLGLAFALPNMIGLIGTIYRPGCFRK 203
            L GY    +WS++ G S Y  +  FF   RA QG+G AF   + + ++G  Y P C RK
Sbjct: 149 FLIGYAWLALWSLLTGFSRYCPSSHFFFFCRAAQGIGAAFTFTSALSILGKSYPP-CKRK 207

Query: 204 NMIISIIGAMSPXXXXXXXXXXXXXVKYDKSNWPWSFYAFGLISFVNLIISWYCIPNSIP 263
           N I S  GA                 +   ++W W++++  +   V +I+S + IP  + 
Sbjct: 208 NFIFSFFGACGSFGVVLGMVFSALFTQL--AHWSWAYWSMAIACVVIIILSIFFIPGDVV 265

Query: 264 TNIHGLKM---DWLGSVLGVFGLIILNFVFNQAPIVGWQSAYIIVLLVLSFCALVIFVVY 320
                  +   D+LG+ L V GL++ +  +NQAP  G+   Y+ VLL++S   L + +  
Sbjct: 266 EKHETSNVFYFDYLGAFLFVTGLVLFSVAWNQAPTYGFGRTYVYVLLIVSVVILALAMYV 325

Query: 321 EVKYAKTPLIP-KAISSNRGMLMILFSLFCGWGSFGIWTFYYFSFELNLRHYSPLWAGSS 379
           E K    PL+P   IS+N   L +L ++F  + SF +W  Y F F L  +  + L A + 
Sbjct: 326 ETK-VDDPLLPWTHISANT--LKVLLAIFFAYASFTMWAAYTFRFNLMAKGDTLLLAAAK 382

Query: 380 YFIFVISGSTVAIVCGLTIK-KIKPSVLFCCSMMGFLGGNIIFAATPVNQTFFRNMLGCM 438
                +SG   A+   L +   ++  +    S++ FL   I+ A     QT++  +    
Sbjct: 383 MTPMAVSGVFAALFSALLLNIHVQVQIRMLISLLAFLVPPILMATMGAGQTYWGEVFVTT 442

Query: 439 FLLPLGMDFSFPASSIILSDSLPMQYQGMAGSLVNTVINYSTSICLGMAGTVE------- 491
            ++  G+D SFP+++++LS+ +P +++G+  SLV  V+NY+T++    A +V        
Sbjct: 443 IVISFGLDISFPSATLLLSNRIPDKFKGLGASLVGAVLNYATALGPPTAASVLRYQCPDC 502

Query: 492 MKHNSHGKDLLNGYRAAIYFAIGLAGLAVCVS 523
           M H   G           Y  IG AGL   V+
Sbjct: 503 MAHK--GNAFTKTINIIGYVGIGTAGLGTLVA 532

>KAFR0C04860 Chr3 (964552..966156) [1605 bp, 534 aa] {ON}  YOR378W
          Length = 534

 Score =  172 bits (435), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 143/529 (27%), Positives = 259/529 (48%), Gaps = 27/529 (5%)

Query: 36  DSRSSLNSSLTQVLSTDTA-----DNDESSSYQNPDYFKNKYQEFGFIFSGMIGQLLSQA 90
           +S  +L SS  Q     +       ++E  S  +      +++E   +     GQ +S  
Sbjct: 5   ESEETLTSSKLQPHEPTSPVKVVPSHNEILSKTDEHPLNMQFKEIIIVLLISSGQFISLL 64

Query: 91  GLTQTLSIMNVLAKELDSTSSRQ---AWLMSSFPLALGSFILVSGRLGDIYGLKKILLGG 147
           G  Q +  M  +A        +     W  +++     +F++++G+LGDI G K + + G
Sbjct: 65  GAVQGIPQMASIASTFSLRPDQNLELGWCNAAYATTATTFVIIAGKLGDINGHKNMFIFG 124

Query: 148 YIITTVWSIICGLSSYAH-NDAFFITARAFQGLGLAFALPNMIGLIGTIYRPGCFRKNMI 206
           Y   T+WS++ G S YA  N  FF   R  QG+G AF  P  + L+G  Y P C RKN +
Sbjct: 125 YAWLTLWSLLTGFSKYAKANAVFFYFCRGAQGIGSAFLTPTGLALLGKHYPP-CKRKNYV 183

Query: 207 ISIIGAMSPXXXXXXXXXXXXXVKYDKSNWPWSFYAFGLISFVNLIISWYCIP-NSIPTN 265
            S  GA  P              +   + W W++++  +   +  I+S+  IP ++ P  
Sbjct: 184 FSFYGACGPFGIVAGSVFSALFTQL--TTWAWTYWSMAVTCLIITILSYIFIPKDNTPKR 241

Query: 266 IHG--LKMDWLGSVLGVFGLIILNFVFNQAPIVGWQSAYIIVLLVLSFCALVIFVVYEVK 323
                   D++G   G+ G+I+ + V+NQAP+  +++ Y+  LL++S   + + ++ + +
Sbjct: 242 ERSAFYSFDYVGGFCGITGMILFSVVWNQAPLSHFKAPYVYSLLIVSVVFMTMALIIDSR 301

Query: 324 YAKTPLIP-KAISSNRGMLMILFSLFCGWGSFGIWTFYYFSFELNLRHYSPLWAGSSYFI 382
             K PLIP K++ SN  ++  L  +F G+  F IW FY + F L  ++ S L A + +  
Sbjct: 302 -VKDPLIPWKSMCSN--VIKALIVVFFGFLGFTIWLFYSWRFYLVAKNDSLLLAAAKFIP 358

Query: 383 FVISGSTVAIVCGLTI-KKIKPSVLFCCSMMGFLGGNIIFAATPVNQTFFRNMLGCMFLL 441
             ISG   A    L + KK+   +    ++  FL   I+ +   + +T++ N      ++
Sbjct: 359 LGISGIFAACFSVLLLNKKVPVQLRLLTAVCAFLICAILISTMTLQETYWGNAFVATVII 418

Query: 442 PLGMDFSFPASSIILSDSLPMQYQGMAGSLVNTVINYSTSICLGMAGTV------EMKHN 495
            +G+D +FP+++++LS+ +  + QG+A +L  T +NY T++  G+A  +      +    
Sbjct: 419 AIGLDVAFPSATLLLSNGVLNEQQGLAAALAATALNYGTALGPGVATLIITYQCDDCLAR 478

Query: 496 SHGKDLLNGYRAAIYFAIGLAGLAVCVSGGYMIECLWKDRVLSLEENKQ 544
           S G+  ++    A Y AIG AG+AV V+    I   +K+R+  L E K+
Sbjct: 479 SDGR-FVHAVHIAGYVAIGTAGIAVVVAIFGSITEYYKERMDDLREKKR 526

>NCAS0A05720 Chr1 (1117491..1119182) [1692 bp, 563 aa] {ON} 
          Length = 563

 Score =  164 bits (414), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 144/545 (26%), Positives = 256/545 (46%), Gaps = 36/545 (6%)

Query: 32  LKNIDSRSSLNSSLT--QVLSTDTADNDESSSYQNPDYFKNKYQEFGFIFSGMIGQLLSQ 89
           L +  + SSL+S  T  Q  +   A   +     NP    ++ +E  FI      Q +S 
Sbjct: 27  LPSNSTASSLHSQRTKEQCSNLQPAQAQDQLESMNPPPGPSRLRECMFIVIIASSQFISL 86

Query: 90  AGLTQTLSIMNVLAK--ELDSTSSRQA-WLMSSFPLALGSFILVSGRLGDIYGLKKILLG 146
           A  +Q +  M+ +    +L +  S +A W  ++F +  G+FI+ +G+L D+ G K + + 
Sbjct: 87  AAASQAILQMDAITAWFQLPADRSLEAGWANAAFAITCGTFIIPAGKLCDLIGSKTVFIF 146

Query: 147 GYIITTVWSIICGLSSYAH--NDAFFITARAFQGLGLAFALPNMIGLIGTIYRPGCFRKN 204
           GY   T+WS++ G+S YA      FF   R  QG+G A   P+ + L+G  Y P C +KN
Sbjct: 147 GYAWYTLWSLLVGISRYAPKGQATFFFFGRGCQGIGAAALFPSSLALLGKYYPPSC-KKN 205

Query: 205 MIISIIGAMSPXXXXXXXXXXXXXVKYDKSNWPWSFYAFGLIS-FVNLIISWYCIPNSIP 263
           ++ S+ G   P              +   ++W W++++  ++S F  LI  +Y  P+ I 
Sbjct: 206 IVFSLYGFCVPLGVVVGGVFSAIFTQL--AHWSWNYWSMAIVSAFFTLISCFYIPPDEII 263

Query: 264 TN---------IHGLKMDWLGSVLGVFGLIILNFVFNQAPIVGWQSAYIIVLLVLSFCAL 314
            +          H  K D+LG+ L V  L++    +NQA    ++S  + V L++S    
Sbjct: 264 KSEEQKKKRAWFHLPKFDYLGTFLYVASLLLFAVCWNQATGFKFKSVQVYVTLIVSLVCF 323

Query: 315 VIFVVYEVKYAKTPLIP-KAISSN--RGMLMILFSLFCGWGSFGIWTFYYFSFELNLRHY 371
           V  V+ E  Y   P+IP + I     + +L++ FS      SF IW FY + +   +R+ 
Sbjct: 324 VAMVIVEF-YVDDPIIPARKIHPQTIKALLVVFFSYL----SFTIWLFYLWKYFTVVRND 378

Query: 372 SPLWAGSSYFIFVISGSTVAIVCGLTIKKIKP-SVLFCCSMMGFLGGNIIFAATPVNQTF 430
           + L   + +    I+G   A+   L I    P  +        FL  +I+F      +++
Sbjct: 379 TVLLGAAKFVPLSIAGFIAALFSILLISTAVPVQIRLLAGACSFLLAHILFITLSRTESY 438

Query: 431 FRNMLGCMFLLPLGMDFSFPASSIILSDSLPMQYQGMAGSLVNTVINYSTSICLGMAGTV 490
           +      + ++ +G+D SFP+++++LS+ +P + +G++ +LV T +NY T I   +A T+
Sbjct: 439 WARPFLTIIIISIGLDISFPSATLLLSNGVPQELRGISAALVGTALNYGTGIGPPIAQTI 498

Query: 491 --EMKHNSHGKDLLNGYRAAIYFA----IGLAGLAVCVS-GGYMIECLWKDRVLSLEENK 543
                        ++ +  AI+ A    IG +G+AV V   G + E  W+    S    +
Sbjct: 499 IGYQCDKCMASGDMDQFVKAIHIAAAVGIGASGIAVVVGLYGTVTEYSWETHSYSKRCVE 558

Query: 544 QTDIE 548
             D E
Sbjct: 559 PYDDE 563

>SAKL0C06116g Chr3 complement(571813..572370) [558 bp, 185 aa] {ON}
           some similarities with uniprot|P13090 Saccharomyces
           cerevisiae YML116W ATR1 Multidrug efflux pump of the
           major facilitator superfamily required for resistance to
           aminotriazole and 4-nitroquinoline-N-oxide
          Length = 185

 Score =  148 bits (373), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 80/190 (42%), Positives = 111/190 (58%), Gaps = 34/190 (17%)

Query: 82  MIGQLLSQAGLTQTLSIMNVLAKELDSTSSRQAWLMSSFPLALGSFILVSGRLGDIYGLK 141
           M+ QLL+Q G TQTL ++NVL++  +S+++ Q  L++S PL  GSFILVSG++GDIYGLK
Sbjct: 1   MMSQLLNQVGTTQTLPLINVLSRGFESSTAEQTRLVASIPLVSGSFILVSGKVGDIYGLK 60

Query: 142 KILLGGYIITTVWSIICGLSSYAHNDAFFITARAFQGLGLAFALPNMIGLIGTIYRPGCF 201
             LL GY    VWS ICGL+ YA +  FF+ ARAFQGLGLAF LPN++G +  +Y  G  
Sbjct: 61  NTLLFGYATVIVWSFICGLTRYAGSVQFFVIARAFQGLGLAFVLPNVMGTVSNVYIAGSI 120

Query: 202 RKNMIISIIGAMSPXXXXXXXXXXXXXVKYDKSNWPWSFYAFGLISFVNLIISWYCIPNS 261
           RKNM+                                  YA+ +   +N+ +  + +P +
Sbjct: 121 RKNMV----------------------------------YAYTVAVSLNMALCVWALPWN 146

Query: 262 IPTNIHGLKM 271
           IPTN+ G  M
Sbjct: 147 IPTNVRGQAM 156

 Score = 35.0 bits (79), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 44/152 (28%), Positives = 67/152 (44%), Gaps = 36/152 (23%)

Query: 354 FGIWTFYYFSFELNLRHYSPLWAGSSYFIFVISGSTVAIVCGLTIKKIKPSVLFCCS--- 410
           FG  T   +SF   L  Y    AGS  F FVI+ +      GL +  + P+V+   S   
Sbjct: 65  FGYATVIVWSFICGLTRY----AGSVQF-FVIARA----FQGLGLAFVLPNVMGTVSNVY 115

Query: 411 MMGFLGGNIIFAATPVNQTFFRNMLGCMFLLPLGMDFSFPASSIILSDSLPMQYQGMAGS 470
           + G +  N+++A T        NM  C++ LP                ++P   +G A  
Sbjct: 116 IAGSIRKNMVYAYTVAVSL---NMALCVWALPW---------------NIPTNVRGQA-- 155

Query: 471 LVNTVINYSTSICLGMAGTVEMKHNSHGKDLL 502
               ++ YS  +CLG+AGTVE + +  G D L
Sbjct: 156 ----MLGYSMPMCLGIAGTVEHRVHKGGADRL 183

>CAGL0L02519g Chr12 complement(297555..299144) [1590 bp, 529 aa]
           {ON} similar to uniprot|Q08902 Saccharomyces cerevisiae
           YOR378w
          Length = 529

 Score =  154 bits (390), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 118/413 (28%), Positives = 203/413 (49%), Gaps = 24/413 (5%)

Query: 85  QLLSQAGLTQTLSIMNVLAKELDSTSSRQA---WLMSSFPLALGSFILVSGRLGDIYGLK 141
           QL++  G  Q + I   L +      ++     W  +S+ L     +L++G+LGD+ G K
Sbjct: 49  QLVTLIGAVQGVPIAAYLRERYRIEPAKGGLVGWANASYMLGSAVMVLIAGKLGDLNGHK 108

Query: 142 KILLGGYIITTVWSIICGLSSYAH-NDAFFITARAFQGLGLAFALPNMIGLIGTIYRPGC 200
           ++++ G+I  T+WS+I G S Y   N AF+ TARA QG+G  F +PN + ++G  Y    
Sbjct: 109 RMVVFGWIWLTIWSLITGFSYYDRGNQAFYYTARALQGIGSGFIVPNSLAIMGRTYFEPG 168

Query: 201 FRKNMIISIIGAMSPXXXXXXXXXXXXXVKYDKSNWPWSFYAFGLISFVNLIISWYCIPN 260
            +K +I SI G M+               +  K  W W+++A   +  +  + +   IP 
Sbjct: 169 LKKTIIFSIFGMMTSTGFVIGTTFSSLFAQLTK--WAWNYWALACVCVLYTVGAILFIP- 225

Query: 261 SIPTNI-HG-------LKMDWLGSVLGVFGLIILNFVFNQAPIVGWQ--SAYIIVLLVLS 310
             P NI H         + D+LG++ GV GL++ +  F QA  +GW     YI +++ + 
Sbjct: 226 --PDNIVHKPNSKPLYKRFDYLGAITGVSGLVLFDVAFTQASALGWSPPHTYITLIIGVI 283

Query: 311 FCALVIFVVYEVKYAKTPLIPKAISSNRGMLMILFSLFCGWGSFGIWTFYYFSFELNLRH 370
              + +FV + V     PL+P        +++IL  ++ G+ SF IW  +++ F   + +
Sbjct: 284 LILIAMFVDWRVD---DPLVPLQ-HLRADVVVILICVYFGFLSFVIWANWFWQFYELVHN 339

Query: 371 YSPLWAGSSYFIFVISGSTVAIVCGLTIK-KIKPSVLFCCSMMGFLGGNIIFAATPVNQT 429
            SPL   +      I     AI     ++  IK   +   SM+ FL  NI+ A    N T
Sbjct: 340 DSPLRIAAKLVPLAIGSIPAAIFTVTCLQLNIKAPTMMVISMVCFLVPNILMATVTPNTT 399

Query: 430 FFRNMLGCMFLLPLGMDFSFPASSIILSDSLPMQYQGMAGSLVNTVINYSTSI 482
           ++        + P  +D + P ++++ SDS+  + QG+A SL+ TVI+Y+ SI
Sbjct: 400 YWAQPFVSSIIAPFAVDITVPTATLLFSDSVRKESQGIAASLIITVISYAISI 452

>NDAI0K02730 Chr11 complement(612590..614404) [1815 bp, 604 aa] {ON}
           
          Length = 604

 Score =  137 bits (345), Expect = 9e-34,   Method: Compositional matrix adjust.
 Identities = 128/576 (22%), Positives = 260/576 (45%), Gaps = 89/576 (15%)

Query: 30  QSLKNIDSRSSLNSSLTQVLSTDTADNDESSSYQNPDYFKNKYQEFGFIFSGMIGQLLSQ 89
           +++++  S    +SSL ++    +  N    SY N         +  FIF     Q ++ 
Sbjct: 40  ETVQDQQSHKVTHSSLIRLQKLQSPTN----SYLN---------DIIFIFLICSSQFITL 86

Query: 90  AGLTQTLSIMNVLAK--ELDSTSSRQ-AWLMSSFPLALGSFILVSGRLGDIYGLKKILLG 146
           A  +Q +  M+ L+   ++  TS+ Q  W+ +SF +  G+FI+++G+L DI   + I + 
Sbjct: 87  ASASQAILQMDSLSVWFKIPPTSTLQLGWVNASFAMTCGAFIILAGKLCDILNPRIIFIS 146

Query: 147 GYIITTVWSIICGLSSYAHNDAFFI-TARAFQGLGLAFALPNMIGLIGTIYR-------- 197
           GY+  ++W++I G +SY   +  F+   R  QG+G A   P+ + L+   Y         
Sbjct: 147 GYVWFSLWTLITGFASYVPKNMIFLYICRGCQGIGGALLFPSALILLNQYYTVPEPSPSQ 206

Query: 198 ------------PG--------------------------CFRKNMIISIIGAMSPXXXX 219
                       P                           C  K++  S+ GA +P    
Sbjct: 207 SQSKSPTTSAPSPSHDIEKNLSSDDDNDGDSSIADDSDIICTSKSIAFSLYGACAPLGIV 266

Query: 220 XXXXXXXXXVKYDKSNWPWSFYAFGLISFVNLIISWYCIPNSIP-----TNIHGLK---- 270
                     +   + WPW++++  +++ +  I+S++ +   IP     +N + LK    
Sbjct: 267 IGGIFSAIFTQL--ATWPWNYWSMSIVTTLLSILSYFYVVVPIPVEKLDSNPNSLKNWKN 324

Query: 271 MDWLGSVLGVFGLIILNFVFNQAPIVGWQSAYIIVLLVLSFCALVIFVVYEVKYAKTPLI 330
            D+LG +LG+  LI+    ++QA +  +++ ++ + L+ S  + +  +++E  Y   P+I
Sbjct: 325 FDFLGVILGISALILFGVSWDQATMYKFKTIHVYLTLLFSLVSFIAMIIWEY-YFNNPII 383

Query: 331 PKAISSNRGMLMILFSLFCGWGSFGIWTFYYFSFELNLRHYSPLWAGSSYFIFVISG--- 387
           P     + G +  L  +F  + SF  W FY +     ++  SP+     +    ++G   
Sbjct: 384 PIR-QIHPGTIKALLVVFFSYISFTQWLFYTWKLFTEVKDNSPILGSVKFIPLSVAGIIS 442

Query: 388 STVAIVCGLTIKKIKPSVLFCCSMMGFLGGNIIFAATPVNQTFFRNMLGCMFLLPLGMDF 447
           +T +I+  L +K++   +        FL  +I+     ++ +++      +  + +G+D 
Sbjct: 443 ATFSIL--LIVKRVPVQIRLLAGASSFLLSHILLLTCKLDSSYWTYQFFSIISISIGLDI 500

Query: 448 SFPASSIILSDSLPMQYQGMAGSLVNTVINYSTSICLGMAGTVE-------MKHNSHGKD 500
           SFP+++++L++ +P + QG+  +LV +V+NY T+I   +A T+        M      K 
Sbjct: 501 SFPSATLLLTNGIPPEIQGICAALVGSVLNYGTAIGPPIAQTIIQYQCESCMSDPHDKKA 560

Query: 501 LLNGYRAAIYFAIGLAGLAVCVS-GGYMIECLWKDR 535
            L G   A    +G +G+AV +   G + E  WK +
Sbjct: 561 FLKGIHIAGAVGVGCSGIAVLIGIYGTITEYSWKTK 596

>Kpol_358.4 s358 complement(9458..11311) [1854 bp, 617 aa] {ON}
           complement(9458..11311) [1854 nt, 618 aa]
          Length = 617

 Score = 58.9 bits (141), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 46/148 (31%), Positives = 82/148 (55%), Gaps = 8/148 (5%)

Query: 270 KMDWLGSVL--GVFGLIILNFVFNQAPIVGWQSAYIIVLLVLSFC-ALVIFVVYEVKYAK 326
           K+D++G +L    FG I++ F         W++A+IIV  V+ +C AL IF+++E+K++K
Sbjct: 286 KLDFIGLLLLCATFGCILVPFTLAGGLQDKWKTAHIIVPEVIGWCVALPIFLLWEIKFSK 345

Query: 327 TPLIPKAISSNRGM---LMILFSLFCGWGSFGIWTFYYFSFELNLRHYSPLWAGSSY-FI 382
            PL P A+  +RG+   L+I F +   W   G + +      +N    S     S Y F+
Sbjct: 346 VPLTPWALIKDRGIFFALVIAFHINFIWYMQGDYMYTVLIVSVNESIKSATRITSLYSFV 405

Query: 383 FVISGSTVAIVCGLTIKKIKPSVLFCCS 410
            VI+G+ + +V  + +++ KP ++F  S
Sbjct: 406 SVITGTLLGLVI-IKVRRTKPFIIFGVS 432

>KLLA0C18931g Chr3 (1680133..1681794) [1662 bp, 553 aa] {ON}
           uniprot|Q874B4 Kluyveromyces lactis KLLA0C18931g Drug
           efflux permease KNQ1
          Length = 553

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 104/482 (21%), Positives = 193/482 (40%), Gaps = 66/482 (13%)

Query: 87  LSQAGLTQTLSIMNVLAKELDSTSSRQAWLMSSFPLALGSFILVSGRLGDIYGLKKILLG 146
           L  A +   + ++  +    + + ++  W ++S+ +    FI   GR+GDI G   ++  
Sbjct: 34  LDLASVGAMIVLVTDIETRFNVSHTQSGWALTSYVITFAGFIAFFGRVGDIVGNGIMMCV 93

Query: 147 GYIITTVWSIICGLSSYAHNDAFFITARAFQGLGLAFALPNMIGLIGTIYRPGCFRK--N 204
             +I  ++S++C +     N   F   RAFQG+  A  +P    L+  +++    ++  +
Sbjct: 94  FSVIFGIFSLLCAV---VPNFIAFTVFRAFQGMAGAGIVPCAYALVNKMFQGPNLQRYFS 150

Query: 205 MIISIIGAMSPXXXXXXXXXXXXXVKYDKSNWPWSFYA--------FGLISFVNLIISWY 256
           ++ S+I AM+              + Y KS + + F A          LI +  L+++ +
Sbjct: 151 ILSSVISAMAGVGFIIGGAFGETALGY-KSFFYFLFAASLATAAVICVLIGYPELLLNRH 209

Query: 257 CIPNSIPTNIHGLKMDWLGSVLGVFGLIILNFVFNQAPIVGWQSAYIIVLLVLSFCALVI 316
                        K+D +G +L + G I+L     Q     W      V L +S   L+I
Sbjct: 210 SYKEKFQ---RVYKLDVIGCLLFISGSILLVVGLTQGG-ESWNDPTAYVPLAVSIVLLII 265

Query: 317 FVVYEVKYAKTPLIPKAISSNRG-----------------------MLMILFSLFCGWGS 353
           F ++ + YA    + K IS+++G                       +L+  F LFCG+  
Sbjct: 266 FFMWNLGYAVVLKLIKPISTHKGYAYMESVNLLIPKNLMFSHNFIPVLLATFFLFCGF-- 323

Query: 354 FGIWTFYYFSFELNLRHYSPLWAGSSYFIFVISGSTVAIVCGLTIKK---------IKP- 403
             +   Y       + +YS    G+S  + V S   + ++ GL +            KP 
Sbjct: 324 --MVVMYV------IANYSATVEGNS--MIVASIKIIPMISGLVLANGTVAYKQDLFKPK 373

Query: 404 SVLFCCSMMGFLGGNIIFAATPVNQTFFRNM--LGCMFLLPLGMDFSFPASSIILSDSLP 461
           + L   S +  LGG        V+   F  +  +G  F   LG  F F     +     P
Sbjct: 374 NALVVGSFISILGGAFFVPIKYVDDNLFWKLFFMGG-FFTGLGGAFFFCYMITMAIGDAP 432

Query: 462 MQYQGMAGSLVNTVINYSTSICLGMAGTVEMKHNSHGKDLLNGYRAAIYFAIGLAGLAVC 521
            QY+ +AG +V T   +   + L +  ++     +   DL + ++ A Y  I  A ++  
Sbjct: 433 DQYKALAGGIVQTSGQFGNEVSLSIVISLLGNQTTDKADLRDRFQNASYIVITAATISTL 492

