Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0D032608.839ON76873834660.0
ZYRO0G14168g8.839ON76467523000.0
TDEL0B005808.839ON71367522940.0
CAGL0M02959g8.839ON75867822650.0
Kpol_1068.98.839ON74567922380.0
KAFR0B039108.839ON72468021770.0
NCAS0C004208.839ON72568021310.0
TPHA0I002408.839ON73268021290.0
NDAI0K004208.839ON77870820430.0
KNAG0J002808.839ON74268719900.0
SAKL0D01496g8.839ON68863119430.0
YMR277W (FCP1)8.839ON73268119290.0
Skud_13.4498.839ON73468119220.0
Smik_13.4908.839ON73268019170.0
Suva_13.4658.839ON73268119140.0
Ecym_46108.839ON75163818850.0
ABL127W8.839ON72863618610.0
Kwal_27.102638.839ON74363518600.0
KLTH0C03894g8.839ON74563418570.0
KLLA0D01595g8.839ON71962617410.0
Smik_12.825.202ON392451010.002
TPHA0E030705.202ON49451990.003
YLR019W (PSR2)5.202ON39745980.003
Skud_12.875.202ON39245940.010
SAKL0G12870g5.202ON39945940.010
NCAS0A068005.202ON47351940.012
NDAI0D018605.202ON51451920.020
Suva_10.995.202ON38545890.048
KNAG0M017405.202ON48145890.052
NDAI0I021705.202ON39145880.062
TPHA0N006705.202ON45241880.068
NCAS0D027405.202ON39845850.13
ZYRO0B10428g5.202ON48240850.14
TBLA0C060905.202ON48451850.14
KLLA0F15620g5.202ON41445840.16
YLL010C (PSR1)5.202ON42742830.23
Smik_12.535.202ON41442830.26
CAGL0D03234g5.202ON41045820.27
Ecym_72764.156ON59381830.29
Suva_10.655.202ON41542820.30
ADR369C7.46ON82748830.31
TDEL0E042705.202ON45340820.34
CAGL0D05610g5.202ON44740810.41
Ecym_71045.202ON49240810.43
KAFR0A065604.156ON55583790.83
Skud_12.575.202ON41540781.0
Kpol_1010.615.94ON93280781.1
Kpol_2002.1005.202ON47745781.1
AAL158W5.202ON47840771.2
SAKL0E03014g2.472ON830124771.6
Kwal_33.151405.202ON41040751.9
NCAS0B062202.293ON48633752.0
AGR014W2.492aON21980742.0
KAFR0J009905.202ON48345742.7
TPHA0A051105.94ON106560752.9
NCAS0B080801.216ON4108160753.2
SAKL0H20592g4.156ON50881724.7
TPHA0H010705.94ON1015139725.9
CAGL0L06644g5.94ON82863717.1
YOL115W (PAP2)3.58ON584107717.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0D03260
         (768 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0D03260 Chr4 (810350..812656) [2307 bp, 768 aa] {ON} Anc_8.8...  1339   0.0  
ZYRO0G14168g Chr7 (1128601..1130895) [2295 bp, 764 aa] {ON} simi...   890   0.0  
TDEL0B00580 Chr2 complement(111408..113549) [2142 bp, 713 aa] {O...   888   0.0  
CAGL0M02959g Chr13 (332990..335266) [2277 bp, 758 aa] {ON} simil...   877   0.0  
Kpol_1068.9 s1068 complement(15966..18203) [2238 bp, 745 aa] {ON...   866   0.0  
KAFR0B03910 Chr2 (811940..814114) [2175 bp, 724 aa] {ON} Anc_8.8...   843   0.0  
NCAS0C00420 Chr3 complement(65252..67429) [2178 bp, 725 aa] {ON}...   825   0.0  
TPHA0I00240 Chr9 (43854..46052) [2199 bp, 732 aa] {ON} Anc_8.839...   824   0.0  
NDAI0K00420 Chr11 complement(94101..96437) [2337 bp, 778 aa] {ON...   791   0.0  
KNAG0J00280 Chr10 complement(41831..44059) [2229 bp, 742 aa] {ON...   771   0.0  
SAKL0D01496g Chr4 complement(120202..122268) [2067 bp, 688 aa] {...   753   0.0  
YMR277W Chr13 (820256..822454) [2199 bp, 732 aa] {ON}  FCP1Carbo...   747   0.0  
Skud_13.449 Chr13 (793592..795796) [2205 bp, 734 aa] {ON} YMR277...   744   0.0  
Smik_13.490 Chr13 (803288..805486) [2199 bp, 732 aa] {ON} YMR277...   743   0.0  
Suva_13.465 Chr13 (802947..805145) [2199 bp, 732 aa] {ON} YMR277...   741   0.0  
Ecym_4610 Chr4 (1188871..1191126) [2256 bp, 751 aa] {ON} similar...   730   0.0  
ABL127W Chr2 (156798..158984) [2187 bp, 728 aa] {ON} Syntenic ho...   721   0.0  
Kwal_27.10263 s27 complement(268744..270975) [2232 bp, 743 aa] {...   721   0.0  
KLTH0C03894g Chr3 complement(339897..342134) [2238 bp, 745 aa] {...   719   0.0  
KLLA0D01595g Chr4 complement(141459..143618) [2160 bp, 719 aa] {...   675   0.0  
Smik_12.82 Chr12 (167115..168293) [1179 bp, 392 aa] {ON} YLR019W...    44   0.002
TPHA0E03070 Chr5 (644651..646135) [1485 bp, 494 aa] {ON} Anc_5.2...    43   0.003
YLR019W Chr12 (180288..181481) [1194 bp, 397 aa] {ON}  PSR2Funct...    42   0.003
Skud_12.87 Chr12 (172096..173274) [1179 bp, 392 aa] {ON} YLR019W...    41   0.010
SAKL0G12870g Chr7 (1100535..1101734) [1200 bp, 399 aa] {ON} simi...    41   0.010
NCAS0A06800 Chr1 (1346677..1348098) [1422 bp, 473 aa] {ON} Anc_5...    41   0.012
NDAI0D01860 Chr4 (437370..438914) [1545 bp, 514 aa] {ON} Anc_5.202     40   0.020
Suva_10.99 Chr10 (186341..187498) [1158 bp, 385 aa] {ON} YLR019W...    39   0.048
KNAG0M01740 Chr13 (321477..322922) [1446 bp, 481 aa] {ON} Anc_5....    39   0.052
NDAI0I02170 Chr9 (498399..499574) [1176 bp, 391 aa] {ON} Anc_5.202     39   0.062
TPHA0N00670 Chr14 complement(147329..148687) [1359 bp, 452 aa] {...    39   0.068
NCAS0D02740 Chr4 complement(525116..526312) [1197 bp, 398 aa] {O...    37   0.13 
ZYRO0B10428g Chr2 (823155..824603) [1449 bp, 482 aa] {ON} simila...    37   0.14 
TBLA0C06090 Chr3 complement(1478726..1480180) [1455 bp, 484 aa] ...    37   0.14 
KLLA0F15620g Chr6 complement(1441560..1442804) [1245 bp, 414 aa]...    37   0.16 
YLL010C Chr12 complement(129330..130613) [1284 bp, 427 aa] {ON} ...    37   0.23 
Smik_12.53 Chr12 complement(116428..117672) [1245 bp, 414 aa] {O...    37   0.26 
CAGL0D03234g Chr4 (334913..336145) [1233 bp, 410 aa] {ON} simila...    36   0.27 
Ecym_7276 Chr7 complement(579526..581307) [1782 bp, 593 aa] {ON}...    37   0.29 
Suva_10.65 Chr10 complement(134276..135523) [1248 bp, 415 aa] {O...    36   0.30 
ADR369C Chr4 complement(1362309..1364792) [2484 bp, 827 aa] {ON}...    37   0.31 
TDEL0E04270 Chr5 (798352..799713) [1362 bp, 453 aa] {ON} Anc_5.2...    36   0.34 
CAGL0D05610g Chr4 complement(534849..536192) [1344 bp, 447 aa] {...    36   0.41 
Ecym_7104 Chr7 (203366..204844) [1479 bp, 492 aa] {ON} similar t...    36   0.43 
KAFR0A06560 Chr1 complement(1329583..1331250) [1668 bp, 555 aa] ...    35   0.83 
Skud_12.57 Chr12 complement(120706..121953) [1248 bp, 415 aa] {O...    35   1.0  
Kpol_1010.61 s1010 (148944..151325,151327..151743) [2799 bp, 932...    35   1.1  
Kpol_2002.100 s2002 complement(238947..240380) [1434 bp, 477 aa]...    35   1.1  
AAL158W Chr1 (67892..69328) [1437 bp, 478 aa] {ON} Syntenic homo...    34   1.2  
SAKL0E03014g Chr5 complement(245756..248248) [2493 bp, 830 aa] {...    34   1.6  
Kwal_33.15140 s33 complement(975769..977001) [1233 bp, 410 aa] {...    33   1.9  
NCAS0B06220 Chr2 complement(1173970..1175430) [1461 bp, 486 aa] ...    33   2.0  
AGR014W Chr7 (742007..742666) [660 bp, 219 aa] {ON} Non-syntenic...    33   2.0  
KAFR0J00990 Chr10 complement(178980..180431) [1452 bp, 483 aa] {...    33   2.7  
TPHA0A05110 Chr1 (1149460..1152657) [3198 bp, 1065 aa] {ON} Anc_...    33   2.9  
NCAS0B08080 Chr2 complement(1532527..1544853) [12327 bp, 4108 aa...    33   3.2  
SAKL0H20592g Chr8 complement(1805321..1806847) [1527 bp, 508 aa]...    32   4.7  
TPHA0H01070 Chr8 (229632..232679) [3048 bp, 1015 aa] {ON} Anc_5....    32   5.9  
CAGL0L06644g Chr12 (750307..752793) [2487 bp, 828 aa] {ON} some ...    32   7.1  
YOL115W Chr15 (101475..103229) [1755 bp, 584 aa] {ON}  PAP2Non-c...    32   7.4  