Query: 522 VS 523
           VS
Sbjct: 493 VS 494

>Smik_13.272 Chr13 complement(427283..428968) [1686 bp, 561 aa] {ON}
           YMR088C (REAL)
          Length = 561

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 40/107 (37%), Positives = 57/107 (53%), Gaps = 4/107 (3%)

Query: 74  EFGFIFSGMIGQLLSQAGLTQTLSIMNVLAKELDSTSSRQAWLMSSFPLALGSFILVSGR 133
           +F  +FS  +G  LS    T   +IMN +A+E  S SSR+ W+ +SF L   +F  + G+
Sbjct: 35  KFPILFSLWLGSFLSSLDGTIVANIMNRVAEEF-SESSRKQWIATSFLLTNTAFQPLYGK 93

Query: 134 LGDIYGLKKILLGGYIITTVWSIICGLSSYAHNDAFFITARAFQGLG 180
           L DI G K  LL  +     + I C L+ +A N   F  ARA  G+G
Sbjct: 94  LSDITGRKSALLTAHFF---FGIGCLLTCFARNVTEFSIARAICGIG 137

>Smik_6.24 Chr6 (39520..41154) [1635 bp, 544 aa] {ON} YMR279C (REAL)
          Length = 544

 Score = 54.3 bits (129), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 107/518 (20%), Positives = 188/518 (36%), Gaps = 50/518 (9%)

Query: 69  KNKYQ---EFGFIFSGMIGQLLSQAGLTQTLSIMNVLAKELDSTSSRQAWLMSSFPLALG 125
           K+ YQ     G IF G    LL+ A +   +S+++ LAK+ + + +  +W ++S+ +   
Sbjct: 22  KSPYQLNVNVGLIFLGCTFDLLNVASM---ISLIDDLAKKYNISYTTASWSLTSYAVTFA 78

Query: 126 SFILVSGRLGDIYGLKKILLGGYIITTVWSIICGLSSYAHNDAFFITARAFQGLGLAFAL 185
            FI   GRLGDI G   +     I  + ++I+  L +   N   F   RA QG+  A  +
Sbjct: 79  GFIACMGRLGDIVGNSVLFT---ISCSCFAILSLLCAVMPNFPAFAVFRAIQGICAAGLV 135

Query: 186 PNMIGLIGTIYRPGCFRKNMIISIIGAMSPXXXXXXXXXXXXXVKYD-KSNWPWSFYAFG 244
           P    LI  +      +K   I   G  S               K   +  +  +F    
Sbjct: 136 PCAYALIPILAPKEKVQKYFSIVSCGFSSTIGLGLIIGGAFAATKIGYRGIFYLTFAVMS 195

Query: 245 LISFVNLIISWYC-----IPNSIPTNIHGLKMDWLGSVLGVFGLIILNFVFNQAPIVGWQ 299
           LIS +    ++        P  I        +D++GS++ V G I++     +     W 
Sbjct: 196 LISVIAFFFTYNVENFDKKPQKIQAQTSVKSLDFIGSLIFVAGSILIVVGLTEGG-ESWN 254

Query: 300 SAYIIVLLVLSFCALVIFVVYEVKYAKTP-------------------LIPKAISSNRGM 340
                V L++       F V+   YAK                     LIP  +   +  
Sbjct: 255 RPVTYVTLIIGILLFFGFFVWNCTYAKIVRGIRFVGIDTSKYFEKVQLLIPVDVLFMKNF 314

Query: 341 LMILFSLFCGWGSFGIWTFYYFSFELNLRHYSPLWAGSSYFIFVISGSTVAIVCGLTIKK 400
           + I+ +            +    +       SPL AG      +I       +C     K
Sbjct: 315 IPIVLAFALNNACLFSCLYIIDQYSQYAEKDSPLLAGVKLVPLIICMVVGNALCAFESTK 374

Query: 401 IKPSVLFCCSMMGFLGGNIIFAATPV--NQTFFRNMLGCMFLLPLGMDFSFPASSIILSD 458
           +KP V         L G+II     +  +  F++       L+  G+   +P +  I   
Sbjct: 375 LKPRVGVALGFSLALAGSIILIQLHLIKDNVFWKIFFSSQALVGFGVAIFYPYALQIAVG 434

Query: 459 SLPMQYQGMAGSLVNTVINYSTSICLGMAGTV-----EMKHNSHG-KDLLNGYRAAIYFA 512
             P Q +G+A  +  T       I   +  +V     EMK      ++   G++   YF 
Sbjct: 435 GAPDQSKGIASGVAQTFGQLGIEITFSVMASVLGDINEMKGKEDAIQNFRTGFQNCSYFT 494

Query: 513 IGLAGLAVCVSGGYMIECLWKDRVLSLEENKQTDIESS 550
           + +  L      G+++  +   R +    +  +D+ESS
Sbjct: 495 VAVGAL------GFLVTAICI-RDIHTPNDDISDLESS 525

>SAKL0C12122g Chr3 (1086281..1088116) [1836 bp, 611 aa] {ON} similar
           to uniprot|P39980 Saccharomyces cerevisiae YEL065W SIT1
           Ferrioxamine B transporter member of the ARN family of
           transporters that specifically recognize
           siderophore-iron chelates transcription is induced
           during iron deprivation and diauxic shift potentially
           phosphorylated by Cdc28p
          Length = 611

 Score = 53.9 bits (128), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 45/141 (31%), Positives = 74/141 (52%), Gaps = 8/141 (5%)

Query: 281 FGLIILNFVFNQAPIVGWQSAYIIVLLVLSFC-ALVIFVVYEVKYAKTPLIPKAISSNRG 339
           FGL+++ F         W+SA IIV  VL +C AL +F+++E KYA+ PL P  +  +RG
Sbjct: 276 FGLVLIPFTLAGGLQTKWKSASIIVPEVLGWCLALPLFLLWEGKYARNPLTPWDLIKDRG 335

Query: 340 M---LMILFSLFCGWGSFGIWTFYYFSFELNLRHYSPLWAGSSY-FIFVISGSTVAIVCG 395
           +   L+I F +   W   G + +      ++    S     S Y F+ VI+G+ +  V  
Sbjct: 336 IFSALIIAFLINFIWYMQGDYMYTVLIVAVHESIKSATRIVSLYSFVSVITGTLLGFVI- 394

Query: 396 LTIKKIKPSVLF--CCSMMGF 414
           + +++ KP +LF  CC  + F
Sbjct: 395 VKVRRTKPFILFGVCCWFLSF 415

>Skud_13.244 Chr13 complement(417271..418959) [1689 bp, 562 aa] {ON}
           YMR088C (REAL)
          Length = 562

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 42/118 (35%), Positives = 59/118 (50%), Gaps = 11/118 (9%)

Query: 70  NKYQE-------FGFIFSGMIGQLLSQAGLTQTLSIMNVLAKELDSTSSRQAWLMSSFPL 122
            KY E       F  +FS  +G  LS    T   +IMN +A++  S SSR+ W+ +SF L
Sbjct: 24  QKYHEYNLALPKFPILFSLWLGSFLSSLDSTIVANIMNRVAEDF-SESSRKQWIATSFLL 82

Query: 123 ALGSFILVSGRLGDIYGLKKILLGGYIITTVWSIICGLSSYAHNDAFFITARAFQGLG 180
              +F  + G+L DI G K  LL   I    + + C L+ +A N   F  ARA  G+G
Sbjct: 83  TNTAFQPLYGKLSDITGRKSALL---IAQFFFGLGCLLTCFARNVTEFSIARAICGIG 137

>YMR088C Chr13 complement(443414..445102) [1689 bp, 562 aa] {ON}
           VBA1Permease of basic amino acids in the vacuolar
           membrane
          Length = 562

 Score = 51.6 bits (122), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 38/107 (35%), Positives = 56/107 (52%), Gaps = 4/107 (3%)

Query: 74  EFGFIFSGMIGQLLSQAGLTQTLSIMNVLAKELDSTSSRQAWLMSSFPLALGSFILVSGR 133
           +F  +FS  +G  LS    T   +IMN +A+E  S SS++ W+ +SF L   +F  + G+
Sbjct: 35  KFPILFSLWLGSFLSSLDSTIVANIMNRVAEEF-SESSKKQWIATSFLLTNTAFQPLYGK 93

Query: 134 LGDIYGLKKILLGGYIITTVWSIICGLSSYAHNDAFFITARAFQGLG 180
           L DI G K  LL        + + C L+ +A N   F  ARA  G+G
Sbjct: 94  LSDITGRKSALLTAQFF---FGLGCLLTCFARNVTEFSIARAICGIG 137

>TPHA0M00120 Chr13 (23458..25317) [1860 bp, 619 aa] {ON} 
          Length = 619

 Score = 51.2 bits (121), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 41/146 (28%), Positives = 79/146 (54%), Gaps = 10/146 (6%)

Query: 270 KMDWLGSVL--GVFGLIILNFVFNQAPIVGWQSAYIIVLLVLSFC-ALVIFVVYEVKYAK 326
           ++D++G ++    FG I++ F         WQ+A+IIV  V+ +C AL +F+++E+K+++
Sbjct: 282 RLDFIGLLMLCVTFGCILIPFTLAGGLQSEWQTAHIIVPEVIGWCLALPLFLLWEIKFSR 341

Query: 327 TPLIPKAISSNRGMLMILFSL----FCGWGSFGIWTFYYFSFELNLRHYSPLWAGSSY-F 381
            PL P A+  +RG++  +F      FC W   G + +      ++    S     S Y F
Sbjct: 342 HPLTPWALIKDRGIIFAIFIAFHINFC-WYMQGDYMYTVLIVSVHESVKSATRITSLYSF 400

Query: 382 IFVISGSTVAIVCGLTIKKIKPSVLF 407
           + VI+G+ + +     I++ KP ++F
Sbjct: 401 VSVITGTILGMFI-TKIRRTKPFIVF 425

>Suva_13.265 Chr13 complement(424929..426614) [1686 bp, 561 aa] {ON}
           YMR088C (REAL)
          Length = 561

 Score = 50.4 bits (119), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 39/119 (32%), Positives = 59/119 (49%), Gaps = 11/119 (9%)

Query: 69  KNKYQE-------FGFIFSGMIGQLLSQAGLTQTLSIMNVLAKELDSTSSRQAWLMSSFP 121
           + KY E       F  +FS  +G  LS    T   +IMN +A+E  S SS++ W+ +SF 
Sbjct: 23  EQKYHEYNLALPKFPILFSLWLGSFLSSLDSTIVANIMNRVAEEF-SESSKKQWIATSFL 81

Query: 122 LALGSFILVSGRLGDIYGLKKILLGGYIITTVWSIICGLSSYAHNDAFFITARAFQGLG 180
           L   +F  + G+L DI G +  LL        + + C ++ +A N   F  ARA  G+G
Sbjct: 82  LTNTAFQPLYGKLSDIIGRRPALLTAQFF---FGLGCLMTCFARNVTEFSIARAVCGIG 137

>Skud_6.16 Chr6 (26284..27933) [1650 bp, 549 aa] {ON} YOR378W (REAL)
          Length = 549

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 105/518 (20%), Positives = 186/518 (35%), Gaps = 50/518 (9%)

Query: 69  KNKYQ---EFGFIFSGMIGQLLSQAGLTQTLSIMNVLAKELDSTSSRQAWLMSSFPLALG 125
           K++YQ     G IF G    LL+ A +   +S+++ LAK  + + +  +W ++S+ +   
Sbjct: 22  KSRYQLNVNVGLIFLGCTFDLLNVASM---ISLIDDLAKTYNISYTTASWSLTSYAVTFA 78

Query: 126 SFILVSGRLGDIYGLKKILLGGYIITTVWSIICGLSSYAHNDAFFITARAFQGLGLAFAL 185
            FI   GRLGDI G   +         V S++C +     N   F   RA QG+  A  +
Sbjct: 79  GFIACMGRLGDIIGNSVLFTISCSCFAVLSLLCAV---MPNFPAFAVFRAIQGICAAGLV 135

Query: 186 PNMIGLIGTIYRPGCFRKNMIISIIGAMSPXXXXXXXXXXXXXVKYD-KSNWPWSFYAFG 244
           P    LI  +      +K   I   G  S               K   +  +  +F    
Sbjct: 136 PCAYALIPILAPKEKVQKYFSIVSCGFSSTIGLGLIIGGAFATTKIGYRGIFYLTFAVMT 195

Query: 245 LISFVNLIISWYC-----IPNSIPTNIHGLKMDWLGSVLGVFGLIILNFVFNQAPIVGWQ 299
           LIS +    ++        P     +     +D++GS++ V G I++     +     W 
Sbjct: 196 LISIIAFFFTYGVEKLNKKPQKDQASTSVKSLDFIGSLIFVAGSILIVVGLTEGG-ESWN 254

Query: 300 SAYIIVLLVLSFCALVIFVVYEVKYAKTP-------------------LIPKAISSNRGM 340
                V LV+       F V+   Y K                     LIP  +   +  
Sbjct: 255 RPVTYVTLVIGIILFFGFFVWNCTYTKIVRGFKYCGIDTSKYFEKVQLLIPIDVLFMKNF 314

Query: 341 LMILFSLFCGWGSFGIWTFYYFSFELNLRHYSPLWAGSSYFIFVISGSTVAIVCGLTIKK 400
           + I+ +            +    +       SPL AG      +I       +C     K
Sbjct: 315 IPIVLAFALNNACLFSCLYIIDQYSQYAERNSPLLAGVKLVPLIICMVIGNALCAFESTK 374

Query: 401 IKPSVLFCCSMMGFLGGNIIFAATPV--NQTFFRNMLGCMFLLPLGMDFSFPASSIILSD 458
           ++P V         L G+II     +     F++       L+  G+   +P +  I   
Sbjct: 375 LRPRVGVAIGFFLALAGSIILIQLHLVKEDLFWKIFFSAQALVGFGVAIFYPYALQIAVG 434

Query: 459 SLPMQYQGMAGSLVNTVINYSTSICLGMAGTV-----EMKHNSHG-KDLLNGYRAAIYFA 512
             P + +G+A  +  T       I   +  +V     EMK  S+  +    G++   YF 
Sbjct: 435 GAPDESRGIASGVAQTFGQLGIEITFSVMASVLGNINEMKGKSNAIQKFRTGFQNCSYFT 494

Query: 513 IGLAGLAVCVSGGYMIECLWKDRVLSLEENKQTDIESS 550
           + +  L      G+++  +    +  L ++  +D+ESS
Sbjct: 495 VAVGAL------GFLVTAICIRDIPPLNDD-MSDLESS 525

>Suva_5.2 Chr5 (3340..5223) [1884 bp, 627 aa] {ON} YEL065W (REAL)
          Length = 627

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 43/149 (28%), Positives = 80/149 (53%), Gaps = 10/149 (6%)

Query: 270 KMDWLGSVL--GVFGLIILNFVFNQAPIVGWQSAYIIVLLVLSFC-ALVIFVVYEVKYAK 326
           K+D +G +L    FG +++ F         W++A+IIV  V+ +  AL +++V+EVKY++
Sbjct: 282 KLDLIGLLLVTAFFGCVLVPFTLAGGLKEEWKAAHIIVPEVIGWVVALPLYMVWEVKYSR 341

Query: 327 TPLIPKAISSNRGMLMILFSLF---CGWGSFG--IWTFYYFSFELNLRHYSPLWAGSSYF 381
            PL P  +  +RG+L  LF  F     W   G  ++T    +   +++  + + A  S F
Sbjct: 342 HPLTPWDLIKDRGVLFALFIAFFINFNWYMQGDYMYTVLVVAVHESIKSATRITALYS-F 400

Query: 382 IFVISGSTVAIVCGLTIKKIKPSVLFCCS 410
           + VI G+ +  +  + +++ KP +LF  S
Sbjct: 401 VSVIVGTILGFIL-IKVRRTKPFILFGIS 428

>NCAS0A07810 Chr1 complement(1554541..1556247) [1707 bp, 568 aa]
           {ON} Anc_2.473
          Length = 568

 Score = 48.5 bits (114), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 38/139 (27%), Positives = 66/139 (47%), Gaps = 4/139 (2%)

Query: 42  NSSLTQVLSTDTADNDESSSYQNPDYFKNKYQEFGFIFSGMIGQLLSQAGLTQTLSIMNV 101
            SSL  + S+     +++   +    +     +F  + S  +G  LS    T   +IMN 
Sbjct: 7   TSSLLPIRSSIEDGEEDNGLEEQYHEYNLSLPKFPILLSLWLGSFLSSLDSTIVANIMNK 66

Query: 102 LAKELDSTSSRQAWLMSSFPLALGSFILVSGRLGDIYGLKKILLGGYIITTVWSIICGLS 161
           +A+E + +  +Q W+ +SF L   +F  + G+L DI G K  +L  +     + + C L+
Sbjct: 67  VAEEFEESDKKQ-WIATSFLLTNTAFQPLYGKLSDITGRKFAVLTSHFF---FGLGCFLT 122

Query: 162 SYAHNDAFFITARAFQGLG 180
            +A N   F  ARA  G+G
Sbjct: 123 CFAQNITQFSIARAICGIG 141

>KLTH0G09504g Chr7 complement(792202..794076) [1875 bp, 624 aa] {ON}
           similar to uniprot|P39980 Saccharomyces cerevisiae
           YEL065W SIT1 Ferrioxamine B transporter member of the
           ARN family of transporters that specifically recognize
           siderophore-iron chelates transcription is induced
           during iron deprivation and diauxic shift potentially
           phosphorylated by Cdc28p
          Length = 624

 Score = 48.5 bits (114), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 27/82 (32%), Positives = 49/82 (59%), Gaps = 3/82 (3%)

Query: 270 KMDWLGSVL--GVFGLIILNFVFNQAPIVGWQSAYIIVLLVLSFC-ALVIFVVYEVKYAK 326
           ++D +G +L  G  G +++ F         W++A IIV  V+ +C AL +FV++E K+A+
Sbjct: 267 RLDSVGLILVVGALGCVLVPFTLAGGLSDKWRTAQIIVPEVIGWCVALPLFVLWEAKFAR 326

Query: 327 TPLIPKAISSNRGMLMILFSLF 348
            PL P+++  +RG++  L   F
Sbjct: 327 FPLTPRSVLKDRGVIAALVIAF 348

>Kwal_23.5241 s23 (1071768..1073543) [1776 bp, 591 aa] {ON} YEL065W
           (SIT1) - Ferrioxamine B permease [contig 8] FULL
          Length = 591

 Score = 48.1 bits (113), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 50/80 (62%), Gaps = 3/80 (3%)

Query: 264 TNIHGLKMDWLGSVLG--VFGLIILNFVFNQAPIVGWQSAYIIVLLVLSFC-ALVIFVVY 320
           T +   ++D +G ++   VFG I++ F    +    WQ+A IIV  V+ +C AL +F+++
Sbjct: 249 TEVFFWRLDAVGLIMVCVVFGCILIPFTLAGSLKDKWQTAEIIVPEVIGWCVALPLFLLW 308

Query: 321 EVKYAKTPLIPKAISSNRGM 340
           E+K+AK PL+P  +  +RG+
Sbjct: 309 EMKFAKHPLVPWNVIKDRGI 328

>NCAS0D02350 Chr4 (439325..441229) [1905 bp, 634 aa] {ON} 
          Length = 634

 Score = 48.1 bits (113), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 38/145 (26%), Positives = 79/145 (54%), Gaps = 8/145 (5%)

Query: 270 KMDWLGSVLGV--FGLIILNFVFNQAPIVGWQSAYIIVLLVLSFC-ALVIFVVYEVKYAK 326
           ++D +G +L V  FG +++ F         W++A+IIV  V+ +C AL +++++E+K+++
Sbjct: 278 RLDMIGLLLIVCFFGCVLIPFTLAGGMKEQWRTAHIIVPEVIGWCVALPLYILWEIKFSR 337

Query: 327 TPLIPKAISSNRGM---LMILFSLFCGWGSFGIWTFYYFSFELNLRHYSPLWAGSSY-FI 382
            PL P  +  +RG+   L+I F +   W   G + +      ++    +     S Y F+
Sbjct: 338 HPLTPWELLKDRGVYSALIIAFLINFCWYMQGDYMYTVLIVAVHESVKAATRITSLYSFV 397

Query: 383 FVISGSTVAIVCGLTIKKIKPSVLF 407
            VI+G+ + +   + +++ KP +LF
Sbjct: 398 SVITGTILGLFL-VKLRRTKPFILF 421

>SAKL0E02992g Chr5 complement(243652..245364) [1713 bp, 570 aa] {ON}
           similar to uniprot|Q04301 Saccharomyces cerevisiae
           YMR088C VBA1 Permease of basic amino acids in the
           vacuolar membrane
          Length = 570

 Score = 47.4 bits (111), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 45/146 (30%), Positives = 73/146 (50%), Gaps = 11/146 (7%)

Query: 36  DSRSSL--NSSLTQVLSTDTAD--NDESSSYQNPDYFKNKYQ--EFGFIFSGMIGQLLSQ 89
           D R++L  ++   Q LS +  D  N ++SS +  +Y K+     +   +FS  +G  L  
Sbjct: 7   DERTNLLPDTLDPQSLSLNLEDEFNRKNSSLEE-EYHKHNLDLPKLPIVFSLWMGSFLGA 65

Query: 90  AGLTQTLSIMNVLAKELDSTSSRQAWLMSSFPLALGSFILVSGRLGDIYGLKKILLGGYI 149
              T   +IMN +A+E   +  +Q W+ +SF L   +F  + G+L DI G K  LL  + 
Sbjct: 66  LDGTIVANIMNRVAEEFQESDKKQ-WIATSFLLTNTAFQPLYGKLSDITGRKFALLVAH- 123

Query: 150 ITTVWSIICGLSSYAHNDAFFITARA 175
             T + + C L+ +A N   F  ARA
Sbjct: 124 --TFFCLGCLLTCFARNVTEFSIARA 147

>Kpol_416.5 s416 (23208..25031) [1824 bp, 607 aa] {ON}
           (23208..25031) [1824 nt, 608 aa]
          Length = 607

 Score = 47.4 bits (111), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 28/76 (36%), Positives = 44/76 (57%), Gaps = 5/76 (6%)

Query: 279 GVFGLIILNFVFNQAPIVGWQSAYIIVLLVLSFC-ALVIFVVYEVKYAKTPLIPKAISSN 337
            +FG+I++ F         W +A IIV  VL +  AL +F+V+E+K+A+ PL PK    N
Sbjct: 282 AIFGMILIPFTLAGGEEKVWSTARIIVPEVLGWAFALPLFLVWEIKFARYPLTPKDALKN 341

Query: 338 RG----MLMILFSLFC 349
           RG    ++++LF  F 
Sbjct: 342 RGIVSALVLVLFLQFA 357

>Kwal_34.15746 s34 (37757..39313) [1557 bp, 518 aa] {ON} YGR224W
           (AZR1) - MFS-MDR [contig 274] FULL
          Length = 518

 Score = 47.4 bits (111), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 100/487 (20%), Positives = 182/487 (37%), Gaps = 52/487 (10%)

Query: 78  IFSGMIGQLLSQAGLTQTLSIMNVLAKELDSTSSRQAWLMSSFPLALGSFILVSGRLGDI 137
           IF G    LL+ AG+   +S++  L +      +  +W ++S+ +    FI   GRLGDI
Sbjct: 33  IFFGCTFDLLNVAGV---ISVIEDLGETYKLGYTGASWALTSYAITFAGFIAFMGRLGDI 89

Query: 138 YGLKKILLGGYIITTVWSIICGLSSYAHNDAFFITARAFQGLGLAFALPNMIGLIGTIYR 197
            G   +      + T++S++C +     +   F   RA QG+  A  +P    LI  +  
Sbjct: 90  VGNSVLFTISCFLFTLFSLLCAV---VRDFPTFAVFRALQGISAAGIVPCGYALIPLLAE 146

Query: 198 PGCFRKNMIISIIGAMSPXXXXXXXXXXXXXVKYDKSNWPW-------------SFYAFG 244
           P   +K   I   G  S               K   +   +             SFY + 
Sbjct: 147 PQDIQKFFSIVSCGFSSTIGIGLIVGGAFALTKVGYAGIFYLSFAGMLVVSIAASFYTYR 206

Query: 245 LISFVNLIISWYCIPNSIPTNIHGLKMDWLGSVLGVFGLIILNFVFNQAPIVGWQS--AY 302
           +     L +    IP+  P       +D++GS++ V G +++     +     W+   AY
Sbjct: 207 IEERKFLEVKVEDIPHDHP---KVASLDFVGSLIFVSGSVLIVAGLTEGG-ESWRRPVAY 262

Query: 303 I-IVLLVLSFCALVIFVVYEVKYA--------KTP--------LIPKAISSNRGMLMILF 345
           +   + VL FC+  I+  Y  K           TP        L+PK +      + I+ 
Sbjct: 263 VPFSIGVLLFCSFFIWNCYYQKMVSRLKAVGFNTPQYLNNVQVLVPKDVLFMPNFIPIIL 322

Query: 346 SLFCGWGSFGIWTFYYFSFELNLRHYSPLWAGSSYFIFVISGSTVAIVCGLTIKKIKPSV 405
           S  C         +    +   +   SPL AG      ++S       C +   +++P V
Sbjct: 323 SFACNNACLFSVIYIIDQYSQYVEKNSPLIAGVRLIPLIVSMVIGNTTCAIRSLQLRPKV 382

Query: 406 LFCCSMMGFLGGNIIFAA--TPVNQTFFRNMLGCMFLLPLGMDFSFPASSIILSDSLPMQ 463
                 +  L G+II     T  N  F++        + LG    +P +  ++    P  
Sbjct: 383 GVVLGFLFMLCGSIILIQLHTIENGIFWKLFFCSQISVGLGAAIFYPYALKLVVGGAPDG 442