>TBLA0D03260 Chr4 (810350..812656) [2307 bp, 768 aa] {ON} Anc_8.839
           YMR277W
          Length = 768

 Score = 1339 bits (3466), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 660/738 (89%), Positives = 660/738 (89%)

Query: 1   MSTPVLSPADLPFPITIDQLITPIGSHVEKGQRLFAYKFWYMVEIAQSPDNNDPTXXXXX 60
           MSTPVLSPADLPFPITIDQLITPIGSHVEKGQRLFAYKFWYMVEIAQSPDNNDPT     
Sbjct: 1   MSTPVLSPADLPFPITIDQLITPIGSHVEKGQRLFAYKFWYMVEIAQSPDNNDPTSENSS 60

Query: 61  XXXXXXXXXXXXXXXXXHQKKSIRESIEFFESPFEGDLIGWNVDKGDEIISENQLLCDIK 120
                            HQKKSIRESIEFFESPFEGDLIGWNVDKGDEIISENQLLCDIK
Sbjct: 61  DLSGNNSDSNENGNNASHQKKSIRESIEFFESPFEGDLIGWNVDKGDEIISENQLLCDIK 120

Query: 121 RPCNHDIVYAGICTQCGKEVDDSDIMDASLSISHTDTNLKISRKEARDIDQSSMSRXXXX 180
           RPCNHDIVYAGICTQCGKEVDDSDIMDASLSISHTDTNLKISRKEARDIDQSSMSR    
Sbjct: 121 RPCNHDIVYAGICTQCGKEVDDSDIMDASLSISHTDTNLKISRKEARDIDQSSMSRLKKI 180

Query: 181 XXXXXXXXXXQTVIHCGVDPTIGEWKNDPKNPNYETLKDVRSFSLDEEPILPPSYMGPRP 240
                     QTVIHCGVDPTIGEWKNDPKNPNYETLKDVRSFSLDEEPILPPSYMGPRP
Sbjct: 181 KKLILVVDLDQTVIHCGVDPTIGEWKNDPKNPNYETLKDVRSFSLDEEPILPPSYMGPRP 240

Query: 241 PVRKCWYYVKVRPGLKEFFAKIAPLYEMHIYTMATRAYALEIAKIIDPDGSLFGSRILSR 300
           PVRKCWYYVKVRPGLKEFFAKIAPLYEMHIYTMATRAYALEIAKIIDPDGSLFGSRILSR
Sbjct: 241 PVRKCWYYVKVRPGLKEFFAKIAPLYEMHIYTMATRAYALEIAKIIDPDGSLFGSRILSR 300

Query: 301 DENGSLTQKSLERLFPTDQSMVIIIDDRGDVWNWCNNLIKVIPYNFFVGIGDINSNFLPR 360
           DENGSLTQKSLERLFPTDQSMVIIIDDRGDVWNWCNNLIKVIPYNFFVGIGDINSNFLPR
Sbjct: 301 DENGSLTQKSLERLFPTDQSMVIIIDDRGDVWNWCNNLIKVIPYNFFVGIGDINSNFLPR 360

Query: 361 QQSTMLQLGIRSHKKKNTNETLNSEDDKSDSTLSVHEKDKTEELLTDIMDTEKKLQKKID 420
           QQSTMLQLGIRSHKKKNTNETLNSEDDKSDSTLSVHEKDKTEELLTDIMDTEKKLQKKID
Sbjct: 361 QQSTMLQLGIRSHKKKNTNETLNSEDDKSDSTLSVHEKDKTEELLTDIMDTEKKLQKKID 420

Query: 421 EEVRRQEKKLIKDEMPKRKSISDESSNNELSKKIEFSASLEVQQQNRPLATLQRHRQNQR 480
           EEVRRQEKKLIKDEMPKRKSISDESSNNELSKKIEFSASLEVQQQNRPLATLQRHRQNQR
Sbjct: 421 EEVRRQEKKLIKDEMPKRKSISDESSNNELSKKIEFSASLEVQQQNRPLATLQRHRQNQR 480

Query: 481 LLIDDDDELFYLKDILTEVHDTFYEQLDEDKNESVSIQTLMPRLKFSVFSGYNFVFSGLI 540
           LLIDDDDELFYLKDILTEVHDTFYEQLDEDKNESVSIQTLMPRLKFSVFSGYNFVFSGLI
Sbjct: 481 LLIDDDDELFYLKDILTEVHDTFYEQLDEDKNESVSIQTLMPRLKFSVFSGYNFVFSGLI 540

Query: 541 PLGTDIRRADIVLWTNMFGANSTADIDENTTHVITKTAGTYKARLAKAFNPEIKVVHPDW 600
           PLGTDIRRADIVLWTNMFGANSTADIDENTTHVITKTAGTYKARLAKAFNPEIKVVHPDW
Sbjct: 541 PLGTDIRRADIVLWTNMFGANSTADIDENTTHVITKTAGTYKARLAKAFNPEIKVVHPDW 600

Query: 601 IFECLVSWKRMPEKPYELIIEQPASXXXXXXXXXXXXXXXXXXXXXXXXTEAQFEALNTR 660
           IFECLVSWKRMPEKPYELIIEQPAS                        TEAQFEALNTR
Sbjct: 601 IFECLVSWKRMPEKPYELIIEQPASEEELEEFKKKLELKNELLEKREMETEAQFEALNTR 660

Query: 661 DPAIDLFASGTSWLNXXXXXXXXXXXXXXXXXXTEKNEEDYEPNLSDGKRSFKEESTDQM 720
           DPAIDLFASGTSWLN                  TEKNEEDYEPNLSDGKRSFKEESTDQM
Sbjct: 661 DPAIDLFASGTSWLNDDDDDIPISDSDSSIESDTEKNEEDYEPNLSDGKRSFKEESTDQM 720

Query: 721 RNNKKLKILDESESEVKK 738
           RNNKKLKILDESESEVKK
Sbjct: 721 RNNKKLKILDESESEVKK 738

>ZYRO0G14168g Chr7 (1128601..1130895) [2295 bp, 764 aa] {ON} similar
           to uniprot|Q03254 Saccharomyces cerevisiae YMR277W FCP1
           Carboxy-terminal domain (CTD) phosphatase
          Length = 764

 Score =  890 bits (2300), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 427/675 (63%), Positives = 502/675 (74%), Gaps = 41/675 (6%)

Query: 1   MSTPVLSPADLPFPITIDQLITPIGSHVEKGQRLFAYKFWYMVEIAQSPDNNDPTXXXXX 60
           M+TPV++P  LP+PITIDQLI PIGS V+KGQRLFAYKFWYMVEIA SPD ND       
Sbjct: 1   MATPVIAPESLPYPITIDQLIAPIGSTVKKGQRLFAYKFWYMVEIASSPDENDGNGGAQ- 59

Query: 61  XXXXXXXXXXXXXXXXXHQKKSIRESIEFFESPFEGDLIGWNVDKGDEIISENQLLCDIK 120
                            H KK++RESIEFFESPFEGDL+ W VD+GDE+ S  Q++C+I 
Sbjct: 60  -----------------HSKKTVRESIEFFESPFEGDLVSWEVDRGDEVASARQVICEIM 102

Query: 121 RPCNHDIVYAGICTQCGKEVDDSDIMDASLSISHTDTNLKISRKEARDIDQSSMSRXXXX 180
           RPCNHD+VY G+CT CGKEVD++D M+A+L+ISHTDTNLK+SRKEA D++     R    
Sbjct: 103 RPCNHDVVYGGLCTMCGKEVDENDQMEANLAISHTDTNLKVSRKEAEDMEHFLKQRLRQS 162

Query: 181 XXXXXXXXXXQTVIHCGVDPTIGEWKNDPKNPNYETLKDVRSFSLDEEPILPPSYMGPRP 240
                     QTVIHCGVDPTIGEWK DP NPNYETLKDV+ FSL+EEPI+PP YMGPR 
Sbjct: 163 KKLVLVVDLDQTVIHCGVDPTIGEWKKDPSNPNYETLKDVQMFSLEEEPIVPPMYMGPRL 222

Query: 241 PVRKCWYYVKVRPGLKEFFAKIAPLYEMHIYTMATRAYALEIAKIIDPDGSLFGSRILSR 300
           P RKCWY+VKVRPGL+EFFA++APLYEMHIYTMATR YALEIAKIIDPDGSLFG RILSR
Sbjct: 223 PERKCWYFVKVRPGLREFFAQLAPLYEMHIYTMATRTYALEIAKIIDPDGSLFGDRILSR 282