Query: 464 YQGMAGSLVNTVINYSTSI-------CLGMAGTVEMKHNSHGKDLLNGYRAAIYFAIGLA 516
            +G+A  +  T   +   +        LG    V+   NS  +   + ++   YF++ +A
Sbjct: 443 AKGIASGMTQTFAQFGVEVTFSVMVSVLGNITDVKETLNSQ-ETFKDRFQNCAYFSVAVA 501

Query: 517 GLAVCVS 523
            L + ++
Sbjct: 502 ALGLILT 508

>NDAI0I02650 Chr9 (617474..619390) [1917 bp, 638 aa] {ON} 
          Length = 638

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 41/150 (27%), Positives = 83/150 (55%), Gaps = 10/150 (6%)

Query: 270 KMDWLGSVLGV--FGLIILNFVFNQAPIVGWQSAYIIVLLVLSFCA-LVIFVVYEVKYAK 326
           K+D +G +L V  FG +++ F         W++A+IIV  V+ +   L +++++E+K++K
Sbjct: 270 KLDMIGLLLMVCFFGCVLVPFTLAGGMNSEWKTAHIIVPEVIGWVVCLPLYILWEMKFSK 329

Query: 327 TPLIPKAISSNRGML--MILFSL--FCGWGSFGIWTFYYFSFELNLRHYSPLWAGSSY-F 381
            PL P A+  +RG+   +I+ ++  FC W   G + +      ++    S     S Y F
Sbjct: 330 HPLTPWALLKDRGVFSALIIATMINFC-WYMQGDYMYTVLVVAVHESVKSATRITSLYSF 388

Query: 382 IFVISGSTVAIVCGLTIKKIKPSVLFCCSM 411
           + V++G+ + +V  + +++ KP ++F  SM
Sbjct: 389 VSVLTGTGLGLVL-IKVRRTKPFIIFGISM 417

>Kpol_416.6 s416 (26742..28535) [1794 bp, 597 aa] {ON}
           (26742..28535) [1794 nt, 598 aa]
          Length = 597

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 59/239 (24%), Positives = 107/239 (44%), Gaps = 19/239 (7%)

Query: 264 TNIHGLKMDWLGSVLGV--FGLIILNFVFNQAPIVGWQSAYIIVLLVLSFC-ALVIFVVY 320
           T I   K+D++G +L V  FGL+++ F         W++A IIV  VL +  A   F+ +
Sbjct: 269 TEIFLWKLDFIGLLLAVAFFGLVLVPFTLAGGLNKKWKTARIIVPEVLGWVVAFPAFLTW 328

Query: 321 EVKYAKTPLIPKAISSNRGMLMILFSLFCGWGSFGIWTFYYFSFELNLRHYSPLWAG--S 378
           E+K+AK PL P     +RG+   L        +F +   Y ++  L   + +   A   +
Sbjct: 329 EIKFAKYPLTPWKTVKDRGVFSALIIAIFLQTAFYMQKTYMYTILLVAVNQTKKSATRIN 388

Query: 379 SYFIFVISGSTVAIVCGLTIKKIKPSVLFCCSMMGFLGGNIIFAATPVNQTF------FR 432
           S F FV + S    + GL I K++ +  F      F G  + F +  + + +      + 
Sbjct: 389 SLFTFVTALS--GTLLGLVIVKVRRTKEFI-----FFGIAVWFLSFGLLERYTGGTNAYA 441

Query: 433 NMLGCMFLLPLGMDF-SFPASSIILSDSLPMQYQGMAGSLVNTVINYSTSICLGMAGTV 490
            ++  + LL  G  F  +P  + + + +L  +   +  SL   +    TS+   +AG +
Sbjct: 442 GIIAALCLLGFGNGFIKYPTKASMQASALTHEMMAIITSLFMAISTIGTSVGSSVAGAI 500

>TDEL0G04740 Chr7 complement(865319..867124) [1806 bp, 601 aa] {ON} 
          Length = 601

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 42/145 (28%), Positives = 76/145 (52%), Gaps = 8/145 (5%)

Query: 270 KMDWLGSVL--GVFGLIILNFVFNQAPIVGWQSAYIIVLLVLSFC-ALVIFVVYEVKYAK 326
           ++D+ G +L    FG I++ F         W++A IIV  V+ +  AL +++++E KYA+
Sbjct: 263 RLDFPGLILICVTFGCILIPFTLGGGLNEKWKTAGIIVPEVIGWVVALPLYMIWESKYAR 322

Query: 327 TPLIPKAISSNRGM---LMILFSLFCGWGSFGIWTFYYFSFELNLRHYSPLWAGSSY-FI 382
            PL P  +  +RG+   L+I F +   W   G + F      +N  + S     S Y F+
Sbjct: 323 HPLTPWKLIKDRGIFSALIIAFHINFIWYMQGDYMFTVLRVAVNESNSSAQRITSLYSFV 382

Query: 383 FVISGSTVAIVCGLTIKKIKPSVLF 407
            VI+G+ + +V  + +++ K  +LF
Sbjct: 383 SVITGTLLGLVI-VKVRRTKKFILF 406

>Skud_5.24 Chr5 (26839..28722) [1884 bp, 627 aa] {ON} YEL065W (REAL)
          Length = 627

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 40/148 (27%), Positives = 77/148 (52%), Gaps = 8/148 (5%)

Query: 270 KMDWLGSVL--GVFGLIILNFVFNQAPIVGWQSAYIIVLLVLSFC-ALVIFVVYEVKYAK 326
           K+D +G +L    FG +++ F         W++A+IIV  V+ +  AL +++++E+KY++
Sbjct: 282 KLDIIGMLLITAFFGCVLVPFTLAGGLKEEWRTAHIIVPEVIGWVVALPLYMLWEMKYSR 341

Query: 327 TPLIPKAISSNRGM---LMILFSLFCGWGSFGIWTFYYFSFELNLRHYSPLWAGSSY-FI 382
            PL P  +  +RG+   L+I F +   W   G + +      ++    S     S Y F+
Sbjct: 342 HPLTPWDLIKDRGIFFALLIAFFINFNWYMQGDYMYTVLIVAVHESIKSATRITSLYSFV 401

Query: 383 FVISGSTVAIVCGLTIKKIKPSVLFCCS 410
            VI G+ +  +  + +++ KP +LF  S
Sbjct: 402 SVIVGTILGFIL-IKVRRTKPFILFGIS 428

>SAKL0C02178g Chr3 complement(191542..193239) [1698 bp, 565 aa] {ON}
           weakly similar to uniprot|Q04301 Saccharomyces
           cerevisiae YMR088C VBA1 Permease of basic amino acids in
           the vacuolar membrane
          Length = 565

 Score = 44.7 bits (104), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 35/133 (26%), Positives = 69/133 (51%), Gaps = 6/133 (4%)

Query: 50  STDTA--DNDESSSYQNPDYFKNKYQEFGFIFSGMIGQLLSQAGLTQTLSIMNVLAKELD 107
           +T+TA  D  E S+  + +    K +    + + ++G  LS    T   +++  +A +LD
Sbjct: 16  TTETALVDTGEESTTSHSELPPTKVRIT--VLALLMGSFLSALDTTIVATLLPTIASDLD 73

Query: 108 STSSRQAWLMSSFPLALGSFILVSGRLGDIYGLKKILLGGYIITTVWSIICGLSSYAHND 167
           + SS+ +W+ +++ L+  +F  + G+L DI+G K +L+   +   +   ICG S + +N 
Sbjct: 74  A-SSQMSWIATAYLLSCSAFQPLYGKLSDIFGRKILLILSNLTFALGCAICG-SPWTNNV 131

Query: 168 AFFITARAFQGLG 180
               T R   G+G
Sbjct: 132 WVLSTGRFVAGIG 144

>Kwal_23.4853 s23 complement(895045..896856) [1812 bp, 603 aa] {ON}
           YEL065W (SIT1) - Ferrioxamine B permease [contig 5] FULL
          Length = 603

 Score = 44.7 bits (104), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 45/75 (60%), Gaps = 3/75 (4%)

Query: 270 KMDWLGSVLGVFGL--IILNFVFNQAPIVGWQSAYIIVLLVLSFC-ALVIFVVYEVKYAK 326
           ++D LG +L   GL  +++ F         W+SA+IIV  V+ +C A  +FV++E KYA+
Sbjct: 258 RLDILGLILITAGLGCVLIPFTLAGGLSDKWKSAHIIVPEVIGWCVAFPLFVLWEKKYAR 317

Query: 327 TPLIPKAISSNRGML 341
            PL P  +  +RG++
Sbjct: 318 HPLTPWRLLKDRGVI 332

>KLLA0F13684g Chr6 complement(1267367..1269082) [1716 bp, 571 aa]
           {ON} similar to uniprot|Q04301 Saccharomyces cerevisiae
           YMR088C VBA1 Permease of basic amino acids in the
           vacuolar membrane
          Length = 571

 Score = 44.3 bits (103), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 35/138 (25%), Positives = 64/138 (46%), Gaps = 11/138 (7%)

Query: 50  STDTADNDESSSYQNPDYFKNKYQEFGF-------IFSGMIGQLLSQAGLTQTLSIMNVL 102
           +T    N  +SS  + D  +  Y            ++S  +G  L     T   +IMN +
Sbjct: 8   TTRLLSNRITSSSADEDDLEEMYHRHNLALPKGPILYSLWMGSFLGSLDSTIVANIMNKV 67

Query: 103 AKELDSTSSRQAWLMSSFPLALGSFILVSGRLGDIYGLKKILLGGYIITTVWSIICGLSS 162
           A+E + +  +Q W+++SF L   +F  + G+L D+ G K  L+  +   + + + C  ++
Sbjct: 68  AEEFEESDKKQ-WIVTSFLLTNTAFQPLYGKLSDLAGRKTALMVAH---SFFLVGCLFTA 123

Query: 163 YAHNDAFFITARAFQGLG 180
            + N   F  ARA  G+G
Sbjct: 124 LSRNLVEFSIARAVCGMG 141

>KLTH0A01562g Chr1 complement(138389..140236) [1848 bp, 615 aa] {ON}
           similar to uniprot|P39980 Saccharomyces cerevisiae
           YEL065W SIT1 Ferrioxamine B transporter member of the
           ARN family of transporters that specifically recognize
           siderophore-iron chelates transcription is induced
           during iron deprivation and diauxic shift potentially
           phosphorylated by Cdc28p
          Length = 615

 Score = 44.3 bits (103), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 40/62 (64%), Gaps = 1/62 (1%)

Query: 280 VFGLIILNFVFNQAPIVGWQSAYIIVLLVLSFC-ALVIFVVYEVKYAKTPLIPKAISSNR 338
           VFG I++ F    +    W+ A IIV  V+ +C AL +F+++E KY++ PL+P ++  +R
Sbjct: 287 VFGCILVPFTLAGSLQSKWKRAEIIVPEVIGWCVALPLFLLWEGKYSRHPLVPWSLVKDR 346

Query: 339 GM 340
           G+
Sbjct: 347 GI 348

>SAKL0F00440g Chr6 complement(36452..38086) [1635 bp, 544 aa] {ON}
           conserved hypothetical protein
          Length = 544

 Score = 43.9 bits (102), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 88/420 (20%), Positives = 157/420 (37%), Gaps = 47/420 (11%)

Query: 90  AGLTQTLSIMNVLAKELDSTSSRQAWLMSSFPLALGSFILVSGRLGDIYGLKKILLGGYI 149
           A L+ T  I N    E  + S    W ++++ +    FI   GR+GDI G   + +    
Sbjct: 43  AVLSATRDIENTYQIEFTTAS----WALTAYAITFAGFIAFLGRVGDIIGNSVLFVSSCF 98

Query: 150 ITTVWSIICGLSSYAHNDAFFITARAFQGLGLAFALPNMIGLIGTIYRPGCFRKNMIISI 209
           + ++ S+IC +    +N   F   RA QG+  A  +P+   LI T+      +    I  
Sbjct: 99  LFSILSLICAV---VNNFGTFAVFRALQGIAAAGIVPSGYALIPTLSDEHEVQSFFAIVS 155

Query: 210 IGAMSPXXXXXXXXXXXXXVKYDKSNWPWSFYAFGLISFVNLIISWY----------CIP 259
            G  +               +     +   FY    +  V  IIS++          C  
Sbjct: 156 CGFSTSFGIGFIIGGAFTLTRI---GYKGIFYLTFAVMLVISIISYFSIGTSANQKPCTK 212

Query: 260 NSIPTNI--HGLKMDWLGSVLGVFGLIILNFVFNQAPIVGWQSAYIIVLLVLSFCALVIF 317
           +S  T      L +D++GS + +   I++     +     W+     V L++     V+F
Sbjct: 213 DSPKTTKWSDALSLDFIGSFMFISSTILIVVGLTEGG-ESWKKPSAYVTLIVGIALFVLF 271

Query: 318 VVYEVKY---------AKTP-----------LIPKAISSNRGMLMILFSLFCGWGSFGIW 357
            ++ + Y         A  P           LIPK +   +  + I  ++F  +G     
Sbjct: 272 FIWNICYGVLVKNLKSASNPKVYNYFRTIQVLIPKDVLMMKNFIPITVAVFANYGCLFSN 331

Query: 358 TFYYFSFELNLRHYSPLWAGSSYFIFVISGSTVAIVCGLTIKKIKP--SVLFCCSMMGFL 415
            +    +   +   SPL A       V+S     +V  +    I P  +V+    +M F+
Sbjct: 332 LYIVNQYCQYVSKNSPLLAAVKLLPLVVSMLIPNVVIAIKSDLISPRKAVVLGFFIM-FI 390

Query: 416 GGNIIFAATPVNQTFFRNMLGC-MFLLPLGMDFSFPASSIILSDSLPMQYQGMAGSLVNT 474
           G  I+     +    +  +  C   L+  G    FP S  IL    P +Y+G+A  ++ T
Sbjct: 391 GSIILIQLHLITDNLYWKIFFCSQSLIAFGAAIFFPYSLNILIGFAPDEYKGIASGVMQT 450

>KLTH0H16214g Chr8 complement(1398230..1399885) [1656 bp, 551 aa]
           {ON} conserved hypothetical protein
          Length = 551

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 38/133 (28%), Positives = 60/133 (45%), Gaps = 11/133 (8%)

Query: 70  NKYQ---EFGFIFSGMIGQLLSQAGLTQTLSIMNVLAKELDSTSSRQAWLMSSFPLALGS 126
           +KYQ       IF G    LL+ AG+   +S++  L +      +  +W ++S+ +    
Sbjct: 26  SKYQLIINMALIFLGCTFDLLNVAGV---ISVIEDLGETYGLEYTTASWALTSYAITFAG 82

Query: 127 FILVSGRLGDIYGLKKIL-LGGYIITTVWSIICGLSSYAHNDAFFITARAFQGLGLAFAL 185
            I   GRLGDI G   +  + G+     +S+ C L +   N   F   RA QG+  A  +
Sbjct: 83  LIAFMGRLGDIIGNSVLFTISGFF----FSLFCLLCAVVTNFPAFAVLRALQGIAAAGLV 138

Query: 186 PNMIGLIGTIYRP 198
           P    LI T+  P
Sbjct: 139 PCGYALIPTLADP 151

>Kpol_467.24 s467 (55523..56632) [1110 bp, 370 aa] {ON}
           (55523..56632) [1110 nt, 370 aa]
          Length = 370

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 37/128 (28%), Positives = 60/128 (46%), Gaps = 6/128 (4%)

Query: 50  STDTADNDESSSYQNPDYFKNKYQ--EFGFIFSGMIGQLLSQAGLTQTLSIMNVLAKELD 107
           ST    +++     + +Y K      +F  + S  +G  LS    T   +IMN +A+E  
Sbjct: 7   STRLLPDEQHCDALDEEYTKYNLSLPKFPILVSLWLGSFLSSIDSTIVANIMNKVAEEFQ 66

Query: 108 STSSRQAWLMSSFPLALGSFILVSGRLGDIYGLKKILLGGYIITTVWSIICGLSSYAHND 167
            +  +Q W+ +SF L   +F  + G+L DI G K  LL      + + + C L+S + N 
Sbjct: 67  ESQEKQ-WIATSFLLTNTAFQPLYGKLSDITGRKFALLTAL---SFFGLGCFLTSLSTNI 122

Query: 168 AFFITARA 175
             F  ARA
Sbjct: 123 KQFAIARA 130

>Suva_10.11 Chr10 (18934..20556) [1623 bp, 540 aa] {ON} YOR378W
           (REAL)
          Length = 540

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 36/127 (28%), Positives = 59/127 (46%), Gaps = 9/127 (7%)

Query: 69  KNKYQ---EFGFIFSGMIGQLLSQAGLTQTLSIMNVLAKELDSTSSRQAWLMSSFPLALG 125
           K+ YQ       IF G    LL+ A +   +S+++ LA++ D + +  +W ++S+ +   
Sbjct: 22  KSTYQLNVNVALIFLGCTFDLLNVASM---ISLIDDLAQKYDISYTTASWSLTSYAVTFA 78

Query: 126 SFILVSGRLGDIYGLKKILLGGYIITTVWSIICGLSSYAHNDAFFITARAFQGLGLAFAL 185
            FI   GRLGDI G   +         + S++C +     N   F   RA QG+  A  +
Sbjct: 79  GFIAFMGRLGDIVGNSILFTVSCFFFAILSLLCAV---MPNFPAFAVFRAIQGISAAGLV 135

Query: 186 PNMIGLI 192
           P    LI
Sbjct: 136 PCAYALI 142

>NDAI0H02200 Chr8 complement(536385..538100) [1716 bp, 571 aa] {ON} 
           YGR224W
          Length = 571

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 36/120 (30%), Positives = 56/120 (46%), Gaps = 11/120 (9%)

Query: 68  FKNKYQEFGF------IFSGM-IGQLLSQAGLTQTLSIMNVLAKELDSTSSRQAWLMSSF 120
            + KY E         I S + +G   S    T   +IMN +A+E   +  +Q W+ +SF
Sbjct: 29  LEKKYHEHNLSLPKVPILSSLWLGSFFSSLDSTIVANIMNRVAEEFAESDKKQ-WIATSF 87

Query: 121 PLALGSFILVSGRLGDIYGLKKILLGGYIITTVWSIICGLSSYAHNDAFFITARAFQGLG 180
            L   +F  + G+L DI G K  +L  +     + + C L+ +A N   F  ARA  G+G
Sbjct: 88  LLTNTAFQPLYGKLSDITGRKFAVLTAHFF---FGLGCLLTCFAQNVTQFSIARAICGMG 144

>CAGL0J01375g Chr10 (127843..129537) [1695 bp, 564 aa] {ON} similar
           to uniprot|Q04301 Saccharomyces cerevisiae YMR088c
          Length = 564

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 37/140 (26%), Positives = 64/140 (45%), Gaps = 5/140 (3%)

Query: 42  NSSLTQVLSTDTADNDESSSYQNPDYFKN-KYQEFGFIFSGMIGQLLSQAGLTQTLSIMN 100
           N   T  L   T D  E  + +   +  N    +   + S  +G  LS    T   +IMN
Sbjct: 3   NLDETTGLLEQTPDTTEQDALEQEYHEHNLSLPKLPIVLSLWLGSFLSSLDGTIVANIMN 62

Query: 101 VLAKELDSTSSRQAWLMSSFPLALGSFILVSGRLGDIYGLKKILLGGYIITTVWSIICGL 160
            +A+E   +  +Q W+ +S+ L   +F  + G+L D+ G K  +L  +     + + C L
Sbjct: 63  RVAEEFQESDKKQ-WIATSYLLTNTAFQPLYGKLSDLTGRKFAVLTAHFF---FGLGCLL 118

Query: 161 SSYAHNDAFFITARAFQGLG 180
           + +A++   F  ARA  G+G
Sbjct: 119 TCFANSVTQFAIARAICGVG 138

>Smik_5.22 Chr5 (30048..31934) [1887 bp, 628 aa] {ON} YEL065W (REAL)
          Length = 628

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 38/148 (25%), Positives = 77/148 (52%), Gaps = 8/148 (5%)

Query: 270 KMDWLGSVLGV--FGLIILNFVFNQAPIVGWQSAYIIVLLVLSFCALV-IFVVYEVKYAK 326
           K+D +G +L    FG +++ F         W+SA+IIV  V+ +  ++ +++++E+KY++
Sbjct: 282 KLDIIGMLLITVFFGCVLVPFTLAGGLKEEWKSAHIIVPEVIGWVVVLPLYMLWEMKYSR 341

Query: 327 TPLIPKAISSNRGM---LMILFSLFCGWGSFGIWTFYYFSFELNLRHYSPLWAGSSY-FI 382
            PL P  +  +RG+   L+I F +   W   G + +      ++    S     S Y F+
Sbjct: 342 HPLTPWDLIKDRGIFFALLIAFFINFNWYMQGDYMYTVLVVAVHESIKSATRITSLYSFV 401

Query: 383 FVISGSTVAIVCGLTIKKIKPSVLFCCS 410
            VI G+ +  +  + +++ KP ++F  S
Sbjct: 402 SVIVGTILGFIL-IKVRRTKPFIIFGIS 428

>YEL065W Chr5 (27657..29543) [1887 bp, 628 aa] {ON}
           SIT1Ferrioxamine B transporter, member of the ARN family
           of transporters that specifically recognize
           siderophore-iron chelates; transcription is induced
           during iron deprivation and diauxic shift; potentially
           phosphorylated by Cdc28p
          Length = 628

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 37/148 (25%), Positives = 77/148 (52%), Gaps = 8/148 (5%)

Query: 270 KMDWLGSVLGV--FGLIILNFVFNQAPIVGWQSAYIIVLLVLSFCALV-IFVVYEVKYAK 326
           K+D +G +L    FG +++ F         W++A+IIV  V+ +  ++ +++++E+KY++
Sbjct: 282 KLDIIGMLLITVFFGCVLVPFTLAGGLKEEWKTAHIIVPEVIGWVVVLPLYMLWEIKYSR 341

Query: 327 TPLIPKAISSNRGM---LMILFSLFCGWGSFGIWTFYYFSFELNLRHYSPLWAGSSY-FI 382
            PL P  +  +RG+   L+I F +   W   G + +      ++    S     S Y F+
Sbjct: 342 HPLTPWDLIQDRGIFFALLIAFFINFNWYMQGDYMYTVLVVAVHESIKSATRITSLYSFV 401

Query: 383 FVISGSTVAIVCGLTIKKIKPSVLFCCS 410
            VI G+ +  +  + +++ KP ++F  S
Sbjct: 402 SVIVGTILGFIL-IKVRRTKPFIIFGIS 428

>CAGL0E04092g Chr5 (394380..396317) [1938 bp, 645 aa] {ON} similar
           to uniprot|P38731 Saccharomyces cerevisiae YHL040c ARN1
           or uniprot|P38724 Saccharomyces cerevisiae YHL047c TAF1
          Length = 645

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 29/101 (28%), Positives = 46/101 (45%), Gaps = 21/101 (20%)

Query: 267 HGLK-----MDWLGSVLGVF------GLIILNFVFNQAPIVGWQSAYIIVLLVLSFCALV 315
           HGLK     + W    +GVF      G I++           W ++++I   VL F  + 
Sbjct: 293 HGLKDTIVELFWKIDAMGVFIMTISLGCILVPLTLAGGTKSKWNNSHVIGPFVLGFVLIP 352

Query: 316 IFVVYEVKYAKTPLIPKAISSNRGMLMILFSLFCGWGSFGI 356
           I V++E K+A+ P+IP  +  +RG+          W SF I
Sbjct: 353 ILVLWEYKFARDPIIPYKLVKDRGV----------WASFAI 383

>NDAI0A02050 Chr1 complement(456678..458531) [1854 bp, 617 aa] {ON} 
          Length = 617

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 41/150 (27%), Positives = 76/150 (50%), Gaps = 9/150 (6%)

Query: 270 KMDWLGSVLGV--FGLIILNFVFNQAPIVGWQSAYIIVLLVLSF-CALVIFVVYEVKYAK 326
           ++D LG +LGV  F  +++ F         W+SA IIV  V+ +  AL +++ +E K+AK
Sbjct: 271 RLDILGLLLGVIFFACVLIPFTLAAKATDKWKSASIIVPEVIGWLVALPLYIFWEWKFAK 330

Query: 327 TPLIPKAISSNRGML-MILFSLFCGWGSFGIWTFYYFSFELNLRHYSPLWAGSS----YF 381
            PL P  +  +RG+   +L +LF  +  + + + Y ++  L     + L A  +     F
Sbjct: 331 FPLTPWNLVKDRGVYGGLLIALFLDFAYY-VQSTYKYTVLLVSFDTTVLAATRTNNMFTF 389

Query: 382 IFVISGSTVAIVCGLTIKKIKPSVLFCCSM 411
           + VI+ + + I     +++ K  + F  SM
Sbjct: 390 VGVITANLLGIFVAKKLRRTKGFIFFGISM 419

>SAKL0G06600g Chr7 complement(549492..551381) [1890 bp, 629 aa] {ON}
           similar to uniprot|P39980 Saccharomyces cerevisiae
           YEL065W SIT1 Ferrioxamine B transporter member of the
           ARN family of transporters that specifically recognize
           siderophore-iron chelates transcription is induced
           during iron deprivation and diauxic shift potentially
           phosphorylated by Cdc28p
          Length = 629

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 39/73 (53%), Gaps = 2/73 (2%)

Query: 270 KMDWLG--SVLGVFGLIILNFVFNQAPIVGWQSAYIIVLLVLSFCALVIFVVYEVKYAKT 327
           K+D  G  S++ + GLI+            W++A +IV L+L FC + +F  +E + A  
Sbjct: 288 KLDIFGVLSLMIILGLILTPLTLAGGETAEWRTAKVIVPLILGFCWIPVFAFWENRIATH 347

Query: 328 PLIPKAISSNRGM 340
           P+ P  +  +RG+
Sbjct: 348 PIAPTDMFRDRGV 360

>Kpol_513.33 s513 complement(95274..97154) [1881 bp, 626 aa] {ON}
           complement(95274..97154) [1881 nt, 627 aa]
          Length = 626

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 31/100 (31%), Positives = 51/100 (51%), Gaps = 13/100 (13%)

Query: 270 KMDWLGSVLGV--FGLIILNFVFNQAPIVGWQSAYIIVLLVLSFC-ALVIFVVYEVKYAK 326
           K+D LG +L V  F LI++     +    GW SA  IV  VL +  AL +F+ +E+K+A 
Sbjct: 266 KLDMLGLILLVAFFALILVPLTLAKGLHEGWGSAKFIVPEVLGWALALPLFLTWELKFAS 325

Query: 327 TPLIPKAISSNRGMLMILFSLFCGWGSFGIWTFYYFSFEL 366
            P+ P  +  +RG+          +G  G+  F  F +++
Sbjct: 326 NPITPLDLIKDRGI----------YGGIGVSLFLEFVYDI 355

>YKR106W Chr11 (661442..663289) [1848 bp, 615 aa] {ON}
           GEX2Proton:glutathione antiporter localized to the
           vacuolar and plasma membranes; expressed at a very low
           level; almost identical to paralog Gex1p; potential role
           in resistance to oxidative stress and modulation of the
           PKA pathway
          Length = 615

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 39/73 (53%), Gaps = 2/73 (2%)

Query: 270 KMDWLGSVLGV--FGLIILNFVFNQAPIVGWQSAYIIVLLVLSFCALVIFVVYEVKYAKT 327
           K+D +G +L     G I++           W ++ II  LV   C   IF+ +E K+AK+
Sbjct: 273 KLDIVGILLITVSLGCILVPLTLANETSQKWHNSKIIATLVSGGCLFFIFLYWEAKFAKS 332

Query: 328 PLIPKAISSNRGM 340
           PL+P  + S+RG+
Sbjct: 333 PLLPFKLLSDRGI 345

>YCL073C Chr3 complement(6479..8326) [1848 bp, 615 aa] {ON}
           GEX1Proton:glutathione antiporter localized to the
           vacuolar and plasma membranes; imports glutathione from
           the vacuole and exports it through the plasma membrane;
           has a role in resistance to oxidative stress and
           modulation of the PKA pathway
          Length = 615

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 39/73 (53%), Gaps = 2/73 (2%)

Query: 270 KMDWLGSVLGV--FGLIILNFVFNQAPIVGWQSAYIIVLLVLSFCALVIFVVYEVKYAKT 327
           K+D +G +L     G I++           W ++ II  LV   C   IF+ +E K+AK+
Sbjct: 273 KLDIVGILLITVSLGCILVPLTLANETSQKWHNSKIIATLVSGGCLFFIFLYWEAKFAKS 332

Query: 328 PLIPKAISSNRGM 340
           PL+P  + S+RG+
Sbjct: 333 PLLPFKLLSDRGI 345

>Skud_18.6 Chr18 (14597..16429) [1833 bp, 610 aa] {ON} YCL073C
           (REAL)
          Length = 610

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 32/67 (47%), Gaps = 10/67 (14%)

Query: 298 WQSAYIIVLLVLSFCALVIFVVYEVKYAKTPLIPKAISSNRGMLMILFSLFCGWGSFGIW 357
           W S+ II  LV       IFV +E  YAK PL+P  +  +RG+          W   G+ 
Sbjct: 298 WHSSKIIGTLVFGGVLFCIFVFWETAYAKNPLLPFKLLGDRGI----------WAPLGVA 347

Query: 358 TFYYFSF 364
            F YF+F
Sbjct: 348 FFNYFTF 354

>KLTH0B10142g Chr2 complement(847376..849082) [1707 bp, 568 aa] {ON}
           similar to uniprot|P36172 Saccharomyces cerevisiae
           YKR105C Hypothetical ORF
          Length = 568

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 42/169 (24%), Positives = 75/169 (44%), Gaps = 14/169 (8%)

Query: 297 GWQSAYIIVLLVLSFCALVIFVVYEVKYAKT--------PLIPKAISSNRGMLMILFSLF 348
            W S  +I  +++    + I +VY+ K  +         PL+   I SNR +L+  F+ F
Sbjct: 285 AWNSGIVISFIIIGVLLIAISLVYDFKVFEQIKTQDSFRPLLSWEIMSNRSILLSNFTGF 344

Query: 349 CGWGSFGIWTFYYFSFELNLRHYSPLWAGSSYFIFVISGSTVAIVCGLTIKK---IKPSV 405
               ++ +   Y   F   +  +S   AG      ++S    +I  G+  KK   IKP +
Sbjct: 345 FSTVAYNVQMIYSVQFFQLVYGFSAWKAGLHLIPILVSTVVFSIASGILTKKTGHIKPLL 404

Query: 406 LFCCSMMGFLGGNIIFAATPVNQTFFRNMLGCMFLLPLGMDFSFPASSI 454
           +F  S MG LGG ++      N++     +G + L  + + F  P++ I
Sbjct: 405 VF-GSAMGVLGGGLMTLLD--NKSTKHTQIGVLILPGVALGFVLPSALI 450

>TDEL0A02490 Chr1 (446429..448093) [1665 bp, 554 aa] {ON} Anc_2.473
           YMR088C
          Length = 554

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 31/93 (33%), Positives = 46/93 (49%), Gaps = 4/93 (4%)

Query: 83  IGQLLSQAGLTQTLSIMNVLAKELDSTSSRQAWLMSSFPLALGSFILVSGRLGDIYGLKK 142
           +G  +S    T   +IMN +A+E  S S ++ W+ +SF L   +F  + G+L D+ G K 
Sbjct: 43  LGSFVSSLDGTIVANIMNRVAEEF-SESDKKQWIATSFLLTNTAFQPLYGKLSDVTGRKF 101

Query: 143 ILLGGYIITTVWSIICGLSSYAHNDAFFITARA 175
            LL  Y    +    C L+  A N   F  ARA
Sbjct: 102 ALLMAYFFLVIG---CLLTCLARNVTEFAVARA 131

>SAKL0F00792g Chr6 (70444..72297) [1854 bp, 617 aa] {ON} similar to
           uniprot|P38731 Saccharomyces cerevisiae YHL040C ARN1
           Transporter member of the ARN family of transporters
           that specifically recognize siderophore-iron chelates
           responsible for uptake of iron bound to ferrirubin
           ferrirhodin and related siderophores
          Length = 617

 Score = 40.8 bits (94), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 41/78 (52%), Gaps = 6/78 (7%)

Query: 269 LKMDWLGSVLGVF------GLIILNFVFNQAPIVGWQSAYIIVLLVLSFCALVIFVVYEV 322
           +++ W   V+G+F      G I++           WQ++ II  LVL F  + +F+ +E 
Sbjct: 272 VQLFWKLDVVGIFIMTISLGCILVPLTLAGGSSSKWQNSEIIGPLVLGFVLVPVFIYWES 331

Query: 323 KYAKTPLIPKAISSNRGM 340
           K+AK PL P  +  +RG+
Sbjct: 332 KWAKDPLAPFELLKDRGI 349

>KAFR0D00790 Chr4 (168111..169796) [1686 bp, 561 aa] {ON} 
          Length = 561

 Score = 40.0 bits (92), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 53/178 (29%), Positives = 79/178 (44%), Gaps = 30/178 (16%)

Query: 28  EQQSLKNIDSRSSLNSSLTQVLSTDTADN---DESSSYQN------PDYFKNKYQEF--- 75
           EQQS++ +D+  S N S    +S   +DN   DES   Q       P    + Y +F   
Sbjct: 4   EQQSVQELDASVS-NRSQQSTVSNKVSDNEIKDESYDEQAGQEITLPKKPISAYSKFIIL 62

Query: 76  -------GFIF---SGMIGQLLSQAGLTQTLSIMNVLAKELDSTSSRQAWLMSSFPL--A 123
                  GFIF   +G I   ++Q    Q    +N  + E   ++ R+  ++  F +  A
Sbjct: 63  SLCVAFGGFIFGWDTGTISGFVAQTDFLQRFGELNS-SGEYYLSNVREGLIVGIFNIGCA 121

Query: 124 LGSFILVSGRLGDIYGLKKILLGGYIITTVWSIICGLSSYAHNDAFFITARAFQGLGL 181
            G  IL   +LGD+YG K  L    II  V  +IC ++S      +FI  R   GLG+
Sbjct: 122 FGGIIL--SKLGDMYGRKIGLTCVTIIYIVGQVIC-IASVDKWYQYFI-GRIVAGLGV 175

>Smik_21.4 Chr21 (1261..3078) [1818 bp, 605 aa] {ON} YOL158C (REAL)
          Length = 605

 Score = 39.7 bits (91), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 25/35 (71%)

Query: 298 WQSAYIIVLLVLSFCALVIFVVYEVKYAKTPLIPK 332
           W+  YII ++V+  C   IF+++E+++AK P IP+
Sbjct: 306 WREGYIIAMIVVGGCLGFIFLIWELRFAKNPFIPR 340

>KAFR0I01560 Chr9 (328940..330838) [1899 bp, 632 aa] {ON}  YHL040C
          Length = 632

 Score = 39.7 bits (91), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 25/89 (28%), Positives = 42/89 (47%), Gaps = 12/89 (13%)

Query: 270 KMDWLGSVL--GVFGLIILNFVFNQAPIVGWQSAYIIVLLVLSFCALVIFVVYEVKYAKT 327
           K+D +G +L     G I++           W+ + II + VL F  + IF ++E K+A  
Sbjct: 281 KIDIIGVLLMAASLGCILVPLTLAGGTSSKWRDSRIIGVFVLGFVLIPIFFIWEKKFATD 340

Query: 328 PLIPKAISSNRGMLMILFSLFCGWGSFGI 356
           P++P  +  +RG+          W S GI
Sbjct: 341 PIVPYKLVKDRGV----------WASLGI 359

>Skud_2.423 Chr2 (756345..758027) [1683 bp, 560 aa] {ON} YBR293W
           (REAL)
          Length = 560

 Score = 39.7 bits (91), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 63/255 (24%), Positives = 109/255 (42%), Gaps = 26/255 (10%)

Query: 236 WPWSFYAFGLISFVNLIISWYCIPNSIPTNIHG-----------LKMDWLGSVLGVFGLI 284
           W W F     IS ++ ++  Y +PN    N                +D  GS+L + GL 
Sbjct: 206 WRWCFLIQVPISIISSVLMNYYVPNQKEYNHENSNIFRNSKRILTDIDITGSILIITGLT 265

Query: 285 ILNFVFN---QAPIVGWQSAYIIVLLVLSFCALVIFVVYEVKYAKTPLIP-KAISSNRGM 340
           +     +       + W S  +++LLV S   L++F+ +E K     +IP + +SS+   
Sbjct: 266 LQLLYLSLGCSGSKLSWTSPSVLLLLVGSIAILLLFISHEKKTTARAIIPMELVSSSYSF 325

Query: 341 LMILFSLFCGWGSFG-IWTFYYFSFELNLRHYSPLWAGSSYFIFVISGSTVAIVCGLTIK 399
           +++L S+  G+ S+  ++T   F F++ L   S   AG    I  +     +++ G ++ 
Sbjct: 326 VVLLISILVGFASYAYLFTLPLF-FQIVLGD-STAKAGLRLAIPSLFTPVGSLITGFSMS 383

Query: 400 KIK--PSVLFCCSMMGFLGGNIIFAATPVNQTFFRNMLGCMFLLP--LGMDFSFPASSII 455
           K     S+L+    + FL GN +F           N L  +FL+P  LG   +FP +   
Sbjct: 384 KYNCLRSLLYVGVSLMFL-GNFLFLFIEKTSP---NWLISLFLIPANLGQGITFPTTLFT 439

Query: 456 LSDSLPMQYQGMAGS 470
                P   Q  A S
Sbjct: 440 FIFLFPKSDQATATS 454

>SAKL0E04246g Chr5 (336416..338113) [1698 bp, 565 aa] {ON} weakly
           similar to uniprot|Q04301 Saccharomyces cerevisiae
           YMR088C VBA1 Permease of basic amino acids in the
           vacuolar membrane
          Length = 565

 Score = 39.7 bits (91), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 45/77 (58%), Gaps = 1/77 (1%)

Query: 83  IGQLLSQAGLTQTLSIMNVLAKELDSTSSRQAWLMSSFPLALGSFILVSGRLGDIYGLKK 142
           +G  LS    T   +++  +A +LD+ SS+ +W+ +S+ L+  +F  + G+L DI+G K 
Sbjct: 49  LGSFLSALDTTIVSTLLPTIASDLDA-SSQMSWIATSYLLSCSAFQPLYGKLSDIFGRKI 107

Query: 143 ILLGGYIITTVWSIICG 159
           +L+   ++  +   +CG
Sbjct: 108 LLVWSNLVFAIGCALCG 124

>Ecym_7399 Chr7 complement(820280..821971) [1692 bp, 563 aa] {ON}
           similar to Ashbya gossypii ABL040W
          Length = 563

 Score = 39.7 bits (91), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 53/106 (50%), Gaps = 5/106 (4%)

Query: 83  IGQLLSQAGLTQTLSIMNVLAKELDSTSSRQAWLMSSFPLALGSFILVSGRLGDIYGLKK 142
           +   L+    T   +IMN + +E    S R  W+ +SF L    F  + G+L D+ G + 
Sbjct: 55  MANFLASMDRTIIANIMNSVTEEFKE-SHRIQWVATSFLLTSTVFQPIYGKLSDVTGRRF 113

Query: 143 ILLGGYIITTVWSIICGLSSYAHNDAFFITARAFQGLGLAFALPNM 188
           +L+  Y   +++ + C +++YA N   F   RA  G+G A  +P M
Sbjct: 114 VLVLAY---SLFLLGCLVTAYARNIWEFAFGRAICGIG-AGGIPTM 155

>KLLA0F17776g Chr6 complement(1627198..1628859) [1662 bp, 553 aa]
           {ON} weakly similar to uniprot|Q04301 Saccharomyces
           cerevisiae YMR088C VBA1 Permease of basic amino acids in
           the vacuolar membrane
          Length = 553

 Score = 39.3 bits (90), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 46/81 (56%), Gaps = 9/81 (11%)

Query: 78  IFSGMIGQLLSQAGLTQTLSIMNVLAKELDSTSSRQAWLMSSFPLALGSFILVSGRLGDI 137
           +F+  +G  L+    T   +++  +A ELD+ S++ +W+ +S+ L+  +F  + G+L D+
Sbjct: 35  VFALFVGSYLAALDTTIVTTLLPTIASELDA-SNQMSWIATSYLLSCSAFQPLYGKLSDV 93

Query: 138 YGLKKILLGGYIITTVWSIIC 158
           +G K +L        +WS +C
Sbjct: 94  FGRKPLL--------IWSNLC 106

>TDEL0D06610 Chr4 complement(1195341..1196834) [1494 bp, 497 aa]
           {ON}  possible pseudogene; N added at two sites to avoid
           frameshifts
          Length = 497

 Score = 39.3 bits (90), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 24/91 (26%), Positives = 45/91 (49%), Gaps = 3/91 (3%)

Query: 92  LTQTLSIMNVLAKELDSTSSRQAWLMSSFPLALGSFILVSGRLGDIYGLKKILLGGYIIT 151
           ++  +S+++ L+ +   + +  +W ++S+ +    FI   GRLGDI G  ++        
Sbjct: 45  VSSMISLIDELSTKYSISYTTASWSLTSYAVTFAGFIAFMGRLGDIVGNSRLFTVSCGCF 104

Query: 152 TVWSIICGLSSYAHNDAFFITARAFQGLGLA 182
            + S++CGL     N   F   RA QG+  A
Sbjct: 105 AILSLLCGL---MPNFEAFAVMRALQGIAAA 132

>Kwal_34.15711 s34 (21213..23069) [1857 bp, 618 aa] {ON} YHL047C
           (ARN2) - 1:1 [contig 275] FULL
          Length = 618

 Score = 39.3 bits (90), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 39/159 (24%), Positives = 69/159 (43%), Gaps = 14/159 (8%)

Query: 267 HGL-----KMDWLGSVLGVF------GLIILNFVFNQAPIVGWQSAYIIVLLVLSFCALV 315
           HGL     ++ W   V+GV       G I++           W+SA +I   VL F  + 
Sbjct: 271 HGLVQTLKQLFWKLDVVGVLLFSISTGCILVPLTLAGGASTQWRSAKVIAPFVLGFLLVP 330

Query: 316 IFVVYEVKYAKTPLIPKAISSNRGMLMILFSLFCGWGSFGIWTFYYFSFELNLRHYSPLW 375
           +F+ +E K A  PL P  +  +RG+   L   F     + +   Y ++  +   + SPL 
Sbjct: 331 VFIYWESKLALVPLAPFKMLKDRGIWAPLVITFLICYIYMMAAGYLYTILVVAGNESPLS 390

Query: 376 AGSSYFIFVISGSTVAIVCGLTI---KKIKPSVLFCCSM 411
           A     ++    +  + V G+ +    ++KP  +F CS+
Sbjct: 391 ATRITSLYSFVAAVFSPVVGIFVARFTRLKPFAVFGCSL 429

>ZYRO0C01430g Chr3 complement(101140..102912) [1773 bp, 590 aa] {ON}
           weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 590

 Score = 39.3 bits (90), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 45/79 (56%), Gaps = 1/79 (1%)

Query: 83  IGQLLSQAGLTQTLSIMNVLAKELDSTSSRQAWLMSSFPLALGSFILVSGRLGDIYGLKK 142
           +G  L+ A  T   +IM  +A E +    R +W+ +++ L+  +F  + G+L DI+G K 
Sbjct: 87  LGIFLAAADGTLVSTIMAHIASEFNELP-RISWIATAYLLSSATFQPLYGKLSDIFGRKP 145

Query: 143 ILLGGYIITTVWSIICGLS 161
           +L+   I+  V  ++CGL+
Sbjct: 146 LLMLNNIVFLVGCLMCGLT 164

>Kwal_56.22298 s56 (31819..33651) [1833 bp, 610 aa] {ON} YHL040C
           (ARN1) - Product of gene unknown [contig 187] FULL
          Length = 610

 Score = 38.9 bits (89), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 30/51 (58%)

Query: 298 WQSAYIIVLLVLSFCALVIFVVYEVKYAKTPLIPKAISSNRGMLMILFSLF 348
           WQ+  +I   VL F  L IF+++E K+A+ P+IP  +  +R +   L S F
Sbjct: 301 WQNPRVISPFVLGFVLLPIFLIWEKKWARDPIIPYDLIKDRAVWASLNSQF 351

>YOL158C Chr15 complement(19491..21311) [1821 bp, 606 aa] {ON}
           ENB1Endosomal ferric enterobactin transporter, expressed
           under conditions of iron deprivation; member of the
           major facilitator superfamily; expression is regulated
           by Rcs1p and affected by chloroquine treatment
          Length = 606

 Score = 38.9 bits (89), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 29/50 (58%)

Query: 283 LIILNFVFNQAPIVGWQSAYIIVLLVLSFCALVIFVVYEVKYAKTPLIPK 332
           L++L           W+  +II ++V+  C   IF+++E+K+AK P IP+
Sbjct: 292 LVLLPLTIAGGATSKWREGHIIAMIVVGGCLGFIFLIWELKFAKNPFIPR 341

>TPHA0B00180 Chr2 complement(29722..31623) [1902 bp, 633 aa] {ON} 
          Length = 633

 Score = 38.5 bits (88), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 31/87 (35%), Positives = 48/87 (55%), Gaps = 7/87 (8%)

Query: 270 KMDWLGSVL--GVFGLIILNFVFNQAPIVGWQSAYIIVLLVLSFC-ALVIFVVYEVKYAK 326
           K+D++G VL   VF LI++ F  +      W SA  IV  V+ +  AL IF V+E K+++
Sbjct: 286 KLDFIGLVLLVAVFALILVPFTTSGGLHREWNSANFIVPEVVGWVVALPIFSVWEWKFSR 345

Query: 327 TPLIPKAISSNRGMLMIL----FSLFC 349
            P++   + S+RG+   L    F  FC
Sbjct: 346 YPILRLDLISDRGIYSALSISFFIQFC 372

>NCAS0A11500 Chr1 complement(2274436..2276280) [1845 bp, 614 aa]
           {ON} 
          Length = 614

 Score = 38.5 bits (88), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 50/88 (56%), Gaps = 11/88 (12%)

Query: 256 YCIPNSIPTNIHGLKMDWLGSVLGV--FGLIILNFVFNQAPIVGWQSAYIIVLLVLSFC- 312
           YCI      +I   K+D +G +L V  F LI++ F    A  + W+S  IIV  VL +  
Sbjct: 277 YCI------DIFFWKLDIIGLILLVAFFSLILVPFTL--AGSLTWKSPKIIVPEVLGWVL 328

Query: 313 ALVIFVVYEVKYAKTPLIPKAISSNRGM 340
           A+ +++++E+KYA+ PL P     +RG+
Sbjct: 329 AIPLYLIWELKYARYPLTPWNSIKDRGI 356

>ZYRO0G03234g Chr7 (247798..249486) [1689 bp, 562 aa] {ON} similar
           to uniprot|Q04301 Saccharomyces cerevisiae YMR088C VBA1
           Permease of basic amino acids in the vacuolar membrane
          Length = 562

 Score = 38.5 bits (88), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 31/120 (25%), Positives = 54/120 (45%), Gaps = 4/120 (3%)

Query: 56  NDESSSYQNPDYFKNKYQEFGFIFSGMIGQLLSQAGLTQTLSIMNVLAKELDSTSSRQAW 115
            DE S       +     +   + S  +G  +     T   +IMN +A+E + +  +Q W
Sbjct: 14  RDEESLEAEYHRYNLSLPKLPILTSLWLGSFIGSLDGTIVANIMNRVAEEFEESDKKQ-W 72

Query: 116 LMSSFPLALGSFILVSGRLGDIYGLKKILLGGYIITTVWSIICGLSSYAHNDAFFITARA 175
           + +SF L   +F  + G+L DI G +  LL  +     + + C L+ +A +   F  ARA
Sbjct: 73  IATSFLLTNTAFQPLYGKLSDITGRRFALLTAHFF---FGLGCLLTCFAQSVEQFALARA 129

>TPHA0G03150 Chr7 (670343..672145) [1803 bp, 600 aa] {ON} Anc_2.473
           YMR088C
          Length = 600

 Score = 38.5 bits (88), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 34/132 (25%), Positives = 62/132 (46%), Gaps = 23/132 (17%)

Query: 32  LKNIDSRSSLNSSLTQVLSTDTADNDESSSYQNPDYFK------------------NKYQ 73
           +K+ID+ +  N+  TQ+L  +  +N ++S  ++  Y                     KY 
Sbjct: 1   MKSIDNSNVNNTEETQLLKNNAVNNSDTSLAKSGGYNSIVSGASSDSNNKPKLDPITKYN 60

Query: 74  ---EFGFIFSGM-IGQLLSQAGLTQTLSIMNVLAKELDSTSSRQAWLMSSFPLALGSFIL 129
                G I + + +G  LS    T    IMN +A++ ++++ +Q W+ +S+ L   +F  
Sbjct: 61  LSLSKGPILTSLWLGSFLSALDATIVAVIMNRVAEDFNASNQKQ-WIATSYLLTNTAFQP 119

Query: 130 VSGRLGDIYGLK 141
           + GRL DI G K
Sbjct: 120 LYGRLSDIIGRK 131

>NCAS0I00110 Chr9 complement(5312..6670) [1359 bp, 452 aa] {ON} 
          Length = 452

 Score = 37.7 bits (86), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 38/73 (52%), Gaps = 2/73 (2%)

Query: 270 KMDWLGSVL--GVFGLIILNFVFNQAPIVGWQSAYIIVLLVLSFCALVIFVVYEVKYAKT 327
           K+D +G++L     G I++           W ++ +I   VL F  + I  V+E K+A+ 
Sbjct: 279 KLDIIGTLLFTACLGCILVPLTLAGGTNSKWNNSRVIGPFVLGFVLIPILGVWEYKWARD 338

Query: 328 PLIPKAISSNRGM 340
           PLIP  +  +RG+
Sbjct: 339 PLIPYKLVRDRGV 351

>KLLA0C19272g Chr3 complement(1717903..1719774) [1872 bp, 623 aa]
           {ON} similar to uniprot|P38724 Saccharomyces cerevisiae
           YHL047C ARN2 Transporter or YHL040C uniprot|P38731
           Saccharomyces cerevisiae YHL040C ARN1 Transporter,
           member of the ARN family of transporters that
           specifically recognize siderophore-iron chelates
           responsible for uptake of iron bound to the siderophore
           triacetylfusarinine C,
          Length = 623

 Score = 38.1 bits (87), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 43/177 (24%), Positives = 69/177 (38%), Gaps = 50/177 (28%)

Query: 267 HGL-----KMDWLGSVLGVF------GLIILNFVFNQAPIVGWQSAYIIVLLVLSFCALV 315
           HGL     ++ W   V+GV       G I++           W + ++I   VL F  L 
Sbjct: 269 HGLLQTLIQLFWKLDVVGVLLLTVTLGCILVPLTLAGGVSQKWNNPHVIAPFVLGFVLLP 328