Query: 301 DENGSLTQKSLERLFPTDQSMVIIIDDRGDVWNWCNNLIKVIPYNFFVGIGDINSNFLPR 360
           DENGSLTQKSLERLFPTDQSMVI+IDDRGDVWNWC NLIKV+PYNFFVG+GDINSNFLPR
Sbjct: 283 DENGSLTQKSLERLFPTDQSMVIVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPR 342

Query: 361 QQSTMLQLGIRSHKKKNTNETLNSEDDKSDSTLSVHEKDKTEELLTDIMDTEKKLQKKID 420
           QQS +LQLG R+HKK                        +++ELLTDIMDTEK+LQ+KID
Sbjct: 343 QQSGLLQLGRRTHKKPQ----------------------ESDELLTDIMDTEKRLQEKID 380

Query: 421 EEVRRQEKKLIKDEMPKRKSISDESSNNELSKKIEFSASLEVQQQNRPLATLQRHRQNQR 480
           EEV+RQE+KL        + +  ES   +L+KK+E+SASLEVQQQNRPLATLQ+H  NQR
Sbjct: 381 EEVKRQEEKLSHQLTTNDEPVQGESK-EQLTKKLEYSASLEVQQQNRPLATLQKHMHNQR 439

Query: 481 LLIDDDDELFYLKDILTEVHDTFYEQLDEDKNESVSIQTLMPRLKFSVFSGYNFVFSGLI 540
           LL+DDDDEL+YLKD L ++H  +Y+ LDE    S  IQ+L+P +K  VF    FVFSGLI
Sbjct: 440 LLVDDDDELYYLKDTLAKIHRKYYKLLDEGNENSADIQSLVPTMKGQVFKDCYFVFSGLI 499

Query: 541 PLGTDIRRADIVLWTNMFGANSTADIDENTTHVITKTAGTYKARLAKAFNPEIKVVHPDW 600
           PLGT+IRRADIVLWT MFGA ++++IDENTTHVITKT GTYKAR+AK FN  +KVVHPDW
Sbjct: 500 PLGTNIRRADIVLWTGMFGAITSSEIDENTTHVITKTPGTYKARIAKGFNENVKVVHPDW 559

Query: 601 IFECLVSWKRMPEKPYELIIEQPASXXXXXXXXXXXXXXXXXXXXXXXXTEAQFEALNTR 660
           +FECLV+W  + EKPYELII+ PA+                         E++      +
Sbjct: 560 VFECLVTWTHVDEKPYELIIQDPATEEEIQDFKRKIEQRHLIEEQRREQFESEALMKTAQ 619

Query: 661 DPAIDLFASGTSWLN 675
           D  ++LFA GTSWLN
Sbjct: 620 DSTLNLFAGGTSWLN 634

>TDEL0B00580 Chr2 complement(111408..113549) [2142 bp, 713 aa] {ON}
           Anc_8.839 YMR277W
          Length = 713

 Score =  888 bits (2294), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 427/675 (63%), Positives = 507/675 (75%), Gaps = 49/675 (7%)

Query: 1   MSTPVLSPADLPFPITIDQLITPIGSHVEKGQRLFAYKFWYMVEIAQSPDNNDPTXXXXX 60
           M+TPV SP  LP+PITIDQLI PIGSHVEKGQRLFA+KFWYMVEIA SPD N+       
Sbjct: 1   MTTPVFSPEVLPYPITIDQLIAPIGSHVEKGQRLFAFKFWYMVEIASSPDENE------- 53

Query: 61  XXXXXXXXXXXXXXXXXHQKKSIRESIEFFESPFEGDLIGWNVDKGDEIISENQLLCDIK 120
                            H+KK++RESIEFFE+PFEGDL+ WNVD GDE+++ NQ +C+I 
Sbjct: 54  ---------------GGHRKKTVRESIEFFEAPFEGDLMSWNVDVGDEVVAPNQAICEIS 98

Query: 121 RPCNHDIVYAGICTQCGKEVDDSDIMDASLSISHTDTNLKISRKEARDIDQSSMSRXXXX 180
           RPCNHDIVY G+CT CGKEVD+S+  + +L+ISHTD NLK+SRKEA DI+ +  +R    
Sbjct: 99  RPCNHDIVYGGLCTLCGKEVDESEQFNGNLAISHTDVNLKVSRKEATDIENNLKTRLRES 158

Query: 181 XXXXXXXXXXQTVIHCGVDPTIGEWKNDPKNPNYETLKDVRSFSLDEEPILPPSYMGPRP 240
                     QTVIHCGVDPTIGEWK D  NPNYE LKDV+SF+LDEEPILP  YMGP+P
Sbjct: 159 KKLVLVVDLDQTVIHCGVDPTIGEWKRDSSNPNYEALKDVQSFALDEEPILPLLYMGPKP 218

Query: 241 PVRKCWYYVKVRPGLKEFFAKIAPLYEMHIYTMATRAYALEIAKIIDPDGSLFGSRILSR 300
           PVRKCWYYVKVRPGLKEFF K+APL+EMHIYTMATRAYALEIAKIIDPDGSLFG RILSR
Sbjct: 219 PVRKCWYYVKVRPGLKEFFDKVAPLFEMHIYTMATRAYALEIAKIIDPDGSLFGDRILSR 278

Query: 301 DENGSLTQKSLERLFPTDQSMVIIIDDRGDVWNWCNNLIKVIPYNFFVGIGDINSNFLPR 360
           DENGS+TQKSLERLFPTDQSMV++IDDRGDVWNWC NLIKV+PYNFFVG+GDINSNFLPR
Sbjct: 279 DENGSITQKSLERLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPR 338

Query: 361 QQSTMLQLGIRSHKKKNTNETLNSEDDKSDSTLSVHEKDKTEELLTDIMDTEKKLQKKID 420
           QQ+TMLQLG  + KK                        +++EL+TDIMDTEKKLQ+KID
Sbjct: 339 QQNTMLQLGRGARKKTQ----------------------ESDELITDIMDTEKKLQEKID 376

Query: 421 EEVRRQEKKLIKDEMPKRKSISDESSNNELSKKIEFSASLEVQQQNRPLATLQRHRQNQR 480
           EEV+RQE+KL   +M   + +    S ++L+KK+E+SASLEVQQQNRPLATLQ+H  NQR
Sbjct: 377 EEVKRQEEKL-NHQMASGEEVPAPESKDQLAKKLEYSASLEVQQQNRPLATLQKHMHNQR 435

Query: 481 LLIDDDDELFYLKDILTEVHDTFYEQLDEDKNESVSIQTLMPRLKFSVFSGYNFVFSGLI 540
           LL+DDDDEL YL++IL +VHD +Y+ L +D  +   I+TL+P +K  VF   +FVFSGLI
Sbjct: 436 LLVDDDDELNYLREILAKVHDEYYKTLGQDSEKKADIKTLLPLMKSKVFEDCHFVFSGLI 495

Query: 541 PLGTDIRRADIVLWTNMFGANSTADIDENTTHVITKTAGTYKARLAKAFNPEIKVVHPDW 600
           PLGT+I RADIVLWTNMFGA S+ +ID++TTHVIT+T GTYKAR+AKAFN  IKVVHPDW
Sbjct: 496 PLGTNINRADIVLWTNMFGAQSSPEIDDSTTHVITRTPGTYKARIAKAFNENIKVVHPDW 555

Query: 601 IFECLVSWKRMPEKPYELIIEQPASXXXXXXXXXXXXXXXXXXXXXXXXTEAQFEALNTR 660
           +FECLVSWK + EKPYELI+EQ A+                         E +    + +
Sbjct: 556 VFECLVSWKHVDEKPYELIVEQTATDEELGDYKQKLARRSSALAEQ----EMELAMESAK 611

Query: 661 DPAIDLFASGTSWLN 675
           +  I+LFA GTSWLN
Sbjct: 612 NGTINLFAGGTSWLN 626

>CAGL0M02959g Chr13 (332990..335266) [2277 bp, 758 aa] {ON} similar
           to uniprot|Q03254 Saccharomyces cerevisiae YMR277w FCP1
          Length = 758

 Score =  877 bits (2265), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 432/678 (63%), Positives = 505/678 (74%), Gaps = 42/678 (6%)

Query: 1   MSTPVLSPADLPFPITIDQLITPIGSHVEKGQRLFAYKFWYMVEIAQSPDNNDPTXXXXX 60
           MSTPVL+P  LP+PIT+D+L+ PIGS+VEKGQRLFAYKFWYMVEIA SPD+ND       
Sbjct: 1   MSTPVLTPMGLPYPITVDELMVPIGSYVEKGQRLFAYKFWYMVEIANSPDDND------- 53

Query: 61  XXXXXXXXXXXXXXXXXHQKKSIRESIEFFESPFEGDLIGWNVDKGDEIISENQLLCDIK 120
                              K+ +RESIEF+E+PFEGDL+ WNVD+ DEI   N  +C+IK
Sbjct: 54  --------IDYEGPEIEKSKRKVRESIEFYEAPFEGDLLSWNVDEKDEIAGPNMAVCEIK 105

Query: 121 RPCNHDIVYAGICTQCGKEVDDSDIMDASLSISHTDTNLKISRKEARDIDQSSMSRXXXX 180
           RPCNHDIVY G+CT CGKEVD+ D +DA+L+ISHTDTNL++SRKEA D+D+   +R    
Sbjct: 106 RPCNHDIVYGGLCTMCGKEVDEYDQVDANLTISHTDTNLRVSRKEAIDLDKQITTRLKNE 165

Query: 181 XXXXXXXXXXQTVIHCGVDPTIGEWKNDPKNPNYETLKDVRSFSLDEEPILPPSYMGPRP 240
                     QTVIHCGVDPTIGEWK DP NPNYETLKDV+ FSL+EEPILP  YMGP+P
Sbjct: 166 KKLVLVVDLDQTVIHCGVDPTIGEWKADPSNPNYETLKDVKCFSLEEEPILPLIYMGPKP 225

Query: 241 PVRKCWYYVKVRPGLKEFFAKIAPLYEMHIYTMATRAYALEIAKIIDPDGSLFGSRILSR 300
           PVR CWYYVK+RPGLKEFF KIAPLYEMHIYTMATRAYALEIAKIIDPD SLFG RILSR
Sbjct: 226 PVRTCWYYVKIRPGLKEFFEKIAPLYEMHIYTMATRAYALEIAKIIDPDKSLFGDRILSR 285

Query: 301 DENGSLTQKSLERLFPTDQSMVIIIDDRGDVWNWCNNLIKVIPYNFFVGIGDINSNFLPR 360
           DENGSLTQKSL RLFPTDQSMV++IDDRGDVWNWC NLIKV+PYNFFVG+GDINSNFLP+
Sbjct: 286 DENGSLTQKSLTRLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPK 345

Query: 361 QQSTMLQLGIRSHKKKNTNETLNSEDDKSDSTLSVHEKDKTEELLTDIMDTEKKLQKKID 420
           QQ+TMLQLG R+ +K                        ++EELLTDIMDTEKKLQ+KID
Sbjct: 346 QQTTMLQLGRRTRQKIK----------------------ESEELLTDIMDTEKKLQEKID 383

Query: 421 EEVRRQEKKLIKDEMPKRKSISDESSNNELSKKIEFSASLEVQQQNRPLATLQRHRQNQR 480
           EEV+RQE+KL   +M   +  +D+ S  +++KK+EFSASLEVQQQNRPLA LQ+H  +QR
Sbjct: 384 EEVKRQEEKL-NHQMATAEESTDQESKEKIAKKLEFSASLEVQQQNRPLAKLQKHLHDQR 442

Query: 481 LLIDDDDELFYLKDILTEVHDTFYEQLDE--DKNESVSIQTLMPRLKFSVFSGYNFVFSG 538
           LLIDDDDELFYLKD L  +H  FY  L++  D+NE+  I  L+P+LK  VF   +FVFSG
Sbjct: 443 LLIDDDDELFYLKDTLAYIHKEFYHLLEDASDQNEA-DITMLLPKLKKKVFKECHFVFSG 501