Query: 316 IFVVYEVKYAKTPLIPKAISSNRGMLMILFSLFCGWGSFGIWTFYYFSFELNLRHYSPLW 375
           IFVV+E K+A  P+ P  +  +RG+          W +  I    YF +++ +       
Sbjct: 329 IFVVWESKWALDPIAPFELLKDRGV----------WSALTIQFLIYFVYQMAV------- 371

Query: 376 AGSSYFIFVI-------SGSTVAIVCGLTI--------------KKIKPSVLFCCSM 411
            G  Y I VI       S + +  V   T               K++KP ++  CS+
Sbjct: 372 -GYLYTILVIAVDESTTSATRITSVYSFTAAVASPFFALVVTRSKRLKPYIITGCSL 427

>KAFR0D00930 Chr4 complement(195566..197410) [1845 bp, 614 aa] {ON} 
          Length = 614

 Score = 38.1 bits (87), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 29/96 (30%), Positives = 51/96 (53%), Gaps = 4/96 (4%)

Query: 270 KMDWLGSVL--GVFGLIILNFVFNQAPIVGWQSAYIIVLLVLSFC-ALVIFVVYEVKYAK 326
           ++D +G +L    FGLI++ F   +     W+ A  IV  VL +  +L ++ ++E  +A+
Sbjct: 279 RVDVVGLILLAATFGLILIPFTLAEKKNYQWKKASYIVPEVLGWAVSLPLYCIWEKFFAR 338

Query: 327 TPLIPKAISSNRGML-MILFSLFCGWGSFGIWTFYY 361
            PL P A   +RG+   +L SLF  +  +   T+ Y
Sbjct: 339 FPLTPLATVKDRGIYGALLVSLFIDFVYYMQHTYLY 374

>TDEL0H00130 Chr8 complement(10267..12132) [1866 bp, 621 aa] {ON} 
          Length = 621

 Score = 37.7 bits (86), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 40/81 (49%), Gaps = 2/81 (2%)

Query: 270 KMDWLGSVLGVFGL--IILNFVFNQAPIVGWQSAYIIVLLVLSFCALVIFVVYEVKYAKT 327
           K+D +G +L   G   I++           WQSA +I   VL F  + IF+ +E K A  
Sbjct: 284 KLDVVGIILLTVGTGCILVPLTLAGGVSTQWQSAKLIAPFVLGFVLIAIFIYWESKLALA 343

Query: 328 PLIPKAISSNRGMLMILFSLF 348
           P+ P  +  +RG+   L+ +F
Sbjct: 344 PIAPFKMLKDRGIWAPLWIMF 364

>KLLA0A10439g Chr1 complement(913342..915246) [1905 bp, 634 aa] {ON}
           similar to uniprot|P38731 Saccharomyces cerevisiae
           YHL040C ARN1 Transporter member of the ARN family of
           transporters that specifically recognize
           siderophore-iron chelates responsible for uptake of iron
           bound to ferrirubin ferrirhodin and related siderophores
          Length = 634

 Score = 37.7 bits (86), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 43/85 (50%), Gaps = 11/85 (12%)

Query: 267 HGL-----KMDWLGSVLGVF-GLIILNFVFNQAPIVG-----WQSAYIIVLLVLSFCALV 315
           HGL     ++ W   V+GVF  +IIL  +     + G     W + +II   +L F  + 
Sbjct: 282 HGLVQSLVQLFWKLDVIGVFFMIIILGCILVPLTLAGGISNKWNNPHIIAPFILGFVLIP 341

Query: 316 IFVVYEVKYAKTPLIPKAISSNRGM 340
            F+ +E K+A+ P+ P  +  +RG+
Sbjct: 342 FFIAWESKWAREPIAPFKLLRDRGI 366

>KNAG0E02560 Chr5 (506517..508253) [1737 bp, 578 aa] {ON} Anc_2.473
           YMR088C
          Length = 578

 Score = 37.7 bits (86), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 34/144 (23%), Positives = 64/144 (44%), Gaps = 6/144 (4%)

Query: 32  LKNIDSRSSLNSSLTQVLSTDTADNDESSSYQNPDYFKNKYQEFGFIFSGMIGQLLSQAG 91
           ++ +D  +SL     +    D  D+ +     + D       +   + S  +G  +S   
Sbjct: 1   MEALDETTSLLPDPVESCPNDLPDDTKLEQEYHRD--NMALPKGPILLSLWLGSFVSALD 58

Query: 92  LTQTLSIMNVLAKELDSTSSRQAWLMSSFPLALGSFILVSGRLGDIYGLKKILLGGYIIT 151
            T   +IMN +A E   +  +Q W+ +S+ L   +F  + G+L DI G K  ++  +   
Sbjct: 59  GTVVANIMNSIAAEFAESDKKQ-WIATSYLLTNTAFQPLYGKLSDITGRKVAVITAHFF- 116

Query: 152 TVWSIICGLSSYAHNDAFFITARA 175
             +++ C L+ +A N   F  ARA
Sbjct: 117 --FALGCLLTCFAQNVTQFSIARA 138

>Smik_11.370 Chr11 (653235..654554) [1320 bp, 440 aa] {ON} YKR106W
           (REAL)
          Length = 440

 Score = 37.4 bits (85), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 44/97 (45%), Gaps = 12/97 (12%)

Query: 270 KMDWLGSVLGVF--GLIILNFVFNQAPIVGWQSAYIIVLLVLSFCALVIFVVYEVKYAKT 327
           ++D +G VL     G I++           W+S+ II  LV      +IF+ +E  YA  
Sbjct: 138 ELDVIGIVLITVSTGCILVPLTLAAGASEKWRSSKIIGTLVSGGVLFLIFMFWEASYAHN 197

Query: 328 PLIPKAISSNRGMLMILFSLFCGWGSFGIWTFYYFSF 364
           PL+P  +  +RG+          W   G+  F YF+F
Sbjct: 198 PLLPFKLLKDRGI----------WAPLGVAFFNYFTF 224

>Smik_6.22 Chr6 complement(31536..33446) [1911 bp, 636 aa] {ON}
           YEL065W (REAL)
          Length = 636

 Score = 37.4 bits (85), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 29/88 (32%), Positives = 44/88 (50%), Gaps = 14/88 (15%)

Query: 265 NIHGLKMDW-LGSV----LGVFGLIILNFVFNQAPIV---------GWQSAYIIVLLVLS 310
            I G K+ W L  V    +  FGLI+L F F+   +          GW +  +I + V+ 
Sbjct: 283 RIRGFKVYWELLKVSLIEIDAFGLILLGFAFSLILLPCSLYSYAEGGWNNPSMIAMEVVG 342

Query: 311 FCALVIFVVYEVKYAKTPLIPKAISSNR 338
              L+ +VV+EV +A  PL+PK +  NR
Sbjct: 343 GILLISYVVFEVFFAPFPLLPKRVLMNR 370

>Kwal_14.722 s14 (9019..10854) [1836 bp, 611 aa] {ON} YCL073C -
           Hypothetical ORF [contig 245] FULL
          Length = 611

 Score = 37.4 bits (85), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 28/118 (23%), Positives = 51/118 (43%), Gaps = 11/118 (9%)

Query: 234 SNWPWSFYAFGLISFVNLIISWYCIPNSIPTNIHGL---------KMDWLGSVL--GVFG 282
           S+ P+  Y F      +    W  + N + T+   +         ++D +G+VL     G
Sbjct: 231 SSLPFITYLFYATHISSKTKKWKDLRNKVETHKRNIILVVKDIFNQIDIVGTVLVTAALG 290

Query: 283 LIILNFVFNQAPIVGWQSAYIIVLLVLSFCALVIFVVYEVKYAKTPLIPKAISSNRGM 340
           LI++           W    II  LV+    L++F+ +E K+AK   +P  +  +RG+
Sbjct: 291 LILVPLTLAGGVSERWHEPGIIATLVIGIALLLVFLFWEAKFAKNAALPFNLLKDRGV 348

>KNAG0J02980 Chr10 (571855..573765) [1911 bp, 636 aa] {ON} 
          Length = 636

 Score = 37.0 bits (84), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 45/179 (25%), Positives = 73/179 (40%), Gaps = 38/179 (21%)

Query: 265 NIHGLKMD-----WLGSVLGVF------GLIILNFVFNQAPIVGWQSAYIIVLLVLSFCA 313
            IHG K+      W   V+GV       G I++           W  + II   VL F  
Sbjct: 279 QIHGWKVTLKTLFWKLDVVGVLLMVACLGCILVPLTLAGGVSSKWNHSNIIGPFVLGFVL 338

Query: 314 LVIFVVYEVKYAKTPLIPKAISSNRGMLMILFSLFCGWGSFGIWTFYYFSFELNLRH-YS 372
           + IF  +E ++A  PL+P  +  +RG+          W + GI     F F + + + Y+
Sbjct: 339 IPIFSYWEARWATNPLVPYKLVKDRGV----------WAALGISFLIDFIFYMAVDYLYT 388

Query: 373 PLWAG-----------SSYFIFVISGSTVAIVCGLT-IKKIKPSVLFCCSM----MGFL 415
            L              SS   FV + ++  +   LT + ++KP ++  CS+    MG L
Sbjct: 389 VLIVAVHESVKSATRISSLSSFVSTVASPIVALALTRVTRMKPVIIVGCSLWLLAMGLL 447

>NDAI0H00140 Chr8 complement(10247..12145) [1899 bp, 632 aa] {ON} 
          Length = 632

 Score = 37.0 bits (84), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 27/89 (30%), Positives = 40/89 (44%), Gaps = 12/89 (13%)

Query: 270 KMDWLGSVLGV--FGLIILNFVFNQAPIVGWQSAYIIVLLVLSFCALVIFVVYEVKYAKT 327
           ++D +G +L V   G I++           W    II   VL F  + IF  +E  +A+ 
Sbjct: 284 RLDIIGVLLMVAWLGCILVPLTLAGGVKSKWNDGRIIGPFVLGFVLVPIFAAWEYFFARD 343

Query: 328 PLIPKAISSNRGMLMILFSLFCGWGSFGI 356
           PLIP A+  +RG+          W S GI
Sbjct: 344 PLIPYALIKDRGV----------WASMGI 362

>Suva_10.9 Chr10 complement(12679..14592) [1914 bp, 637 aa] {ON}
           YEL065W (REAL)
          Length = 637

 Score = 37.0 bits (84), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 38/70 (54%), Gaps = 9/70 (12%)

Query: 278 LGVFGLIILNFVFNQAPIV---------GWQSAYIIVLLVLSFCALVIFVVYEVKYAKTP 328
           +  FGLI+L F F+   +          GW++  +I + V+    L+ +V++EV +A  P
Sbjct: 302 IDAFGLILLGFAFSLILLPCSLYSYAEGGWKNPSMIAMEVIGGIFLISYVIFEVFFAPFP 361

Query: 329 LIPKAISSNR 338
           L+PK +  NR
Sbjct: 362 LLPKRVLVNR 371

>KLTH0D16962g Chr4 (1399514..1401229) [1716 bp, 571 aa] {ON} similar
           to uniprot|P33335 Saccharomyces cerevisiae YPR198W SGE1
           Member of drug-resistance protein family multicopy
           suppressor of gal11 null mutation
          Length = 571

 Score = 36.6 bits (83), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 66/317 (20%), Positives = 125/317 (39%), Gaps = 66/317 (20%)

Query: 96  LSIMNVLAKELDSTSSRQAWLMSSFPLALGSFILVSGRLGDIYGLKKILLGGYIITTVWS 155
           +++ + + +E +  ++   WLM+ + L    F+L+ GR+  + GLK  L+   +I    S
Sbjct: 28  ITLYDTIGQEFNDYAN-VGWLMAGYNLPNALFMLLWGRIASLVGLKCSLMASIVIFEAGS 86

Query: 156 IICGLSSYAHNDAFFITARAFQGLGLAFALPNMIGLIGTIYRPGCFRKNMIISIIGAMSP 215
           ++ G    A++    I AR   G G    + +++  +GT       R   +I+++G    
Sbjct: 87  LMAG---AANSMGMLIGARVISGFG-GSGIESLVYGVGTSIVEEKHRAR-VITVLGIAYM 141

Query: 216 XXXXXXXXXXXXXVKYDKSNWPWSFYA---FGLISFVNL--------------IISWYCI 258
                         ++   +W W FY     G ++   L              +  ++  
Sbjct: 142 LAEGAGPFVGGGLAEH--VSWRWCFYVNLPIGGVALAALGWGYNPAGRAPGRALARFWVR 199

Query: 259 PNSIP-------------TNIHGLKMDWLGSVL--GVFGLIILNFVF--NQAPIVGWQSA 301
             + P               +   ++D  G  L  G F L++L   F  NQ     W+SA
Sbjct: 200 ARAFPYGTLLQAQFWRRAAALMVFRLDIPGLALSSGGFALVMLALTFGGNQ---YAWRSA 256

Query: 302 YIIVLLVLSFCALVIFVVYE-----------VKYAKTPLIPKAISSNRGMLMILFSLFCG 350
            I+ + V     L +F++Y+             Y   PL+P  +++N   + +L S  CG
Sbjct: 257 TIVCMFVFGAALLALFMLYDFVVLPRVGARIAGYEPLPLVPWRLAAN---VPVLTSSLCG 313

Query: 351 WGSFGIWTFYYFSFELN 367
           +       F  F+FEL 
Sbjct: 314 F-------FNCFAFELQ 323

>Skud_6.14 Chr6 complement(19547..21457) [1911 bp, 636 aa] {ON}
           YEL065W (REAL)
          Length = 636

 Score = 36.6 bits (83), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 37/70 (52%), Gaps = 9/70 (12%)

Query: 278 LGVFGLIILNFVFNQAPIV---------GWQSAYIIVLLVLSFCALVIFVVYEVKYAKTP 328
           +  FGLI+L F F+   +          GW +  +I + V+    L+ +VV+EV +A  P
Sbjct: 301 IDAFGLILLGFAFSLILLPCSLYSYAEGGWNNPSMIAMEVVGGIFLISYVVFEVFFAPFP 360

Query: 329 LIPKAISSNR 338
           L+PK +  NR
Sbjct: 361 LLPKRVLMNR 370

>KLTH0D00506g Chr4 (47320..49170) [1851 bp, 616 aa] {ON} similar to
           uniprot|P38731 Saccharomyces cerevisiae YHL040C ARN1
           Transporter member of the ARN family of transporters
           that specifically recognize siderophore-iron chelates
           responsible for uptake of iron bound to ferrirubin
           ferrirhodin and related siderophores
          Length = 616

 Score = 36.2 bits (82), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 26/99 (26%), Positives = 45/99 (45%), Gaps = 12/99 (12%)

Query: 270 KMDWLGSVL--GVFGLIILNFVFNQAPIVGWQSAYIIVLLVLSFCALVIFVVYEVKYAKT 327
           K+D +G +L     G I++           W + +II   VL F  + I + +E+++A+ 
Sbjct: 276 KLDVVGVLLLIATLGCILVPLTLAGGYNSKWNNPHIIGPFVLGFVLVPILMFWEMRWARD 335

Query: 328 PLIPKAISSNRGMLMILFSLFCGWGSFGIWTFYYFSFEL 366
           PL+P  +  +RG+          W +  I    YF F L
Sbjct: 336 PLVPYGLIKDRGV----------WSALAISFLNYFIFAL 364

>KLLA0E14609g Chr5 (1302073..1303992) [1920 bp, 639 aa] {ON} similar
           to uniprot|P38731 Saccharomyces cerevisiae YHL040C ARN1
           Transporter member of the ARN family of transporters
           that specifically recognize siderophore-iron chelates
           responsible for uptake of iron bound to ferrirubin
           ferrirhodin and related siderophores
          Length = 639

 Score = 36.2 bits (82), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 38/73 (52%), Gaps = 2/73 (2%)

Query: 270 KMDWLGSVLGV--FGLIILNFVFNQAPIVGWQSAYIIVLLVLSFCALVIFVVYEVKYAKT 327
           K+D +G +L V   G I++           W +  I+   +L FC +  F+++E KYA+ 
Sbjct: 295 KVDVVGLLLFVAFLGCILVPLTLAGGVSSQWSNGKILGPFILGFCLVPAFILWETKYARL 354

Query: 328 PLIPKAISSNRGM 340
           P+ P  +  +RG+
Sbjct: 355 PIAPFKMLKDRGI 367

>ZYRO0G07414g Chr7 complement(583978..586101) [2124 bp, 707 aa] {ON}
           similar to uniprot|P38731 Saccharomyces cerevisiae
           YHL040C ARN1 Transporter member of the ARN family of
           transporters that specifically recognize
           siderophore-iron chelates responsible for uptake of iron
           bound to ferrirubin ferrirhodin and related siderophores
          Length = 707

 Score = 36.2 bits (82), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 26/97 (26%), Positives = 43/97 (44%), Gaps = 12/97 (12%)

Query: 270 KMDWLGSVLGV--FGLIILNFVFNQAPIVGWQSAYIIVLLVLSFCALVIFVVYEVKYAKT 327
           K+D +G+ +     G I++           W  + II  LVL    L + +VYE+K+A+ 
Sbjct: 309 KLDTIGTFIMTVSLGCILVPLTLAGGTSSKWDDSQIIGPLVLGVVLLPMLIVYELKWARE 368

Query: 328 PLIPKAISSNRGMLMILFSLFCGWGSFGIWTFYYFSF 364
           P++P  +  +R +          W S  I   Y F F
Sbjct: 369 PILPWKLIKDRAV----------WASMSISFLYDFIF 395

>YBR293W Chr2 (787006..788430) [1425 bp, 474 aa] {ON}  VBA2Permease
           of basic amino acids in the vacuolar membrane
          Length = 474

 Score = 35.8 bits (81), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 35/146 (23%), Positives = 68/146 (46%), Gaps = 19/146 (13%)

Query: 236 WPWSFYAFGLISFVNLIISWYCIPNSIPTNIHG-----------LKMDWLGSVLGVFGLI 284
           W W F     IS ++ I+  Y +PN    N                +D +GS+L + GL 
Sbjct: 120 WRWCFLIQVPISVISSILMNYYVPNQKEYNRQNSSIFQNPGKILRDIDVMGSILIITGLT 179

Query: 285 ILNFVFN---QAPIVGWQSAYIIVLLVLSFCALVIFVVYEVKYAKTPLIP-KAISSNRGM 340
           +     +       + W S  +++LLV S   L++F+++E K +   +IP + ++S+  +
Sbjct: 180 LQLLYLSLGCSTSKLSWTSPSVLLLLVGSVIILLLFILHERKTSARAIIPMELVNSSYSV 239

Query: 341 LMILFSLFCGWGSFGIWTFYYFSFEL 366
           +++  S+  G+ S+     Y F+  L
Sbjct: 240 VVLSISILVGFASYA----YLFTLPL 261

>TPHA0G03780 Chr7 complement(800134..801972) [1839 bp, 612 aa] {ON} 
          Length = 612

 Score = 35.8 bits (81), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 45/149 (30%), Positives = 71/149 (47%), Gaps = 16/149 (10%)

Query: 270 KMDWLGSVL--GVFGLIILNFVFNQAPIVGWQSAYIIVLLVLSFC-ALVIFVVYEVKYAK 326
           K D +G +L  GVFGL+++           W  A IIV  VL +  AL ++V +E K+AK
Sbjct: 276 KSDIIGLILLVGVFGLVLVPITLAGGLNKKWNEAQIIVPEVLGWTLALPLYVFWENKFAK 335

Query: 327 TPLIPKAISSNRG----MLMILFSLFCGWGSFGIWTFYYFSFELNLRHYSPLWAGS---- 378
            P+I      + G    + + LF  FC    F +   Y  +F L   + S   A      
Sbjct: 336 YPIIKLETVRDSGIWSALSISLFIDFC----FYMHETYLVTFLLVAVNESKKSATRINSL 391

Query: 379 SYFIFVISGSTVAIVCGLTIKKIKPSVLF 407
           S F+ VI+G  + +   + I++ K S++F
Sbjct: 392 STFVTVITGFFLGLAI-VRIRRTKISIVF 419

>SAKL0G03300g Chr7 (268199..270049) [1851 bp, 616 aa] {ON} similar
           to uniprot|P38731 Saccharomyces cerevisiae YHL040C ARN1
           Transporter member of the ARN family of transporters
           that specifically recognize siderophore-iron chelates
           responsible for uptake of iron bound to ferrirubin
           ferrirhodin and related siderophores
          Length = 616

 Score = 35.8 bits (81), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 32/59 (54%), Gaps = 10/59 (16%)

Query: 298 WQSAYIIVLLVLSFCALVIFVVYEVKYAKTPLIPKAISSNRGMLMILFSLFCGWGSFGI 356
           WQ++ II  +VL F  + +++ +E K+AK P+ P  +  +RG+          W + GI
Sbjct: 306 WQNSQIIGPIVLGFVLIPMYIYWESKWAKEPMAPFKLLKDRGV----------WAALGI 354

>Suva_4.553 Chr4 (959592..961280) [1689 bp, 562 aa] {ON} YBR293W
           (REAL)
          Length = 562

 Score = 35.8 bits (81), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 56/254 (22%), Positives = 107/254 (42%), Gaps = 27/254 (10%)

Query: 236 WPWSFYAFGLISFVNLIISWYCIPNSIPTNIHGL-----------KMDWLGSVLGVFGLI 284
           W W F     IS +  ++  Y +PN    +   +            +D  GS+L + GL 
Sbjct: 211 WRWCFLIQVPISMIASLLMNYYVPNQKEYDDQKINILLSSKKILKDIDITGSILIIAGLT 270

Query: 285 ILNFVFNQAPIVGWQSAYIIVLLVLSFCALVIFVVYEVKYAKTPLIP-KAISSNRGMLMI 343
           +     +      W +  +++LL+ S   +++F++ E K     +IP + ++S+   +++
Sbjct: 271 LQLLYLSLGASFSWTNPPVLMLLLASIVIIILFILNERKTTARAIIPMELVNSSFSFVVL 330

Query: 344 LFSLFCGWGSFGIWTFYYFSFELNLRHY---SPLWAGSSYFIFVISGSTVAIVCGLTIKK 400
             S+  G+ S+     Y F+  L  +     S   AG    I  +     +++ G+++ K
Sbjct: 331 SISILVGFASYA----YLFTLPLFFQIVLGDSTAKAGLRLTIPSLFTPVGSLITGISMSK 386

Query: 401 IK--PSVLFCCSMMGFLGGNIIFAATPVNQTFFRNMLGCMFLLP--LGMDFSFPASSIIL 456
                S+L+    + FL GN +F           N L  +FL+P  LG   +FP +    
Sbjct: 387 YDCLQSLLYIGIFLMFL-GNFLFLFIEKTSP---NWLIGVFLIPANLGQGITFPTTLFTF 442

Query: 457 SDSLPMQYQGMAGS 470
             + P + Q  A S
Sbjct: 443 IFAFPKRDQATATS 456

>YPR198W Chr16 (934034..935665) [1632 bp, 543 aa] {ON}  SGE1Plasma
           membrane multidrug transporter of the major facilitator
           superfamily, acts as an extrusion permease; partial
           multicopy suppressor of gal11 mutations
          Length = 543

 Score = 35.8 bits (81), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 37/67 (55%), Gaps = 3/67 (4%)

Query: 114 AWLMSSFPLALGSFILVSGRLGDIYGLKKILLGGYIITTVWSIICGLSSYAHNDAFFITA 173
            WL++ + L+   F+L+ GRL +I G K+ L+   I+  + S+I  LS   ++ A  I+ 
Sbjct: 46  GWLVTGYALSNAVFMLLWGRLAEILGTKECLMISVIVFEIGSLISALS---NSMATLISG 102

Query: 174 RAFQGLG 180
           R   G G
Sbjct: 103 RVVAGFG 109

>Suva_26.1 Chr26 (1..1602) [1602 bp, 534 aa] {ON} YOL158C (REAL)
          Length = 534

 Score = 35.4 bits (80), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 28/50 (56%)

Query: 283 LIILNFVFNQAPIVGWQSAYIIVLLVLSFCALVIFVVYEVKYAKTPLIPK 332
           L++L           W+  YII ++V+      IF+++E+++AK P IP+
Sbjct: 287 LVLLPLTIAGGATSKWREGYIIAMIVVGGFLGFIFLIWELRFAKNPFIPR 336

>Kpol_543.44 s543 (96992..98923) [1932 bp, 643 aa] {ON}
           (96992..98923) [1932 nt, 644 aa]
          Length = 643

 Score = 35.4 bits (80), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 32/50 (64%)

Query: 112 RQAWLMSSFPLALGSFILVSGRLGDIYGLKKILLGGYIITTVWSIICGLS 161
           R +W+ +++ L+  +F  + G++ DI+G K +L+   I   V S+ICGLS
Sbjct: 157 RISWVATAYLLSSATFQPIYGKISDIFGRKVVLIFCNITFFVGSLICGLS 206

>TBLA0F03040 Chr6 complement(735352..738072) [2721 bp, 906 aa] {ON}
           Anc_8.272 YDR119W
          Length = 906

 Score = 35.4 bits (80), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 84/358 (23%), Positives = 133/358 (37%), Gaps = 111/358 (31%)

Query: 112 RQAWLMSSFPLALGSFILVSGRLGDIYGLKKILLGGYIITTVWSIICGLSSYAH------ 165
           +  W+ +S+ L+   F  + G+L DI+G K +L+   +I     IICG+S+  +      
Sbjct: 433 KVPWVATSYLLSSAVFQPLYGKLSDIFGRKALLIFSNLIFFFGCIICGMSNSLNMLVWGR 492

Query: 166 ------------------NDAFFITARA--------FQGLGLAFALPNMIGLIGTIYRPG 199
                             +D   + +RA        F GLG AF      G+IG I+   
Sbjct: 493 FVAGIGGGGITSMTTITVSDIVPLRSRAVYQGICNFFFGLGTAFG-----GVIGGIFVDH 547

Query: 200 CFRKNMIISIIGAMSPXXXXXXXXXXXXXVKYDKSNWPWSFYAFGLISFVNLIISWYCIP 259
            +   M+                               WS      +S + LI S+  +P
Sbjct: 548 QYGWRMVF------------------------------WSQVPVSGLSTL-LICSFLVVP 576

Query: 260 N----SIPTNIHGLKMDWLGSV-----LGVFGLIILNFVFNQAPIVGWQSAYIIVLLVLS 310
                 +      +++DWLGS+     L  F LI          I   Q  Y   L++ S
Sbjct: 577 RIKNYEVSLGRKLMRVDWLGSISMILWLTSFLLITTMMGGISLDIDSDQFHY---LIMFS 633

Query: 311 FCALVIFVVYEVKYAKTPLIPKAISSNRGML-MILFSLFCGWGSFGIWTFY---YFSFEL 366
             + +IFV+ E+  A  P++P    SNR +L   L + FC  G F    FY   YF+  L
Sbjct: 634 SVSAIIFVLTELFVASDPVLPLRFLSNRSVLGASLGNFFCVMG-FMTICFYLPIYFASVL 692

Query: 367 NLRHYSPLWAGSSYFIFVISGSTVAIVCGLTIKKIKPSVLFCCSMMGFLGGNIIFAAT 424
           ++   SP   G                     K++ P+  F C+ +G LG  +    T
Sbjct: 693 DI---SPTGIG---------------------KRMAPN--FLCTALGSLGAGVYMKQT 724

>ABL040W Chr2 (321534..323237) [1704 bp, 567 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR088C
          Length = 567

 Score = 35.4 bits (80), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 28/92 (30%), Positives = 45/92 (48%), Gaps = 4/92 (4%)

Query: 83  IGQLLSQAGLTQTLSIMNVLAKELDSTSSRQAWLMSSFPLALGSFILVSGRLGDIYGLKK 142
           +G  L+    +   +IMN +A+E   +  +Q W+ +SF L   +F  + GR  DI G K 
Sbjct: 52  LGSFLASIDASIVANIMNKIAEEFHESDKKQ-WMATSFLLTNAAFQPLYGRCSDIVGRKC 110

Query: 143 ILLGGYIITTVWSIICGLSSYAHNDAFFITAR 174
            LL   I  + + +   L+ +A N   F  AR
Sbjct: 111 ALL---IAQSFFLLGTLLTCFARNVTEFAIAR 139

>KLTH0D18150g Chr4 complement(1502817..1504640) [1824 bp, 607 aa]
           {ON} similar to uniprot|P38731 Saccharomyces cerevisiae
           YHL040C ARN1 Transporter member of the ARN family of
           transporters that specifically recognize
           siderophore-iron chelates responsible for uptake of iron
           bound to ferrirubin ferrirhodin and related siderophores
          Length = 607

 Score = 35.4 bits (80), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 31/58 (53%), Gaps = 10/58 (17%)

Query: 298 WQSAYIIVLLVLSFCALVIFVVYEVKYAKTPLIPKAISSNRGMLMILFSLFCGWGSFG 355
           W + ++I  LVL F  L +F+++E K AK P++P  +  +R +          WG+ G
Sbjct: 298 WSNPHLIGPLVLGFVLLPLFMIWESKAAKYPVVPYGLIKDRAV----------WGALG 345

>SAKL0F00110g Chr6 (1456..3318) [1863 bp, 620 aa] {ON} similar to
           uniprot|P38724 Saccharomyces cerevisiae YHL047C ARN2
           Transporter member of the ARN family of transporters
           that specifically recognize siderophore-iron chelates
           responsible for uptake of iron bound to the siderophore
           triacetylfusarinine C
          Length = 620

 Score = 35.4 bits (80), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 28/117 (23%), Positives = 55/117 (47%), Gaps = 3/117 (2%)

Query: 298 WQSAYIIVLLVLSFCALVIFVVYEVKYAKTPLIPKAISSNRGMLMILFSLFCGWGSFGIW 357
           W+SA II  +VL    +++F+ +E K A  PL P  +  +RG+   L  +F     + + 
Sbjct: 315 WRSAKIIAPIVLGSVLVLVFIYWESKLALVPLAPFKMLKDRGIWAPLLLMFLVCFVYVMP 374

Query: 358 TFYYFSFELNLRHYSPLWAGSSYFIFVISGSTVAIVCGLTIK---KIKPSVLFCCSM 411
             Y ++  L   + S L A     ++    + ++   G+ +    ++KP   F C++
Sbjct: 375 ADYLYTILLVAGNESSLSATRITSLYSFVTAVLSAAAGILVTRFPRLKPFAFFGCAL 431

>TBLA0C01040 Chr3 (208261..210270) [2010 bp, 669 aa] {ON} 
          Length = 669

 Score = 35.0 bits (79), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 32/74 (43%), Gaps = 6/74 (8%)

Query: 273 WLGSVLGVF------GLIILNFVFNQAPIVGWQSAYIIVLLVLSFCALVIFVVYEVKYAK 326
           W   V+GV       G I++           W    II    L F  + IF  +E K++K
Sbjct: 325 WRLDVIGVLLMGASLGCILVPLTLAGGTSSKWNHGNIIAPFALGFVLIPIFTFWEWKFSK 384

Query: 327 TPLIPKAISSNRGM 340
           +PLIP  +  +R +
Sbjct: 385 SPLIPSKLVKDRAV 398

>Skud_16.503 Chr16 (880571..882202) [1632 bp, 543 aa] {ON} YPR198W
           (REAL)
          Length = 543

 Score = 35.0 bits (79), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 63/272 (23%), Positives = 111/272 (40%), Gaps = 57/272 (20%)

Query: 115 WLMSSFPLALGSFILVSGRLGDIYGLKKILLGGYIITTVWSIICGLSSYAHNDAFFITAR 174
           WL++ + L    F+L+ GRL +I G  + L+   II  V S+I  LS   ++    I+ R
Sbjct: 47  WLVTGYALTNAVFMLLWGRLAEILGTNECLMISVIIFEVGSLISALS---NSMGTLISGR 103

Query: 175 AFQGLGLAFALPNMIGLIGTIYRPGCFRKNMIISIIGAMSPXXXXXXXXXXXXXVKYDKS 234
              G G    + ++  ++GT       ++N   ++I A++                +++ 
Sbjct: 104 LIAGFG-GSGIESLAFVVGT----SIVQENHRGTMITALATSYVIAEGVGPFIGGAFNEH 158

Query: 235 -NWPWSFYAFGLISFVNLIISWYCIPN--SIPT--------------------------- 264
            +W W FY    I    LII  +C  +  S+P                            
Sbjct: 159 LSWRWCFYINLPIGAFALIILAFCNTSGESLPKVSLLSKIKSIMSYKYDEVFKASFWKKA 218

Query: 265 -NIHGLKMDWLGSVLGVFGLIIL---------NFVFNQAPIVGWQSAYIIVLLVLSFCAL 314
             +   K+D +G  L   G  +L         NF +N + I+   +   I+L++  FCA 
Sbjct: 219 FKVFVFKLDMIGVTLSSAGFTLLMLGLSFGGNNFAWNSSTIISLFTVGPILLIL--FCAY 276

Query: 315 ------VIFVVYEVKYAKTPLIPKAISSNRGM 340
                 ++ + YE K  K PL+  +I+SN G+
Sbjct: 277 DFHFLPLLGLRYENKRTK-PLLTWSIASNSGI 307

>AGR076C Chr7 complement(871564..873624) [2061 bp, 686 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR119W
          Length = 686

 Score = 35.0 bits (79), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 19/80 (23%), Positives = 46/80 (57%), Gaps = 1/80 (1%)

Query: 83  IGQLLSQAGLTQTLSIMNVLAKELDSTSSRQAWLMSSFPLALGSFILVSGRLGDIYGLKK 142
           +G  L+    T   ++++ +A E +    R +W+ +++ L+  +F  + G+L DI+G + 
Sbjct: 148 LGVFLAALDGTIVTTLLDHIASEFNELP-RISWIATAYLLSSATFQPLYGKLSDIFGRRP 206

Query: 143 ILLGGYIITTVWSIICGLSS 162
           +L+   ++  + ++ICG+S 
Sbjct: 207 LLVFSNLVFCLGALICGMSK 226

>Smik_17.11 Chr17 complement(8582..10216) [1635 bp, 544 aa] {ON}
           YPR198W (REAL)
          Length = 544

 Score = 34.7 bits (78), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 65/273 (23%), Positives = 113/273 (41%), Gaps = 56/273 (20%)

Query: 114 AWLMSSFPLALGSFILVSGRLGDIYGLKKILLGGYIITTVWSIICGLSSYAHNDAFFITA 173
            WL++ + L+   F+L+ GRL +I G  + L+   +I  + S+I  LS   +     I  
Sbjct: 46  GWLVTGYALSNAVFMLLWGRLAEILGTTECLMISVVIFEIGSLISALS---NTMGTLIGG 102

Query: 174 RAFQGLGLAFALPNMIGLIGTIYRPGCFRKNMIISIIGAMSPXXXXXXXXXXXXXVKYDK 233
           R   G G +  + ++  ++GT      +R  MI ++  A+S                 + 
Sbjct: 103 RVIAGFGGS-GIESLAFVVGTSIVQENYRGIMITAL--AVSYVIAEGVGPFIGGAFN-EH 158

Query: 234 SNWPWSFY---AFGLISFVNLII------SWYCIP------NSIPT-------------- 264
            +W W FY     G  +F++L         W          NSI +              
Sbjct: 159 LSWRWCFYINLPIGAFAFISLAFCCASGGKWLSKKWLLSKINSITSYKYYEIFKASFWKK 218

Query: 265 --NIHGLKMDWLGSVLGVFGLIIL---------NFVFNQAPIVGWQSAYIIVLLVLSFCA 313
              I   K+D +G +L   G  +L         NF +N + I+ + +   I+L++  FCA
Sbjct: 219 VFQILVFKLDMIGIILSSAGFTLLMLGLSFGGNNFAWNSSIIISFFTLGPILLIL--FCA 276

Query: 314 L------VIFVVYEVKYAKTPLIPKAISSNRGM 340
                  ++ V Y+ KYA+ PL+   I+SN G+
Sbjct: 277 YDFHILPLLGVHYKSKYAR-PLLTWKIASNAGI 308

>Skud_8.3 Chr8 complement(7094..8989) [1896 bp, 631 aa] {ON} YHL040C
           (REAL)
          Length = 631

 Score = 34.7 bits (78), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 27/101 (26%), Positives = 42/101 (41%), Gaps = 21/101 (20%)

Query: 267 HGL-----KMDWLGSVLGVF------GLIILNFVFNQAPIVGWQSAYIIVLLVLSFCALV 315
           HGL     ++ W   V+GV       G I++           W  + +I   VL F  + 
Sbjct: 280 HGLMKILEQLFWKLDVIGVLLMGCSLGCILVPLTLAGGVKTTWNDSRLIGPFVLGFVLIP 339

Query: 316 IFVVYEVKYAKTPLIPKAISSNRGMLMILFSLFCGWGSFGI 356
           I  V+E  YA+ P++P  +  +RG+          W S GI
Sbjct: 340 ILWVWEYSYARDPILPYKLVKDRGV----------WSSMGI 370

>KLLA0A04631g Chr1 complement(415070..416809) [1740 bp, 579 aa] {ON}
           weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 579

 Score = 34.7 bits (78), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 32/153 (20%), Positives = 68/153 (44%), Gaps = 14/153 (9%)

Query: 38  RSSLNSSLTQ---------VLSTDTADNDESSSYQNPDYFKNKYQEFGFIFSGM-IGQLL 87
           R++LN  L++         V  T+     E  + +     +        I S M +G  L
Sbjct: 14  RNALNPELSEGLPAYVGAEVAETEHLLESEDEAREGLQVSEMSRARLHIIISSMCLGSFL 73

Query: 88  SQAGLTQTLSIMNVLAKELDSTSSRQAWLMSSFPLALGSFILVSGRLGDIYGLKKILLGG 147
           +    T   ++++ +A E +  S   +W+ +++ L+  +F  + G++ DI+G + +++  
Sbjct: 74  AALDNTIVTTLLSHIASEFNELS-HISWIATAYLLSSATFQPLYGKISDIFGRRPLIIIS 132

Query: 148 YIITTVWSIICGLSSYAHNDAFFITARAFQGLG 180
            +   +  +ICGLS    N    +  R   G+G
Sbjct: 133 NLFFILGCLICGLS---KNLWTLVAGRFIAGIG 162

>TDEL0H01600 Chr8 complement(273692..275506) [1815 bp, 604 aa] {ON} 
          Length = 604

 Score = 34.3 bits (77), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 23/35 (65%)

Query: 298 WQSAYIIVLLVLSFCALVIFVVYEVKYAKTPLIPK 332
           W+  +II ++V+  C  ++F V+E+  AK P IP+
Sbjct: 305 WKEGHIIAMIVVGGCCGILFFVWELWLAKKPFIPR 339

>KLTH0D00110g Chr4 (796..2658) [1863 bp, 620 aa] {ON} similar to
           uniprot|P38724 Saccharomyces cerevisiae YHL047C ARN2
           Transporter member of the ARN family of transporters
           that specifically recognize siderophore-iron chelates
           responsible for uptake of iron bound to the siderophore
           triacetylfusarinine C
          Length = 620

 Score = 34.3 bits (77), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 39/159 (24%), Positives = 67/159 (42%), Gaps = 14/159 (8%)

Query: 267 HGL-----KMDWLGSVLGVF------GLIILNFVFNQAPIVGWQSAYIIVLLVLSFCALV 315
           HGL     ++ W   V+GV       G I++           W+SA +I  LVL    + 
Sbjct: 273 HGLVQTLKQLFWKLDVVGVLLFSVSTGCILIPLTIAGGASTHWRSAKVIAPLVLGSLLVP 332

Query: 316 IFVVYEVKYAKTPLIPKAISSNRGMLMILFSLFCGWGSFGIWTFYYFSFELNLRHYSPLW 375
            F+ +E K A  PL P  +  +RG+   L   F     + +   Y ++  L   + S L 
Sbjct: 333 FFIYWESKLALVPLAPFKMLKDRGIWAPLLITFLICFIYMMAAGYLYTILLVAGNESSLS 392

Query: 376 AGSSYFIFVISGSTVAIVCGLTI---KKIKPSVLFCCSM 411
           A     ++    +  + V G+ +    ++KP  +F CS+
Sbjct: 393 ATRITSLYSFVAAVFSPVVGIFVARFSRLKPFAVFGCSL 431

>KLTH0B10450g Chr2 complement(885429..887291) [1863 bp, 620 aa] {ON}
           similar to uniprot|P38724 Saccharomyces cerevisiae
           YHL047C ARN2 Transporter member of the ARN family of
           transporters that specifically recognize
           siderophore-iron chelates responsible for uptake of iron
           bound to the siderophore triacetylfusarinine C
          Length = 620

 Score = 34.3 bits (77), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 39/159 (24%), Positives = 67/159 (42%), Gaps = 14/159 (8%)

Query: 267 HGL-----KMDWLGSVLGVF------GLIILNFVFNQAPIVGWQSAYIIVLLVLSFCALV 315
           HGL     ++ W   V+GV       G I++           W+SA +I  LVL    + 
Sbjct: 273 HGLVQTLKQLFWKLDVVGVLLFSVSTGCILIPLTIAGGASTHWRSAKVIAPLVLGSLLVP 332

Query: 316 IFVVYEVKYAKTPLIPKAISSNRGMLMILFSLFCGWGSFGIWTFYYFSFELNLRHYSPLW 375
            F+ +E K A  PL P  +  +RG+   L   F     + +   Y ++  L   + S L 
Sbjct: 333 FFIYWESKLALVPLAPFKMLKDRGIWAPLLITFLICFIYMMAAGYLYTILLVAGNESSLS 392

Query: 376 AGSSYFIFVISGSTVAIVCGLTI---KKIKPSVLFCCSM 411
           A     ++    +  + V G+ +    ++KP  +F CS+
Sbjct: 393 ATRITSLYSFVAAVFSPVVGIFVARFSRLKPFAVFGCSL 431

>SAKL0A00726g Chr1 (82164..83960) [1797 bp, 598 aa] {ON} similar to
           uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 598

 Score = 34.3 bits (77), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 35/147 (23%), Positives = 60/147 (40%), Gaps = 9/147 (6%)

Query: 39  SSLNSSLTQVLSTDTADNDESSSYQNPDYFKNKYQEFGFIFSGMIGQL-----LSQAGLT 93
           S+L  + ++ L T    +      QN           GF     +G L     LS   + 
Sbjct: 2   SALEDNSSKELCTQAESSTSEVVEQNKKVVSQDQVVKGFALYACLGSLTLALFLSALDIL 61

Query: 94  QTLSIMNVLAKELDSTSSRQAWLMSSFPLALGSFILVSGRLGDIYGLKKILLGGYIITTV 153
              +I+  ++++ +  S +  WL++ + L      LV GR   I G K  +L   II  V
Sbjct: 62  IVSTIIETVSRDFNEYS-KSGWLVTGYSLPTALLSLVWGRAASIIGFKSSMLLSIIIFEV 120

Query: 154 WSIICGLSSYAHNDAFFITARAFQGLG 180
            S++   S+ A++    I  R   G+G
Sbjct: 121 GSLV---SALANSMNMLIGGRVISGVG 144

>YKR105C Chr11 complement(658716..660464) [1749 bp, 582 aa] {ON}
           VBA5Putative transporter of the Major Facilitator
           Superfamily (MFS); proposed role as a basic amino acid
           permease based on phylogeny
          Length = 582

 Score = 34.3 bits (77), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 89/410 (21%), Positives = 159/410 (38%), Gaps = 74/410 (18%)

Query: 97  SIMNVLAKELDSTSSRQAWLMSSFPLALGSFILVSGRLGDIYGLKKILLGGYIITTVWSI 156
           +I++V+A++  + S +  WL++ + L      L+ GR   I G +  L+   +I    S+
Sbjct: 59  TIIDVVAEQFGNYS-KTGWLVTGYSLPNAILSLIWGRFASIIGFQHSLILAILIFEAGSL 117

Query: 157 ICGLSSYAHNDAFFITARAFQGLGLAFALPNMIG--LIGTIYRPGCFRKNMIISIIGAMS 214
           I  L+S  +   F        G GL   L  +IG  ++G   RP      ++ISI+    
Sbjct: 118 IAALASSMNMLIFGRVVAGVGGSGLQ-TLCFVIGCTMVGERSRP------LVISILSCAF 170

Query: 215 PXXXXXXXXXXXXXVKYDKSNWPWSFY---AFGLISFVNLIISWYC--------IPNSIP 263
                           +    W W FY     G ++ +  ++++          I ++I 
Sbjct: 171 AVAAIVGPIIGGAFTTH--VTWRWCFYINLPIGGLAIIMFLLTYKAENKGILQQIKDAIG 228

Query: 264 T-------------NIHGL------KMDWLGSVLGVFGLII----LNFVFNQAPIVGWQS 300
           T             N   L      K D+ G  L   GL++    L F  N+     W S
Sbjct: 229 TISSFTFSKFRHQVNFKRLMNGIIFKFDFFGFALCSAGLVLFLLGLTFGGNK---YSWNS 285

Query: 301 AYIIVLLVLSFCALVIFVVYEV-----------KYAKTPLIPKAISSNRGML---MILFS 346
             +I  LVL     +  +VY+              +  PL+ + + +   ++   M+ F 
Sbjct: 286 GQVITYLVLGVLLFIFSLVYDFFLFDKFNPEPDNISYRPLLLRRLVAKPAIIIVNMVTFL 345

Query: 347 LFCGWGSFGIWTFYYFSFELNLRHYSPLWAGSSYFI-FVISGSTVAIVCGLTIKK---IK 402
           L  G+    I++  +F     L   S  W    + I  VI+    AI  G+  KK   +K
Sbjct: 346 LCTGYNGQMIYSVQFF----QLIFASSAWKAGLHLIPIVITNVIAAIASGVITKKLGLVK 401

Query: 403 PSVLFCCSMMGFLGGNIIFAATPVNQTFFRNMLGCMFLLPLGMDFSFPAS 452
           P ++F   ++G +G  ++   T  N +     +G + L    + F+  AS
Sbjct: 402 PLLIF-GGVLGVIGAGLMTLMT--NTSTKSTQIGVLLLPGFSLGFALQAS 448

>NDAI0D01020 Chr4 complement(229357..231135) [1779 bp, 592 aa] {ON} 
          Length = 592

 Score = 34.3 bits (77), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 38/148 (25%), Positives = 66/148 (44%), Gaps = 7/148 (4%)

Query: 50  STDTADNDE----SSSYQNPDYFKNKYQEFGFIFSGMIGQLLSQAGLTQTLSIMNVLAKE 105
           S DT  ++E    +S    P    +  Q++G +F  ++    S  G       +  L KE
Sbjct: 72  SLDTVPDEEKLEQTSESTAPYTLLSYKQKWGMVFLLVMCGFWSSLGSPIYYPALRQLEKE 131

Query: 106 LDSTSSRQAWLMSSFPLALGSFILVSGRLGDIYGLKKILLGGYIITTVWSIICGLSSYAH 165
            +   ++    +  + L  G    VSG L D++G + I+LGG +I  V SI  GL+  A 
Sbjct: 132 FNMDENKVNVTVVVYLLFQGIAPTVSGGLADVFGRRPIILGGMVIYVVASI--GLAC-AP 188

Query: 166 NDAFFITARAFQGLGLAFALPNMIGLIG 193
           +       R  Q +G++  +    G++G
Sbjct: 189 SYGVICFLRCIQSIGISPTIAISSGVVG 216

>Kwal_23.2794 s23 (15194..17053) [1860 bp, 619 aa] {ON} YHL047C
           (ARN2) - Triacetylfusarinine C transporter [contig 246]
           FULL
          Length = 619

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 28/117 (23%), Positives = 54/117 (46%), Gaps = 3/117 (2%)

Query: 298 WQSAYIIVLLVLSFCALVIFVVYEVKYAKTPLIPKAISSNRGMLMILFSLFCGWGSFGIW 357
           W+SA +I   VL F  + +F+ +E + A  PL P  +  +RG+   L  +F     + + 
Sbjct: 313 WRSAKVIAPFVLGFALVPVFLYWESRIALVPLAPFKMLKDRGIWAPLAIMFLICFIYQMA 372

Query: 358 TFYYFSFELNLRHYSPLWAGSSYFIFVISGSTVAIVCGLTI---KKIKPSVLFCCSM 411
             Y ++  L   + S L A     ++    +  + + G+ +    ++KP  L  CS+
Sbjct: 373 AGYLYTVLLVAANESDLSATRITSLYSFVAAIFSPILGVLVARSTRLKPYTLVGCSL 429

>TDEL0B00140 Chr2 (25633..27531) [1899 bp, 632 aa] {ON} 
          Length = 632

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 49/180 (27%), Positives = 83/180 (46%), Gaps = 12/180 (6%)

Query: 275 GSVLGVFGLIILNFVFNQAPIVGWQSAYIIVLLVLSFCA-LVIFVVYEVKYAKTPLIPKA 333
           G +  +FG I++  V        W++  IIV  V+ +   L IF+ +E K AK PL+   
Sbjct: 297 GLLCALFGCILIPLVLAGGSSNHWRNFRIIVPEVVGWVVVLPIFLTWEAKGAKHPLLTWD 356

Query: 334 ISSNRGM---LMILFSLFCGWGSFGIWTFYYFSFELNLRHYSPLWAGSSY-FIFVISGST 389
              +RG+   L+I F +   +   G + F      L+    +     SSY F+ +I G+ 
Sbjct: 357 FIEDRGILAALIIAFYINFVYHLLGDYLFTVLMITLDQSVLASTRITSSYSFVCIICGTL 416

Query: 390 VAIVCGLTIKKIKPSVLF--CCSMMGFLGGNIIFAATPVNQTFFRNMLGCMFLLPLGMDF 447
           + +V  +  ++ KP ++F   C  +  LG  + F     N+ F   + G + LL LG  F
Sbjct: 417 IGLVI-IRARRTKPFIIFGIGCWFLA-LGLLVHFFG---NRPFMPGVTGSLCLLGLGAGF 471

>KNAG0K01020 Chr11 complement(198213..200012) [1800 bp, 599 aa] {ON}
           
          Length = 599

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 86/367 (23%), Positives = 143/367 (38%), Gaps = 64/367 (17%)

Query: 97  SIMNVLAKELDSTSSRQAWLMSSFPLALGSFILVSGRLG-DIYGLKKILLGGYIITTVWS 155
           +I+N +    D+ + +  W+++ + L      L+ GR+     G K  +L   +I  + S
Sbjct: 80  TIINDVGAHFDAYA-KTGWIIAGYSLPNALMSLLWGRIAFSFLGFKTAMLSAIVIFEIGS 138

Query: 156 IICGLSSYAHNDAFFITARAFQGLGLAFALPNMIGLIG-TIYRPGCFRKNMIISIIGAMS 214
           +IC L   A++    I  R   G+G    + ++  +IG T+  P    +  II+ + A  
Sbjct: 139 LICAL---ANSMDMLIGGRVIAGIG-GSGIQSLSFVIGSTLVSPR--GRGFIIAFMSASF 192

Query: 215 PXXXXXXXXXXXXXVKYDKSNWPWSFYAFGLISFVNLII-SWYCIP---NSIPTNIHGLK 270
                           +    W W F+    +  V L+I +W   P     +   IH LK
Sbjct: 193 GIASVIGPFIGGAFTSH--VTWRWCFWINLPVGAVALVIFTWVYNPTGKKQVLLTIHDLK 250