Query: 539 LIPLGTDIRRADIVLWTNMFGANSTADIDENTTHVITKTAGTYKARLAKAFNPEIKVVHP 598
           LIPLGTDI+RADIV+WT++FGA ST+DIDE+TTHV+TKT GTYKARLAKAFNP+IKVVHP
Sbjct: 502 LIPLGTDIKRADIVIWTSLFGAESTSDIDEHTTHVVTKTPGTYKARLAKAFNPDIKVVHP 561

Query: 599 DWIFECLVSWKRMPEKPYELIIEQPASXXXXXXXXXXXXXXXXXXXXXXXXTEAQFEA-L 657
           DWIFECL SWKR+ EKPY LI+EQP S                         E +     
Sbjct: 562 DWIFECLASWKRIDEKPYLLIVEQPVSEDELIEFKKKLEQKKKKLEELEIEEEEELNERA 621

Query: 658 NTRDPAIDLFASGTSWLN 675
           N  +P + LF   TSWLN
Sbjct: 622 NQMEPTMPLFGGDTSWLN 639

>Kpol_1068.9 s1068 complement(15966..18203) [2238 bp, 745 aa] {ON}
           complement(15966..18203) [2238 nt, 746 aa]
          Length = 745

 Score =  866 bits (2238), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 429/679 (63%), Positives = 496/679 (73%), Gaps = 47/679 (6%)

Query: 1   MSTPVLSPADLPFPITIDQLITPIGSHVEKGQRLFAYKFWYMVEIAQSPDNNDPTXXXXX 60
           MSTPV +P  LP+PITI +LI  IGSHVEKGQRLFAYKFWY+VEIA+SPD ND       
Sbjct: 1   MSTPVSAPLGLPYPITISKLIASIGSHVEKGQRLFAYKFWYIVEIAKSPDEND------- 53

Query: 61  XXXXXXXXXXXXXXXXXHQKKSIRESIEFFESPFEGDLIGWNVDKGDEIISENQLLCDIK 120
                            H KKSIRESIEFF+SPFEGDL+ WNVD GDEI+  NQ +C+I 
Sbjct: 54  -----------DGVNDEHSKKSIRESIEFFDSPFEGDLVSWNVDVGDEIVEPNQTICEIV 102

Query: 121 RPCNHDIVYAGICTQCGKEVDDSDIMDASLSISHTDTNLKISRKEARDIDQSSMSRXXXX 180
           RPCNHDIVYAGICT CGKEVD+SD + A+L+ISHTDTNLK+SR+EA DI Q    R    
Sbjct: 103 RPCNHDIVYAGICTMCGKEVDESDQVSANLTISHTDTNLKVSRREANDIGQGIKKRLIRE 162

Query: 181 XXXXXXXXXXQTVIHCGVDPTIGEWKNDPKNPNYETLKDVRSFSLDEEPILPPSYMGPRP 240
                     QTVIHCGVDPTI EWKNDP NPN+ETL+DV+SF L+EEPILPP YMGP+P
Sbjct: 163 KKLILVVDLDQTVIHCGVDPTIAEWKNDPTNPNFETLRDVKSFVLEEEPILPPMYMGPKP 222

Query: 241 PVRKCWYYVKVRPGLKEFFAKIAPLYEMHIYTMATRAYALEIAKIIDPDGSLFGSRILSR 300
           P  KCWYYVK+RPGLKEFF +++ LYEMHIYTMATR+YA EIAKIIDPDG+LF  RILSR
Sbjct: 223 PTHKCWYYVKIRPGLKEFFEEVSKLYEMHIYTMATRSYAQEIAKIIDPDGTLFADRILSR 282

Query: 301 DENGSLTQKSLERLFPTDQSMVIIIDDRGDVWNWCNNLIKVIPYNFFVGIGDINSNFLPR 360
           +ENGSLT KSLERLFPTDQSMV++IDDRGDVWNWC NLIKV PYNFFVGIGDINSNFLPR
Sbjct: 283 NENGSLTHKSLERLFPTDQSMVVVIDDRGDVWNWCPNLIKVTPYNFFVGIGDINSNFLPR 342

Query: 361 QQSTMLQLGIRSHKKKNTNETLNSEDDKSDSTLSVHEKDKTEELLTDIMDTEKKLQKKID 420
           QQ+TMLQLG R+HKK        +ED              T+ELLTDIMDTEKKLQ+KID
Sbjct: 343 QQTTMLQLGRRNHKK--------TED--------------TDELLTDIMDTEKKLQEKID 380

Query: 421 EEVRRQEKKLIKDEMPKRKSISDESSNNELSKKIEFSASLEVQQQNRPLATLQRHRQNQR 480
           EEV+RQE+ L        + IS +    +++KKIEFSASLEVQQQNRPLA LQ+H  NQ+
Sbjct: 381 EEVKRQEENLSHQSAALGEEISSQVRKEDITKKIEFSASLEVQQQNRPLAELQKHMHNQQ 440

Query: 481 LLIDDDDELFYLKDILTEVHDTFYEQLDEDKNESVSIQTLMPRLKFSVFSGYNFVFSGLI 540
           LL DDDDELFYLKDIL  V   +YE+L  DK   + IQTLMP+LK  V  G NFVFSGLI
Sbjct: 441 LLTDDDDELFYLKDILKNVQQKYYEELKTDK--EIQIQTLMPKLKKKVLEGCNFVFSGLI 498

Query: 541 PLGTDIRRADIVLWTNMFGANSTADIDENTTHVITKTAGTYKARLAKAFNPEIKVVHPDW 600
           PLGT+I++ADIVLWTNMFGA S+ADI E+TTHVITKT  TYKA++AKAF  +IKV+HPDW
Sbjct: 499 PLGTNIQKADIVLWTNMFGAQSSADITEDTTHVITKTPHTYKAKIAKAFKSDIKVLHPDW 558

Query: 601 IFECLVSWKRMPEKPYEL-IIEQPASXXXXXXXXXXXXXXXXXXXXXXXXTEAQFE---- 655
           +FECL++WK MPE PYE  II                             +E   E    
Sbjct: 559 VFECLLNWKYMPEFPYEYNIIPTATDKELNEFKEALERRKKKETKTKITVSEESLEGDSN 618