Query: 271 -----------MDWLGSVLGVFGLIILNFVFNQAPIV-------------GWQSAYIIVL 306
                       D L  +L  F L I+ F+   A IV              W S  II+L
Sbjct: 251 ELSEKVKKVRFKDLLKHLL--FKLDIIEFMLISAGIVCILLAFTFGGNRFKWGSYSIILL 308

Query: 307 LVLSFCALVIFVVYE--------------VKYAKTPLIPKAISSNRGMLMILFSLFCGWG 352
            V+  C +++ +VY+              ++Y   PLI       RG+     + F    
Sbjct: 309 FVIGGCLVIVALVYDFVIFPNLQIVKANYIQY--QPLISWKNLRIRGIFTASMTTFFFCI 366

Query: 353 SFGIWTFYYFSFELNLRHYSPLWAGSSYFIFV-ISGSTVAIVCGLTIKK---IKPSVL-- 406
            +   T YY  F   + + SP W  S + I V I     A+VCG    K   +KP  +  
Sbjct: 367 GYMSQTVYYVQFFQLIYNSSP-WKASIHLIAVMIPTVLTAVVCGFLNGKFGYVKPITVAG 425

Query: 407 FCCSMMG 413
            C +++G
Sbjct: 426 MCLAVIG 432

>Smik_2.434 Chr2 (773094..774518) [1425 bp, 474 aa] {ON} YBR293W
           (REAL)
          Length = 474

 Score = 33.5 bits (75), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 61/257 (23%), Positives = 106/257 (41%), Gaps = 30/257 (11%)

Query: 236 WPWSFYAFGLISFVNLIISWYCIPNSIPTNIHG-----------LKMDWLGSVLGVFGLI 284
           W W F     IS ++ I+  Y +PN    N                +D +GS+L + GL 
Sbjct: 120 WRWCFLIQVPISMISSILMNYYVPNQKEYNDQNSNIFNDPKKILTGIDVMGSILIITGLT 179

Query: 285 ILNFVFN---QAPIVGWQSAYIIVLLVLSFCALVIFVVYEVKYAKTPLIP-KAISSNRGM 340
           +     +       + W S  +++LL  S   L++F+++E K     +IP + +SS+   
Sbjct: 180 LQLLYLSLGCSTSNLSWTSPSVLLLLFGSVIILLLFILHERKTTARAIIPMELVSSSYSF 239

Query: 341 LMILFSLFCGWGSFGIWTFYYFSFELNLRHY---SPLWAGSSYFIFVISGSTVAIVCGLT 397
           +++  S+  G+ S+     Y F+  L  +     S   AG    I  +     +++ G +
Sbjct: 240 VVLSISILVGFASYA----YLFTLPLFFQIVLGDSTAKAGLRLTIPSLFTPVGSLITGFS 295

Query: 398 IKKIK--PSVLFCCSMMGFLGGNIIFAATPVNQTFFRNMLGCMFLLP--LGMDFSFPASS 453
           + K     S+L+    + FL GN +F           N L  +FL+P  LG   +FP + 
Sbjct: 296 MSKYNCLRSLLYLGISLMFL-GNFLFLFIEETSP---NWLISLFLIPANLGQGITFPTTL 351

Query: 454 IILSDSLPMQYQGMAGS 470
                  P   Q  A S
Sbjct: 352 FTFIFMFPKSDQATATS 368

>KLLA0F03168g Chr6 (294261..295817) [1557 bp, 518 aa] {ON} similar
           to uniprot|Q08268 Saccharomyces cerevisiae YOL119C MCH4
           or uniprot|Q08777 Saccharomyces cerevisiae YOR306C MCH5
          Length = 518

 Score = 33.5 bits (75), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 43/158 (27%), Positives = 69/158 (43%), Gaps = 29/158 (18%)

Query: 28  EQQSLKNIDSRSSLNSSLTQVLSTDTADNDESSSYQNPDYFKN--KYQEFGF-----IFS 80
           EQ++ KN+   S +  ++ ++    + DND+  S    DY  +   Y E G      +  
Sbjct: 33  EQRTRKNVIG-SEVGININELQPVQSFDNDDGGSDAYTDYDDDGFTYAEGGIAAWLVVLG 91

Query: 81  GMIGQLLS-----QAGLTQTLSIMNVLAKELDSTSSRQAWLMS-SFPLALGSFILVSGRL 134
             +G L +      AG+ QT    + L    D ++S  +W+ S S  L LG+ +  SG  
Sbjct: 92  SFLGILPTWGLYFSAGVIQTYVARHQLK---DESTSTVSWIFSVSSCLLLGTSVF-SGMY 147

Query: 135 GDIYGLKKILLGGYIITT-----------VWSIICGLS 161
            D YG +K L+ G ++T            VW  I  LS
Sbjct: 148 FDRYGARKPLVIGTVMTVGGVLAVAQCTKVWQFILALS 185

>Kwal_26.9616 s26 (1294683..1296371) [1689 bp, 562 aa] {ON} YPR198W
           (SGE1) - Member of drug-resistance protein family
           [contig 363] FULL
          Length = 562

 Score = 33.5 bits (75), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 61/278 (21%), Positives = 98/278 (35%), Gaps = 64/278 (23%)

Query: 115 WLMSSFPLALGSFILVSGRLGDIYGLKKILLGGYIITTVWSIICGLSSYAHNDAFFITAR 174
           WLM+ + L     +L+ GR+  + GLK  L+   +I    S++  L   A +    I  R
Sbjct: 46  WLMTGYNLPNALCMLLWGRIASLVGLKNSLVASIVIFEAGSLLAAL---ATSMGMLIGGR 102

Query: 175 AFQGLG------LAFAL----------PNMIGLIGTIYRPG------------------- 199
              G G      L FA+            ++ ++G  Y                      
Sbjct: 103 VIAGFGGSGIETLVFAVGTRMVDEKHRARVVTILGIAYMLAEGAGPFIGGAFAEHVSWRW 162

Query: 200 CFRKNMIISIIG------AMSPXXXXXXXXXXXXXVKYDKSNWPWSFYAFGLISFVNLII 253
           CF  N+ I  +         +P               Y K +W   F    L   V L I
Sbjct: 163 CFFINIPIGGVALAILCWGYNPAGRTPINALNHYWKSYRKCSWKKVFRLTSLTKVVKLFI 222

Query: 254 SWYCIPNSIPTNIHGLKMDWLGSVL--GVFGLIILNFVFNQAPIVGWQSAYIIVLLVLSF 311
                           ++D +G +L  G F LI+L   F       W SA II +  +  
Sbjct: 223 ---------------YQLDIVGLLLSSGGFALIMLALTFGGNKF-AWNSASIICMFTIGI 266

Query: 312 CALVIFVVYEVKYAKTPLIPKAISSNRGMLMILFSLFC 349
             L IF++Y+  +   P I + + +   M ++ +SL C
Sbjct: 267 ALLGIFMLYD--FVVLPYIGRRLENGEAMPLVPWSLAC 302

>CAGL0J09020g Chr10 (889269..891839) [2571 bp, 856 aa] {ON} highly
           similar to uniprot|P10870 Saccharomyces cerevisiae
           YDL194w SNF3 or uniprot|Q12300 Saccharomyces cerevisiae
           YDL138w RGT2
          Length = 856

 Score = 33.1 bits (74), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 28/103 (27%), Positives = 52/103 (50%), Gaps = 10/103 (9%)

Query: 110 SSRQAWLMSSFPLALGSFI--LVSGRLGDIYGLKKILLGGYIITTVWSIICGLSSYAHND 167
           +++Q  ++ SF L+LG+F+  L +  + D YG KK ++  +    V+S+   L   AHN 
Sbjct: 161 TAQQLAILVSF-LSLGTFVGALSAPVISDKYGRKKTIM--FSTAVVFSLGNSLQVGAHNI 217

Query: 168 AFFITARAFQGLGLAFALPNMIGLIGTIYRPGCFRKNMIISII 210
              I  R   GLG+      ++  +  +Y+     K++  +II
Sbjct: 218 QLLIAGRVISGLGVG-----LVSAVVPLYQAEAAHKSLRGAII 255

>SAKL0A08228g Chr1 complement(732518..734227) [1710 bp, 569 aa] {ON}
           similar to uniprot|P33335 Saccharomyces cerevisiae
           YPR198W SGE1 Member of drug-resistance protein family
           multicopy suppressor of gal11 null mutation
          Length = 569

 Score = 33.1 bits (74), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 39/67 (58%), Gaps = 1/67 (1%)

Query: 96  LSIMNVLAKELDSTSSRQAWLMSSFPLALGSFILVSGRLGDIYGLKKILLGGYIITTVWS 155
           ++I+N +A + ++ S +  WL++ + L+   F L+ GR   I+G K  L+   II  + S
Sbjct: 41  VTILNTIADKFNAYS-KIGWLITGYSLSNALFTLLWGRFAVIFGSKTTLMVSIIIFEIGS 99

Query: 156 IICGLSS 162
           ++  +S+
Sbjct: 100 LVIAVSN 106

>Suva_8.12 Chr8 complement(20611..22512) [1902 bp, 633 aa] {ON}
           YHL040C (REAL)
          Length = 633

 Score = 33.1 bits (74), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 37/90 (41%), Gaps = 16/90 (17%)

Query: 273 WLGSVLGVF------GLIILNFVFNQAPIVGWQSAYIIVLLVLSFCALVIFVVYEVKYAK 326
           W   V+GV       G I++           W  + +I   VL F  + I  V+E + A+
Sbjct: 292 WKLDVIGVLLMGCSLGCILVPLTLAGGVKTTWNDSRLIGPFVLGFVLIPILWVWEYRVAR 351

Query: 327 TPLIPKAISSNRGMLMILFSLFCGWGSFGI 356
            P+IP  +  +RG+          W S GI
Sbjct: 352 DPIIPYKLVKDRGV----------WSSMGI 371

>SAKL0E00132g Chr5 (3269..5131) [1863 bp, 620 aa] {ON} similar to
           uniprot|P38724 Saccharomyces cerevisiae YHL047C ARN2
           Transporter member of the ARN family of transporters
           that specifically recognize siderophore-iron chelates
           responsible for uptake of iron bound to the siderophore
           triacetylfusarinine C
          Length = 620

 Score = 33.1 bits (74), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 38/159 (23%), Positives = 67/159 (42%), Gaps = 14/159 (8%)

Query: 267 HGL-----KMDWLGSVLGVF------GLIILNFVFNQAPIVGWQSAYIIVLLVLSFCALV 315
           HGL     ++ W   V+GV       G I++           W+SA +I  +VL    + 
Sbjct: 273 HGLVQTLKQLFWKLDVVGVLLFSVSTGCILIPLTVAGGASTHWRSAKVIAPIVLGSVLVP 332

Query: 316 IFVVYEVKYAKTPLIPKAISSNRGMLMILFSLFCGWGSFGIWTFYYFSFELNLRHYSPLW 375
            F+ +E K A  PL P  +  +RG+   L   F     + +   Y ++  L   + S L 
Sbjct: 333 AFIYWESKLALVPLAPFKMLKDRGIWAPLLITFLICFIYMMAAGYLYTILLVAGNESSLS 392

Query: 376 AGSSYFIFVISGSTVAIVCGLTI---KKIKPSVLFCCSM 411
           A     ++    +  + V G+ +    ++KP  +F CS+
Sbjct: 393 ATRITSLYSFVAAVFSPVVGIFVARFSRLKPFAVFGCSL 431

>Kwal_26.7755 s26 (500034..501713) [1680 bp, 559 aa] {ON} YMR088C -
           1:1 [contig 55] FULL
          Length = 559

 Score = 33.1 bits (74), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 34/133 (25%), Positives = 59/133 (44%), Gaps = 8/133 (6%)

Query: 46  TQVLSTDTADNDESSSYQNPDYFKN-KYQEFGFIFSGMIGQLLSQAGLTQTLSIMNVLAK 104
           T++LS    DN+  S  +   + +N    +   + S  +G  L     T   ++MN +A+
Sbjct: 10  TRLLSPVDEDNNVHSILEKEYHEQNLNLPKTPILVSLWLGSFLVALDGTIVANVMNRIAE 69

Query: 105 ELDSTSSRQAWLMSSFPLALGSFILVSGRLGDIYGLKKILLGGYIITTVWSIICGL--SS 162
           E   +  +Q W+ +SF L   +F  + G+L D+   +K    G  +   +    GL  S 
Sbjct: 70  EFQESDKKQ-WIATSFLLTNTAFQPLYGKLSDVATGRK----GAALVAQFFFCLGLVISC 124

Query: 163 YAHNDAFFITARA 175
           +A N   F   RA
Sbjct: 125 FAQNVTQFAVGRA 137

>Smik_11.368 Chr11 complement(649880..651622) [1743 bp, 580 aa] {ON}
           YKR105C (REAL)
          Length = 580

 Score = 33.1 bits (74), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 51/205 (24%), Positives = 85/205 (41%), Gaps = 32/205 (15%)

Query: 270 KMDWLGSVLGVFGLII----LNFVFNQAPIVGWQSAYIIVLLVLSFCALVIFVVYEV--- 322
           K D+LG  L   GL++    L F  N+     W S  II  LVL     V  ++Y+    
Sbjct: 252 KFDFLGFALSSAGLVLFLLGLTFGGNK---YSWNSGQIITYLVLGILLFVFSLIYDFFIF 308

Query: 323 --------KYAKTPLIPKAISSNRGML---MILFSLFCGWGSFGIWTFYYFSFELNLRHY 371
                     +  PL  K + +   ++   M+ F L  G+    I++  +F     L   
Sbjct: 309 QKFNPEPDNTSYRPLFLKRLVAKPAVIIVNMVTFLLCIGYNGQMIYSVQFF----QLIFA 364

Query: 372 SPLWAGSSYFI-FVISGSTVAIVCGLTIKK---IKPSVLFCCSMMGFLGGNIIFAATPVN 427
           S  W    + I  VI+    AI  G+  KK   +KP ++F   ++G +G  ++   +  N
Sbjct: 365 SSAWKAGLHLIPIVITNVIAAIASGVITKKLGLVKPLLIF-GGILGVIGAGLMTLMS--N 421

Query: 428 QTFFRNMLGCMFLLPLGMDFSFPAS 452
            +     +G + L  L + F+  AS
Sbjct: 422 NSTSSTQIGVLILPGLSLGFALQAS 446

>SAKL0A07480g Chr1 complement(658699..660420) [1722 bp, 573 aa] {ON}
           similar to uniprot|P38358 Saccharomyces cerevisiae
           YBR293W VBA2 Permease of basic amino acids in the
           vacuolar membrane
          Length = 573

 Score = 33.1 bits (74), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 49/195 (25%), Positives = 86/195 (44%), Gaps = 19/195 (9%)

Query: 270 KMDWLGSVLGVFGLI--ILNFVFNQAPIVG---WQSAYIIVLLVLSFCALVIFVVYEVKY 324
           K+D  GS+L + GL   ++    N +       W S   I L++L+  +LV+F+  E   
Sbjct: 243 KIDLKGSLLLIVGLASQLMYLTVNSSMASSGSQWLSKESIGLILLTVLSLVMFIHTERTT 302

Query: 325 AKTPLIP-KAISSNRGMLMILFSLFCGWGSFGIWTFYYFSFELNLRHYSPLWAGSSYFIF 383
              P+IP K +S +   ++++ S+  G+ S+     Y F+  L  +      A  + F  
Sbjct: 303 QANPIIPTKLLSQSHSTMVLVISVLVGFVSYA----YLFTLPLFFQIVVGDSAARAGFRL 358

Query: 384 VISGSTVAI---VCGLTIKKIKP-SVLFCCSMMGFLGGNIIFAATPVNQTFFRNMLGCMF 439
            I      I   + GL+++  K    L    M+  + GN  F    + +T     L C+ 
Sbjct: 359 AIPSFCTPIGGLITGLSMRIPKTLPFLLSFGMVLMMIGNAFFL---LLKTTTPEWLVCLL 415

Query: 440 LLP--LGMDFSFPAS 452
           L P  +G   +FPA+
Sbjct: 416 LTPANVGQGVTFPAT 430

>TBLA0B10150 Chr2 (2445764..2447479) [1716 bp, 571 aa] {ON} 
          Length = 571

 Score = 32.7 bits (73), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 47/177 (26%), Positives = 72/177 (40%), Gaps = 27/177 (15%)

Query: 27  PEQQSLKNIDSRSS---LNSSLTQVLSTDTADNDESSSYQNPDYFKNKYQEF-------- 75
           P+   + N D+ SS      SL Q  S D    DE S +   D  K    ++        
Sbjct: 12  PDYMGVVNTDTESSDSQKEDSLKQKFSADNFSGDEKSPHA-IDIPKKPPSDYITVCLNCI 70

Query: 76  -----GFIFS---GMIGQLLSQAGLTQTLSIMNVLAKELDSTSSRQAWLMSSFPL--ALG 125
                GF+     G IG  ++Q    +     N   +   S  +R   L+S F +  A+G
Sbjct: 71  MIAFGGFMMGWDIGTIGGFIAQPDFKRRFGSTNKYGEHYLS-KARTGLLVSIFNIGCAIG 129

Query: 126 SFILVSGRLGDIYGLKKILLGGYIITTVWSIICGLSSYAHNDAFFITARAFQGLGLA 182
           S  L  G +GDIYG +  L+   II  V  ++  ++S      +FI  R   G+G+ 
Sbjct: 130 SVTL--GNIGDIYGRRLGLIIATII-FVAGVVIEIASIDKWYQYFI-GRIISGVGMG 182

>ZYRO0A00330g Chr1 (19597..21327) [1731 bp, 576 aa] {ON} similar to
           uniprot|P38358 Saccharomyces cerevisiae YBR293W VBA2
           Permease of basic amino acids in the vacuolar membrane
          Length = 576

 Score = 32.7 bits (73), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 43/167 (25%), Positives = 74/167 (44%), Gaps = 24/167 (14%)

Query: 298 WQSAYIIVLLVLSFCALVIFVVYEVKYAKTPLIP-KAISSNRGMLMILFSLFCGWGSFGI 356
           W S  +  +LV SF  LV+FV+ E + +   +IP K + S    L++  S+  G+ S+  
Sbjct: 298 WSSPGLSAVLVASFIVLVLFVLTEERTSARAIIPSKLVRSLFSFLVLTISVLVGFASYA- 356

Query: 357 WTFYYFSFELNLRHY---SPLWAGSSYFIFVISGSTVAIVCGLTIKKIKPSVLFCCSMMG 413
              Y F+  L  +     S   AG    I  +      ++ G+ + K       C   + 
Sbjct: 357 ---YLFTLPLFFQVILGDSTAKAGLRLAIPSVFTPVGGLIAGICMSKFN-----CLQTLL 408

Query: 414 FLG------GNIIFAATPVNQTFFRNMLGCMFLLP--LGMDFSFPAS 452
           ++G      GN +F     + T   +++G  FL+P  LG   +FP+S
Sbjct: 409 YVGIAFMCLGNFLFLYIGADAT--DSLIG-FFLIPANLGQGITFPSS 452

>KLTH0A07964g Chr1 complement(670591..672450) [1860 bp, 619 aa] {ON}
           similar to uniprot|P38724 Saccharomyces cerevisiae
           YHL047C ARN2 Transporter member of the ARN family of
           transporters that specifically recognize
           siderophore-iron chelates responsible for uptake of iron
           bound to the siderophore triacetylfusarinine C
          Length = 619

 Score = 32.7 bits (73), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 33/132 (25%), Positives = 59/132 (44%), Gaps = 11/132 (8%)

Query: 298 WQSAYIIVLLVLSFCALVIFVVYEVKYAKTPLIPKAISSNRGMLMILFSLFCGWGSFGIW 357
           W+S  +I   VL F  +  FV +E + A+ PL P  +  +RG+   L+  F     + + 
Sbjct: 313 WRSGKVIAPFVLGFSLIPAFVYWESRLARFPLAPFLMLKDRGIWAPLWIYFLIAFIYEMA 372

Query: 358 TFYYFSFELNLRHYSPLWAGSSYFIFVISGSTVAIVCGLTI---KKIKPSVLFCCSM--- 411
             Y ++  L   + S L A     ++    +  + + GL +    ++KP  +  CS+   
Sbjct: 373 AEYLYTILLVAANESDLSAIRITSLYSFVAAIFSPIVGLLVARSSRLKPYTVVGCSLYFV 432

Query: 412 -MG----FLGGN 418
            MG    + GGN
Sbjct: 433 TMGLFYHYRGGN 444

>TPHA0O00950 Chr15 complement(176003..177682) [1680 bp, 559 aa] {ON}
           Anc_1.432
          Length = 559

 Score = 32.3 bits (72), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 23/90 (25%), Positives = 43/90 (47%), Gaps = 17/90 (18%)

Query: 122 LALGSFI--LVSGRLGDIYGLKKILLGGYIITTVWSIICGLSSYAHNDAFFITARAFQGL 179
           ++ GSF+  L+S  + + +G +  L   ++  T W I   +   +HN A  +  R   G+
Sbjct: 79  MSAGSFVGSLISPTISEAFGRRVSL---HLCATFWIIGAVIQCASHNVAMLVCGRLISGI 135

Query: 180 GLAF------------ALPNMIGLIGTIYR 197
           G+ F            A P + GLIG++++
Sbjct: 136 GVGFGSSAAPVYCSEIAPPKIRGLIGSLFQ 165

>KLTH0D05434g Chr4 (486319..488049) [1731 bp, 576 aa] {ON} similar
           to uniprot|Q04301 Saccharomyces cerevisiae YMR088C VBA1
           Permease of basic amino acids in the vacuolar membrane
          Length = 576

 Score = 32.3 bits (72), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 27/98 (27%), Positives = 46/98 (46%), Gaps = 3/98 (3%)

Query: 83  IGQLLSQAGLTQTLSIMNVLAKELDSTSSRQAWLMSSFPLALGSFILVSGRLGDIYGLKK 142
           +G  L     T   ++MN +A+E   +  +Q W+ +SF L   +F  + G+L D+   +K
Sbjct: 48  LGSFLVALDGTIVANVMNRIAEEFQESDKKQ-WIATSFLLTNTAFQPLYGKLSDVATGRK 106

Query: 143 ILLGGYIITTVWSIICGLSSYAHNDAFFITARAFQGLG 180
             L   I    + +   +S +A N   F   RA  G+G
Sbjct: 107 --LATLIAQFFFFLGLIISCFAQNVTQFAIGRAVCGIG 142

>SAKL0H16808g Chr8 complement(1477137..1479110) [1974 bp, 657 aa]
           {ON} weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 657

 Score = 32.3 bits (72), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 14/48 (29%), Positives = 31/48 (64%)

Query: 114 AWLMSSFPLALGSFILVSGRLGDIYGLKKILLGGYIITTVWSIICGLS 161
           +W+ +++ L+  +F  + G++ DI+G K +L+   ++  +  +ICGLS
Sbjct: 167 SWIATAYLLSSATFQPLYGKISDIFGRKPLLIFSNVMFALGCLICGLS 214

>KLTH0G13464g Chr7 complement(1154304..1156085) [1782 bp, 593 aa]
           {ON} weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 593

 Score = 32.3 bits (72), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 27/138 (19%), Positives = 63/138 (45%), Gaps = 5/138 (3%)

Query: 28  EQQSLKNIDSRSSLNSSLTQVLSTDTADNDESSSY----QNPDYFKNKYQEFGFIFSGMI 83
           +Q  L +I+   +  S+    +S++    D   +      + +++    +    +FS  +
Sbjct: 35  QQDHLLDIEQGRAYGSTTKSSISSENEREDAGGATVAGCGSAEFYLPSSRILIIMFSMFL 94

Query: 84  GQLLSQAGLTQTLSIMNVLAKELDSTSSRQAWLMSSFPLALGSFILVSGRLGDIYGLKKI 143
           G  L+    T   +++  +  E +S   + +W+ +S+ L+  +   + G+L D  G K +
Sbjct: 95  GIFLAALDGTIVSTLLTHIGSEFNSLD-KASWIATSYLLSSSTCQPLYGKLSDRLGRKPL 153

Query: 144 LLGGYIITTVWSIICGLS 161
           L+    +  +  +ICGLS
Sbjct: 154 LVFSNAVFAIGCLICGLS 171

>KLTH0C10142g Chr3 (842371..844092) [1722 bp, 573 aa] {ON} similar
           to uniprot|P33335 Saccharomyces cerevisiae YPR198W SGE1
           Member of drug-resistance protein family multicopy
           suppressor of gal11 null mutation
          Length = 573

 Score = 32.3 bits (72), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 73/358 (20%), Positives = 135/358 (37%), Gaps = 70/358 (19%)

Query: 111 SRQAWLMSSFPLALGSFILVSGRLGDIYGLKKILLGGYIITTVWSIICGLSSYAHNDAFF 170
           +R  WL++ + L    F L+ GRL  I GLK  L    +I  + S+I  +S   ++    
Sbjct: 42  ARIGWLVTGYALPNALFTLLWGRLASILGLKTSLTFSIVIFEIGSLIVAVS---NSMGMI 98

Query: 171 ITARAFQGLGLAFALPNMIGLIGTIYRPGCFRKNMIISIIG-------AMSPXXXXXXXX 223
           I  R   G G    + +++ ++GT       R  M+I+++G       A+ P        
Sbjct: 99  IGGRVVAGCG-GSGIQSLVFVVGTSLVEERNR-GMVITVLGLAFAVAFAVGPVIGGAFT- 155

Query: 224 XXXXXVKYDKSNWPWSFY---AFGLISFVNLIISWYCIPNSIPT---------------- 264
                   +  +W W FY     G ++   L  S+     S+                  
Sbjct: 156 --------ENVSWRWCFYINLPIGGVALTMLTFSYNTTEKSVQETLTYNCRQLQTYRYGQ 207