Query: 656 ALNTRDPAIDLFASGTSWL 674
           + +++  ++DLFASG SWL
Sbjct: 619 SPSSQGASVDLFASGASWL 637

>KAFR0B03910 Chr2 (811940..814114) [2175 bp, 724 aa] {ON} Anc_8.839
           YMR277W
          Length = 724

 Score =  843 bits (2177), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 415/680 (61%), Positives = 497/680 (73%), Gaps = 43/680 (6%)

Query: 1   MSTPVLSPADLPFPITIDQLITPIGSHVEKGQRLFAYKFWYMVEIAQSPDNNDPTXXXXX 60
           M+TPVL+P  LP+PITID+LI PIG+++EKG RLFAYKFWYMVEIA SPD+NDP      
Sbjct: 1   MTTPVLAPEGLPYPITIDELICPIGTYIEKGIRLFAYKFWYMVEIASSPDDNDPANTDTQ 60

Query: 61  XXXXXXXXXXXXXXXXXHQKKSIRESIEFFESPFEGDLIGWNVDKGDEIISENQLLCDIK 120
                            H KK IRESIEFF++PFEG LI WN+D GDE+ S +Q++C+IK
Sbjct: 61  AS---------------HPKKKIRESIEFFDAPFEGTLISWNIDVGDELSSASQVICEIK 105

Query: 121 RPCNHDIVYAGICTQCGKEVDDSDI--MDASLSISHTDTNLKISRKEARDIDQSSMSRXX 178
           RPCNHDIVY G+CTQCGKEVD+S+     ++ ++SHTDTNLKISRKEA DI +    R  
Sbjct: 106 RPCNHDIVYGGLCTQCGKEVDESEQSQFGSNFTVSHTDTNLKISRKEALDIGEDFKKRLR 165

Query: 179 XXXXXXXXXXXXQTVIHCGVDPTIGEWKNDPKNPNYETLKDVRSFSLDEEPILPPSYMGP 238
                       QTVIHCGVDPTIGEWK+DP NPNY+TLKDV+ F+L+EEP+LP  YMGP
Sbjct: 166 NEKKLVLVVDLDQTVIHCGVDPTIGEWKSDPNNPNYDTLKDVQMFALEEEPVLPFMYMGP 225

Query: 239 RPPVRKCWYYVKVRPGLKEFFAKIAPLYEMHIYTMATRAYALEIAKIIDPDGSLFGSRIL 298
           +P  RKCWYYVKVRPGLKEFF K+APL+EMHIYTMATRAYALEI KIIDP G LFG+RIL
Sbjct: 226 KPTPRKCWYYVKVRPGLKEFFKKVAPLFEMHIYTMATRAYALEITKIIDPTGELFGNRIL 285

Query: 299 SRDENGSLTQKSLERLFPTDQSMVIIIDDRGDVWNWCNNLIKVIPYNFFVGIGDINSNFL 358
           SRDENGSLT KSLERLFPTDQSMVIIIDDRGDVWNW  NLIKV+PY+FFVG+GDINSNFL
Sbjct: 286 SRDENGSLTSKSLERLFPTDQSMVIIIDDRGDVWNWSPNLIKVVPYSFFVGVGDINSNFL 345

Query: 359 PRQQSTMLQLGIRSHKKKNTNETLNSEDDKSDSTLSVHEKDKTEELLTDIMDTEKKLQKK 418
           P+QQ+TMLQLG RS +K                        + +ELLTDIMDTEKKLQ+K
Sbjct: 346 PKQQTTMLQLGRRSREKAK----------------------EADELLTDIMDTEKKLQEK 383

Query: 419 IDEEVRRQEKKLIKDEMPKRKSISDESSNNELSKKIEFSASLEVQQQNRPLATLQRHRQN 478
           IDEEV+RQEK L    +P  +S+S+E+   E +KK+E SAS+EVQQQNRPLA LQ H  N
Sbjct: 384 IDEEVKRQEKNLSHQVVPTEESVSNETK-EEWTKKLEHSASVEVQQQNRPLAALQEHLHN 442

Query: 479 QRLLIDDDDELFYLKDILTEVHDTFYEQLDEDK--NESVSIQTLMPRLKFSVFSGYNFVF 536
           QRLLIDDDDEL++LKD L +VH+ +Y  L+          I+ +MP+LK SVF G +FVF
Sbjct: 443 QRLLIDDDDELYFLKDTLAKVHNEYYSILENKSLDESGADIKLIMPKLKQSVFEGCHFVF 502

Query: 537 SGLIPLGTDIRRADIVLWTNMFGANSTADIDENTTHVITKTAGTYKARLAKAFNPEIKVV 596
           SGLIPL TDIRRADIV+WT+MFGA S+++I+E TTHVITKT GT+KARLAK+FN +IK+V
Sbjct: 503 SGLIPLHTDIRRADIVVWTSMFGAESSSEINEVTTHVITKTPGTFKARLAKSFNSDIKIV 562

Query: 597 HPDWIFECLVSWKRMPEKPYELIIEQPASXXXXXXXXXXXXXXXXXXXXXXXXT-EAQFE 655
           HPDW+FECL+ W  + EKPY LI+E+P S                        + +    
Sbjct: 563 HPDWVFECLIRWTHVDEKPYTLIVEEPISDRELKKFREDLNNRKLTERNNEQNSGDITGT 622

Query: 656 ALNTRDPAIDLFASGTSWLN 675
            +   D  +DLFA+GTSWLN
Sbjct: 623 IVENFDNTVDLFATGTSWLN 642

>NCAS0C00420 Chr3 complement(65252..67429) [2178 bp, 725 aa] {ON}
           Anc_8.839 YMR277W
          Length = 725

 Score =  825 bits (2131), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 411/680 (60%), Positives = 488/680 (71%), Gaps = 49/680 (7%)

Query: 1   MSTPVLSPADLPFPITIDQLITPIGSHVEKGQRLFAYKFWYMVEIAQSPDNNDPTXXXXX 60
           MST +L+P  LP+PITIDQLIT +G  V+KG RL AYKFW++V++A SPD+ND +     
Sbjct: 1   MSTQILAPIGLPYPITIDQLITHVGDEVQKGDRLLAYKFWFVVDVASSPDDNDVSSPPTA 60