Query: 265 -----------NIHGLKMDWLGSVLGVFGLIIL---------NFVFNQAPIVGWQSAYII 304
                      N     +D++G  L   G ++           + +N   I+ + +   I
Sbjct: 208 WVTASFWRRAYNFLMFDLDFIGFALSSTGFVLFMLGLTFGGNTYAWNSGTIISFLTVGAI 267

Query: 305 VL---LVLSFCALVIFVVYEVKYAKTPLIPKAISSNRGMLM-ILFSLFCGWGSFGIWTFY 360
           ++   LV  F  L  +  +  K   TPL+ +++    G+    + +LF  +G F + T Y
Sbjct: 268 LVLFWLVFDFVLLYKWAAWCRKREATPLLRRSLCFRPGIFTSSIANLFTCFG-FNMQTVY 326

Query: 361 YFSFELNLRHYSPLWAGSSYFIFVISGSTVAIVCGLTIK---KIKPSVLF--CCSMMG 413
                  + +  P  A    + F+I+     I+ G        IKP+++F   C ++G
Sbjct: 327 IVQLYQLVFNSGPTAASMHLWAFLIATMVSVIIIGKAAAIFGLIKPAIVFGATCGLVG 384

>KLTH0E04400g Chr5 (397784..399256) [1473 bp, 490 aa] {ON} weakly
           similar to uniprot|Q08777 Saccharomyces cerevisiae
           YOR306C MCH5
          Length = 490

 Score = 32.0 bits (71), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 57/255 (22%), Positives = 100/255 (39%), Gaps = 33/255 (12%)

Query: 27  PEQQSLKNIDSRSSLNSSLTQVLSTDTADNDESSSYQNPDYFKNKYQEFGF-IFSGMIGQ 85
           P QQ    +   S + ++++   S      +    Y  PD F+  Y E G+  +  ++G 
Sbjct: 4   PGQQEAPGLTESSKVLANIST--SQGKKREEVVEDYSVPDEFE--YAEGGWKAWMAILGS 59

Query: 86  LLS---------QAGLTQTLSIMNVLAKELDSTSSRQAWLMSSFPLAL-GSFILVSGRLG 135
            L           AG+ Q     N LA    ST S   W+ S +   L GSF+  SG   
Sbjct: 60  FLGFFPTWGFFYTAGVMQNYIAKNQLATASTSTIS---WVFSVYNFCLLGSFVF-SGLYF 115

Query: 136 DIYGLKK-ILLGGYIITTVWSIICGLSSYAHNDAFFITARAFQGLGLAFALPNMIGLIGT 194
           D+ G ++ ++LG  +  T    +   +   H   F +      G+G   +   +IG++  
Sbjct: 116 DLNGARRPLILGNVMFLTGMFALGNCTKVWH---FIVCLGILVGMGSGISSSPLIGVV-- 170

Query: 195 IYRPGC--FRKNMIISIIGAMSPXXXXXXXXXXXXXVKYDKSNWPWSFYAFGLISFVNLI 252
                C  F +   I+   AM+                ++KS +PW+  + G +S   L+
Sbjct: 171 -----CHHFNRRRGIATALAMNGGSIGGVVIPLMLRSLFEKSGYPWAMRSLGFLSTGFLV 225

Query: 253 ISWYCIPNSIPTNIH 267
            S + +    P  +H
Sbjct: 226 CSVF-LAREDPAKLH 239

>KLTH0B00110g Chr2 complement(1655..3538) [1884 bp, 627 aa] {ON}
           similar to uniprot|P25596 Saccharomyces cerevisiae
           YCL073C and similar to uniprot|P36173 Saccharomyces
           cerevisiae YKR106W
          Length = 627

 Score = 32.3 bits (72), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 12/43 (27%), Positives = 26/43 (60%)

Query: 298 WQSAYIIVLLVLSFCALVIFVVYEVKYAKTPLIPKAISSNRGM 340
           W    II  +V+ F + + F+ +++K+AK  ++P  +  +RG+
Sbjct: 320 WNKPGIIATIVVGFVSFMFFLAWDIKFAKNAVLPFKLLKDRGV 362

>NCAS0C03460 Chr3 complement(690089..691981) [1893 bp, 630 aa] {ON} 
          Length = 630

 Score = 32.0 bits (71), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 41/84 (48%), Gaps = 4/84 (4%)

Query: 97  SIMNVLAKELDSTSSRQAWLMSSFPLALGSFILVSGRLGDIYGLKKILLGGYIITTVWSI 156
           +I+  +AK+  + S +  W+ + + L      L+ GR+  I G K  +L   II  + S+
Sbjct: 100 TIIEDVAKKFGAYS-KTGWIFAGYSLPNALLALLWGRIASIIGFKSCMLAAIIIFEIGSL 158

Query: 157 ICGLSSYAHNDAFFITARAFQGLG 180
           I G+   A++    I  R   G+G
Sbjct: 159 ISGV---ANSMNMLIGGRVIAGVG 179

>ZYRO0D13310g Chr4 complement(1118820..1120670) [1851 bp, 616 aa]
           {ON} similar to uniprot|P43581 Saccharomyces cerevisiae
           YFL011W HXT10 Putative hexose transporter expressed at
           low levels and expression is repressed by glucose
          Length = 616

 Score = 32.0 bits (71), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 38/75 (50%), Gaps = 7/75 (9%)

Query: 76  GFIF---SGMIGQLLSQAGLTQTLSIMNVLAKELDSTSSRQAWLMSSFPL--ALGSFILV 130
           GF+F   +G I   ++     +     +   +E   + +R   ++S F +  A+G F L 
Sbjct: 129 GFVFGWDTGTISGFINMTDFKRRFGHWDSTNEEFQLSEARMGLIVSVFNVGCAIGGFTL- 187

Query: 131 SGRLGDIYGLKKILL 145
            GRLGDIYG ++ L+
Sbjct: 188 -GRLGDIYGRREGLM 201

>KLLA0D19941g Chr4 complement(1698889..1700724) [1836 bp, 611 aa]
           {ON} similar to uniprot|P36172 Saccharomyces cerevisiae
           YKR105C Hypothetical ORF
          Length = 611

 Score = 32.0 bits (71), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 36/137 (26%), Positives = 61/137 (44%), Gaps = 17/137 (12%)

Query: 298 WQSAYIIVLLVLSFCALVIFVVYEV-----------KYAKTPLIPKAISSNRGMLMILFS 346
           W+SA +I  L++ F   V+ VVY+              +  P++ K + +NR +L+    
Sbjct: 304 WKSAIVICFLIVGFLLSVLSVVYDFYIFDKINPEPSNLSFRPMLVKGLLNNRFILLPNLV 363

Query: 347 LFCGWGSFGIWTFYYFSFELNLRHYSPLW-AGSSYFIFVISGSTVAIVCGLTIKK---IK 402
                 +F  +  Y   F   L   S  W AG      VI+    AI+CG  +KK   +K
Sbjct: 364 TCASAIAFSGYMLYSVQF-FQLVMGSSAWNAGLHLIPLVIASIVSAIICGGIMKKTGQVK 422

Query: 403 PSVLFCCSMMGFLGGNI 419
           P ++   S++  +GG +
Sbjct: 423 PLMISTVSIL-LIGGGV 438

>YHL040C Chr8 complement(19088..20971) [1884 bp, 627 aa] {ON}
           ARN1Transporter, member of the ARN family of
           transporters that specifically recognize
           siderophore-iron chelates; responsible for uptake of
           iron bound to ferrirubin, ferrirhodin, and related
           siderophores
          Length = 627

 Score = 32.0 bits (71), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 21/90 (23%), Positives = 38/90 (42%), Gaps = 16/90 (17%)

Query: 273 WLGSVLGVF------GLIILNFVFNQAPIVGWQSAYIIVLLVLSFCALVIFVVYEVKYAK 326
           W+  V+GV       G I++           W  + +I   VL F  + I  ++E ++A+
Sbjct: 287 WMLDVVGVLLMGCSLGCILVPLTLAGGVKTTWNDSRLIGPFVLGFVLIPILWIWEYRFAR 346

Query: 327 TPLIPKAISSNRGMLMILFSLFCGWGSFGI 356
            P++P  +  +R +          W S GI
Sbjct: 347 DPILPYRLVKDRAV----------WSSMGI 366

>Smik_16.81 Chr16 complement(152022..153515,153516..153899) [1878
           bp, 625 aa] {ON} YGR224W (REAL)
          Length = 625

 Score = 32.0 bits (71), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 40/84 (47%), Gaps = 4/84 (4%)

Query: 97  SIMNVLAKELDSTSSRQAWLMSSFPLALGSFILVSGRLGDIYGLKKILLGGYIITTVWSI 156
           +I+  +AK+L S S    WL + + L     +L+ GR+    G K  +L   +I  + S+
Sbjct: 83  TIIEEVAKQLGSYS-EIGWLFTGYSLPNALLVLIWGRIATPIGFKATMLFAIVIFEIGSL 141

Query: 157 ICGLSSYAHNDAFFITARAFQGLG 180
           I  L+S  +     I  R   G+G
Sbjct: 142 ISALASSMN---MLIGGRVIAGIG 162

>KLLA0B05841g Chr2 complement(522241..527877) [5637 bp, 1878 aa]
           {ON} highly similar to uniprot|P38631 Saccharomyces
           cerevisiae YLR342W FKS1 Catalytic subunit of 1 3-beta-D-
           glucan synthase functionally redundant with alternate
           catalytic subunit Gsc2p binds to regulatory subunit
           Rho1p involved in cell wall synthesis and maintenance
           localizes to sites of cell wall remodeling or
           uniprot|P40989 Saccharomyces cerevisiae YGR032W GSC2
          Length = 1878

 Score = 32.0 bits (71), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 39/80 (48%), Gaps = 4/80 (5%)

Query: 245 LISFVNLIISWYCIPNSIPTNIHGLKMDW-LGSVLGV-FGLIILNFVFNQAPIVGWQSAY 302
           +I  V  I  W+ +P +     H  +  W L  +LGV  G II  FVF   P+  +  A 
Sbjct: 504 IIQIVATISEWFFVPRNWAGAQHLSRRFWFLVGILGVNLGPII--FVFAYDPLTVYSKAA 561

Query: 303 IIVLLVLSFCALVIFVVYEV 322
           ++V  V+ F AL+  + + +
Sbjct: 562 LVVSAVMFFVALITIIFFSI 581

>SAKL0D04510g Chr4 complement(360010..361605) [1596 bp, 531 aa] {ON}
           similar to uniprot|P36035 Saccharomyces cerevisiae
           YKL217W JEN1 Lactate transporter, required for uptake of
           lactate and pyruvate; expression is derepressed by
           transcriptional activator Cat8p under nonfermentative
           growth conditions, and repressed in the presence of
           glucose, fructose, and mannose
          Length = 531

 Score = 31.6 bits (70), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 42/90 (46%), Gaps = 3/90 (3%)

Query: 92  LTQTLSIMNVLAKELDSTSSRQAWLMSSFPLALGSFILVSGRLGDIYGLKKILLGGYIIT 151
            T TL++  + + + D T+ +  W ++   +      ++ G +GD YG K   +      
Sbjct: 92  FTVTLNVKKI-SHDFDVTTKQVTWGITLVLMLRVVGAVLFGYIGDRYGRKVSFIINLFFM 150

Query: 152 TVWSIICGLSSYAHNDAFFITARAFQGLGL 181
            V  II G     HN  +F+ ARAF G+ L
Sbjct: 151 MVLEIITGF--IKHNFKYFLIARAFFGVVL 178

>KLTH0C10120g Chr3 (839780..841735) [1956 bp, 651 aa] {ON} similar
           to uniprot|P33335 Saccharomyces cerevisiae YPR198W SGE1
           Member of drug-resistance protein family multicopy
           suppressor of gal11 null mutation
          Length = 651

 Score = 31.6 bits (70), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 74/348 (21%), Positives = 132/348 (37%), Gaps = 57/348 (16%)

Query: 115 WLMSSFPLALGSFILVSGRLGDIYGLKKILLGGYIITTVWSIICGLSSYAHNDAFFITAR 174
           WL++ + L+   F L+ GR+  + GLK  L+   +I  + S+I  +S   ++    I  R
Sbjct: 82  WLVTGYSLSSALFTLLWGRMASLLGLKTCLMLSVLIFEIGSLIAAVS---NSMGMLIAGR 138

Query: 175 AFQGLGLAFALPNMIGLIGTIYRPGCFRKNMIISIIGAMSPXXXXXXXXXXXXXVKYDKS 234
              G G    + +++ ++GT       R  +I+ +  A                   + +
Sbjct: 139 VVAGAG-GSGIQSLVYIVGTSLVSERSRGMVIMVLTFAF---VGSNAGGPILGGALNEHA 194

Query: 235 NWPWSFYAFGLISFVNLIISWYCI-PNSIP-----------------TNIHGLKMDWLGS 276
           +W W F+    I      + + C  P+  P                 +N+   K  W  +
Sbjct: 195 SWRWCFFINLPIGGAAAFMLFLCYNPSGKPLLSTLTSKLEAARDYRYSNVCTRKF-WAHA 253

Query: 277 V-LGVFGLIILNFVFNQAPIV-------------GWQSAYIIVLLVLSFCALVIFVVYE- 321
           + LGVF   I+ F  + A  V              W S   I  L +    +V+F +Y+ 
Sbjct: 254 LDLGVFRFDIIGFALSSAGFVLLLLGLTFGGRKYSWSSGTTIAYLTVGPVLIVVFCLYDF 313

Query: 322 ---------VKYAK--TPLIPKAISSNRGMLMILFSLFCGWGSFGIWTFYYFSFELNLRH 370
                    + Y+   TPL+P  + S  G+    F+ F  + ++ +   Y   F   + +
Sbjct: 314 LVLPVLARSLAYSSEVTPLVPWPVISKPGVFATSFASFFNFFAYNMQIIYLVQFYQVVHN 373

Query: 371 YSPLWAGSSYFIFVISGSTVAIVCGLTIKK---IKPSVLF--CCSMMG 413
            SP  A +  +   I    V IV G   KK   +KP  +    C  +G
Sbjct: 374 ESPTNASTHMWALSIPALVVIIVLGRINKKFGILKPVAVIGAACGTIG 421

>KLLA0F03311g Chr6 (311639..313267) [1629 bp, 542 aa] {ON} similar
           to uniprot|P53943 Saccharomyces cerevisiae YNL065W AQR1
           Plasma membrane transporter of the major facilitator
           superfamily that confers resistance to short- chain
           monocarboxylic acids and quinidine
          Length = 542

 Score = 31.6 bits (70), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 43/178 (24%), Positives = 74/178 (41%), Gaps = 32/178 (17%)

Query: 28  EQQSLKNIDSRSSLNSSLTQVLSTDTAD----------------NDESSSYQNPDYFKNK 71
           ++++  N  S SS+  ++T+ L  DT D                  E  S ++  Y    
Sbjct: 18  KKKNCDNTGSESSVFRTVTRELRDDTDDVVTHEIYDEESFPDGSKQEQLSEEDVPYTLLT 77

Query: 72  YQEFGFIFSGMIGQLLSQAGLTQTLS------IMNVLAKELDSTSSRQAWLMSSFPLALG 125
           Y++  F+ +     LL+ AG   +L        +  L  E D         +  + L  G
Sbjct: 78  YRQKWFMVA-----LLTSAGFWSSLGSPIYYPALKELEAEFDVNEELINITVVVYLLFQG 132

Query: 126 SFILVSGRLGDIYGLKKILLGGYIITTVWSIICGLS-SYAHNDAFFITARAFQGLGLA 182
               +SG L D+YG + I+L G +I  + SI  GL+ S ++    F+  R  Q  G++
Sbjct: 133 IAPTISGGLADVYGRRPIILLGMLIYVIASI--GLACSKSYGAVVFL--RCLQSAGIS 186

>KAFR0J00930 Chr10 (168674..170374) [1701 bp, 566 aa] {ON} Anc_2.242
           YNL065W
          Length = 566

 Score = 31.6 bits (70), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 36/162 (22%), Positives = 67/162 (41%), Gaps = 11/162 (6%)

Query: 28  EQQSLKNIDSRSSLNSSLTQVLSTDTADNDESSSY-----QN-PDYFKNKYQEFGFIFSG 81
           + Q L    SR++ N       S++ + +++   +     QN P       Q++  +F  
Sbjct: 37  DYQKLHGTISRTTTNELGDDDTSSECSHDEQEQQHIVEGEQNYPHTLLTYRQKWFMVFLM 96

Query: 82  MIGQLLSQAGLTQTLSIMNVLAKELDSTSSRQAWLMSSFPLALGSFILVSGRLGDIYGLK 141
            I    S  G       +  L ++ +   ++    +  + L  G    +SG L D+YG +
Sbjct: 97  TITGFWSSLGSPIYYPALKELEQKFNIDENKVNVTVVVYLLFQGVAPAISGGLADVYGRR 156

Query: 142 KILLGGYIITTVWSI-ICGLSSYAHNDAFFITARAFQGLGLA 182
            ++LGG +I  V SI I    SY       +  R  Q +G++
Sbjct: 157 PVILGGMLIFVVASIGIAKAPSY----GVIVFLRCIQSIGIS 194

>Kwal_56.23754 s56 complement(690851..692620) [1770 bp, 589 aa] {ON}
           YBR293W - Hypothetical ORF [contig 173] FULL
          Length = 589

 Score = 31.2 bits (69), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 26/136 (19%), Positives = 63/136 (46%), Gaps = 2/136 (1%)

Query: 28  EQQSLKNIDSRSSLNSSLTQVLSTDTADNDES-SSYQNPDYFKNKYQEFGFIFSGMIGQL 86
           EQQ   +     S  ++     +  +A  D +    + P++  +  +    + S  +G  
Sbjct: 34  EQQDYNSRTGHDSYGATAVDDRTATSARCDLTFPPSETPEFALSSSRIRIIMISMFLGIF 93

Query: 87  LSQAGLTQTLSIMNVLAKELDSTSSRQAWLMSSFPLALGSFILVSGRLGDIYGLKKILLG 146
           L+    T   +++  +  E +S   + +W+ +S+ L+  +   + G+L D  G K +L+ 
Sbjct: 94  LAALDGTIVSTLLTRIGSEFNSLD-KVSWIATSYLLSSSTCQPLYGKLSDQLGRKPLLVF 152

Query: 147 GYIITTVWSIICGLSS 162
             ++ ++  +ICG+S+
Sbjct: 153 SNVVFSIGCLICGMST 168

>TDEL0G03260 Chr7 (605429..607267) [1839 bp, 612 aa] {ON} 
          Length = 612

 Score = 31.2 bits (69), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 39/84 (46%), Gaps = 4/84 (4%)

Query: 97  SIMNVLAKELDSTSSRQAWLMSSFPLALGSFILVSGRLGDIYGLKKILLGGYIITTVWSI 156
           +I+  +A+E     S+  W+ + + L      L+ GR+  + G K  +L   II  V S+
Sbjct: 77  TIIENVAREFGD-YSKTGWIYAGYSLPSALLTLIWGRIAAVCGFKSSMLTAIIIFEVGSL 135

Query: 157 ICGLSSYAHNDAFFITARAFQGLG 180
           +  L   A++    I  R   GLG
Sbjct: 136 VAAL---ANSMDMLIGGRVIAGLG 156

>TPHA0C01450 Chr3 complement(329744..332848) [3105 bp, 1034 aa] {ON}
           Anc_7.185 YFR030W
          Length = 1034

 Score = 31.2 bits (69), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 20/76 (26%), Positives = 40/76 (52%), Gaps = 2/76 (2%)

Query: 28  EQQSLKNIDSRSSLNSSLTQVLSTDTADNDESSSYQNPDYFKNKYQEFGFIFSGMIGQLL 87
           ++Q++K I+S  S+N +   VL  D  +        N +YF +++ E  F+  G+I   L
Sbjct: 203 DEQAIKEIESHLSVNPTFEDVL--DEFNETTGQKLHNFEYFGDRHAETVFVTYGVIENQL 260

Query: 88  SQAGLTQTLSIMNVLA 103
            +  +  +LS + +L+
Sbjct: 261 FKDSIEGSLSKVGLLS 276

>Skud_15.474 Chr15 complement(829767..831335) [1569 bp, 522 aa] {ON}
           YOR306C (REAL)
          Length = 522

 Score = 31.2 bits (69), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 49/205 (23%), Positives = 83/205 (40%), Gaps = 36/205 (17%)

Query: 25  KNPEQQSLKNIDSRSSLNSSLTQVLSTDTADNDESSSYQN-PDY-FKNKYQEFGFIFSGM 82
           K  E ++  +I+ R   + + ++   +D+ + D +   +N P+   K     FG  F G+
Sbjct: 61  KKAEHKT-TDIEGRPHWSETTSRTHESDSEEGDSNGEAENFPEGGLKAWVVTFG-CFLGL 118

Query: 83  IG--QLLSQAGLTQTLSIMNVLAKELDSTSSRQAWLMSSFPLALGSFILVSGRLGDIYGL 140
           I    LL+  G+ ++    N LA E  ST     WL S F     +  ++SG   D  G 
Sbjct: 119 IACFGLLNSTGVIESHLQDNQLANESVST---IGWLFSLFLFVCFASCIISGTYFDRNGF 175

Query: 141 KKILLGGYII-----------TTVW------SIICG------LSSYAHNDAFFITARAFQ 177
           + I++ G +            T  W      +I+CG      LS      A +     F+
Sbjct: 176 RTIMIVGTVFHVAGLFATANSTKYWHFILSFAIVCGFGNGIVLSPLVSVPAHYF----FK 231

Query: 178 GLGLAFALPNMIGLIGTIYRPGCFR 202
             G A A+  + G +G +  P   R
Sbjct: 232 RRGTALAMATIGGSVGGVVFPIMLR 256

>CAGL0B02189g Chr2 complement(202354..205617) [3264 bp, 1087 aa]
           {ON} highly similar to uniprot|P30822 Saccharomyces
           cerevisiae YGR218w CRM1
          Length = 1087

 Score = 31.2 bits (69), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 23/45 (51%)

Query: 32  LKNIDSRSSLNSSLTQVLSTDTADNDESSSYQNPDYFKNKYQEFG 76
           L + D+RS     LT+V S D  DN+ S   Q   YF+N  Q+  
Sbjct: 243 LASADTRSVTLKCLTEVSSLDLPDNNSSMQQQTVQYFQNTLQQIA 287

>Ecym_4298 Chr4 complement(636605..638641) [2037 bp, 678 aa] {ON}
           similar to Ashbya gossypii AGR076C
          Length = 678

 Score = 31.2 bits (69), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 40/145 (27%), Positives = 73/145 (50%), Gaps = 14/145 (9%)

Query: 28  EQQSLKNIDSRSS--LNSSLTQVLSTDTADNDE-------SSSYQ--NPDYFKNKYQ-EF 75
           ++ SL +  S+S+  LNSS     +T T D+++       SSS +  N    +N  Q  F
Sbjct: 92  QELSLGSAGSQSTTILNSSYGSTSTTVTPDSNKNGNVFIRSSSVEVGNIGDSQNISQIRF 151

Query: 76  GFIFSGMI-GQLLSQAGLTQTLSIMNVLAKELDSTSSRQAWLMSSFPLALGSFILVSGRL 134
             I S ++ G  L     T   ++++ +A E ++     +W+ +S+ L+   F  + G+L
Sbjct: 152 AAIVSSLVVGVFLGSLDGTILSTLLDYIASEFEALP-YISWIAASYLLSACIFQPLYGKL 210

Query: 135 GDIYGLKKILLGGYIITTVWSIICG 159
            DI+G K ILL   ++  +  ++CG
Sbjct: 211 SDIFGRKAILLFSNLMFGLGCLVCG 235

>TDEL0F03990 Chr6 (740471..742366) [1896 bp, 631 aa] {ON} Anc_8.272
           YDR119W
          Length = 631

 Score = 31.2 bits (69), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 15/52 (28%), Positives = 32/52 (61%)

Query: 111 SRQAWLMSSFPLALGSFILVSGRLGDIYGLKKILLGGYIITTVWSIICGLSS 162
           S+ +W+ +S+ L+  +F  + G++ DI+G K +L+   +   +  ++CGLS 
Sbjct: 146 SKVSWIATSYLLSSATFQPLYGKVSDIFGRKCLLVFTNVAFLIGCLMCGLSK 197

>Smik_8.1 Chr8 complement(2797..4680) [1884 bp, 627 aa] {ON} YHL040C
           (REAL)
          Length = 627

 Score = 30.8 bits (68), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 19/93 (20%), Positives = 40/93 (43%), Gaps = 16/93 (17%)

Query: 270 KMDWLGSVLGVF------GLIILNFVFNQAPIVGWQSAYIIVLLVLSFCALVIFVVYEVK 323
           ++ W+  ++GV       G I++           W  + +I   VL F  + +  ++E +
Sbjct: 284 QLFWMLDIIGVLLMGCSLGCILVPLTLAGGVKTTWNDSRLIGPFVLGFVLIPVLWIWEYR 343

Query: 324 YAKTPLIPKAISSNRGMLMILFSLFCGWGSFGI 356
           +A+ P++P  +  +R +          W S GI
Sbjct: 344 FARDPILPYKLVKDRAV----------WSSMGI 366

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.325    0.140    0.434 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 52,870,338
Number of extensions: 2168747
Number of successful extensions: 8986
Number of sequences better than 10.0: 239
Number of HSP's gapped: 9100
Number of HSP's successfully gapped: 263
Length of query: 550
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 435
Effective length of database: 40,294,809
Effective search space: 17528241915
Effective search space used: 17528241915
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 68 (30.8 bits)