Query: 61  XXXXXXXXXXXXXXXXXHQKKSIRESIEFFESPFEGDLIGWNVDKGDEIISENQLLCDIK 120
                              KKSIRESIEFFESP++G LI WNVD GDEI S NQ+L +I 
Sbjct: 61  G------------------KKSIRESIEFFESPYKGQLISWNVDIGDEIASPNQVLAEII 102

Query: 121 RPCNHDIVYAGICTQCGKEVD----DSDIMDASLSISHTDTNLKISRKEARDIDQSSMSR 176
           RPCNHD+VY G+CT CG+EVD    D+    A+L+ISHTDTNLKIS +EA DI  +  +R
Sbjct: 103 RPCNHDVVYGGLCTLCGEEVDEDDNDASGSGANLTISHTDTNLKISTREALDIGLNVRTR 162

Query: 177 XXXXXXXXXXXXXXQTVIHCGVDPTIGEWKNDPKNPNYETLKDVRSFSLDEEPILPPSYM 236
                         QTVIHCGVDPTIGEWKNDPKNPN+ETLKDV+ FSL+EEPILP  YM
Sbjct: 163 LRKEKKLVLVVDLDQTVIHCGVDPTIGEWKNDPKNPNFETLKDVKQFSLEEEPILPTLYM 222

Query: 237 GPRPPVRKCWYYVKVRPGLKEFFAKIAPLYEMHIYTMATRAYALEIAKIIDPDGSLFGSR 296
           GP+PP+RKCWYYVKVRPGLKEF  KIAPL+EMHIYTMATRAYA EIAKIIDP+G LFG R
Sbjct: 223 GPKPPLRKCWYYVKVRPGLKEFLEKIAPLFEMHIYTMATRAYASEIAKIIDPNGDLFGDR 282

Query: 297 ILSRDENGSLTQKSLERLFPTDQSMVIIIDDRGDVWNWCNNLIKVIPYNFFVGIGDINSN 356
           ILSRDENGS+T KSLERLFPTDQSMVI+IDDRGDVWNW  NLIKV+PYNFFVG+GDINSN
Sbjct: 283 ILSRDENGSMTTKSLERLFPTDQSMVIVIDDRGDVWNWSPNLIKVVPYNFFVGVGDINSN 342

Query: 357 FLPRQQSTMLQLGIRSHKKKNTNETLNSEDDKSDSTLSVHEKDKTEELLTDIMDTEKKLQ 416
           FLP+QQ+TMLQLG RS +K        S+D              TE+LL DIMD+EKKL+
Sbjct: 343 FLPKQQATMLQLGRRSREK--------SKD--------------TEDLLIDIMDSEKKLK 380

Query: 417 KKIDEEVRRQEKKLIKDEMPKRKSISDESSNN-ELSKKIEFSASLEVQQQNRPLATLQRH 475
           +KID+EV+RQE++L        +  +    N  E+SKKIE+SASLEVQQQNRPLA LQ+H
Sbjct: 381 EKIDQEVKRQEEELSHQSATTEEPPTSAGENKEEISKKIEYSASLEVQQQNRPLAALQKH 440

Query: 476 RQNQRLLIDDDDELFYLKDILTEVHDTFYEQLDEDKNESVSIQTLMPRLKFSVFSGYNFV 535
             +QRLLIDDDDEL++LKD L  +HD +Y  L +D      I+ +MP +K +V     FV
Sbjct: 441 FHDQRLLIDDDDELYHLKDTLVRIHDKYYNVLKKDGELKADIKLIMPAMKQNVLDNCRFV 500

Query: 536 FSGLIPLGTDIRRADIVLWTNMFGANSTADIDENTTHVITKTAGTYKARLAKAFNPEIKV 595
           FSGLIPLGTDI+RADIV+WTN FGA ST+DIDE TTHVITKT GTYKARLAK+FNP+IK+
Sbjct: 501 FSGLIPLGTDIQRADIVIWTNTFGAISTSDIDEKTTHVITKTPGTYKARLAKSFNPKIKI 560

Query: 596 VHPDWIFECLVSWKRMPEKPYELIIEQPASXXXXXXXXXXXXXXXXXXXXXXXXTEAQFE 655
           +HPDW+FECL SWK + EKPYELI+EQP S                        + A   
Sbjct: 561 LHPDWVFECLTSWKHVDEKPYELIVEQPVSETELEEFKKKLAKRQLLATANENLSPAN-- 618

Query: 656 ALNTRDPAIDLFASGTSWLN 675
              T    ++LF+ G SWL+
Sbjct: 619 --GTNSAELELFSGGMSWLD 636

>TPHA0I00240 Chr9 (43854..46052) [2199 bp, 732 aa] {ON} Anc_8.839
           YMR277W
          Length = 732

 Score =  824 bits (2129), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 410/680 (60%), Positives = 490/680 (72%), Gaps = 41/680 (6%)

Query: 1   MSTPVLSPADLPFPITIDQLITPIGSHVEKGQRLFAYKFWYMVEIAQSPDNNDPTXXXXX 60
           M+TPV  P  +P+PITI +LI P+GS++ KG RLFAYKFWY+VEIA+SPD  D       
Sbjct: 1   MATPVKFPDGMPYPITISKLIAPVGSYINKGDRLFAYKFWYLVEIAKSPDELD------- 53

Query: 61  XXXXXXXXXXXXXXXXXHQKKSIRESIEFFESPFEGDLIGWNVDKGDEIISENQLLCDIK 120
                              KK+IRESI+FF++PFEG +IGWNVD GDEI+   +++C++K
Sbjct: 54  --------VNGNVQDGEQSKKTIRESIDFFDAPFEGTIIGWNVDVGDEIVEPGRIVCEVK 105

Query: 121 RPCNHDIVYAGICTQCGKEVDDSDIMDASLSISHTDTNLKISRKEARDIDQSSMSRXXXX 180
           RPC+HDIVYAGICT CGKEVD+ D + A+L+ISHTDTNLK+SR+EA +I Q++ SR    
Sbjct: 106 RPCDHDIVYAGICTMCGKEVDERDQVSANLTISHTDTNLKVSRQEANNIGQTNKSRLIRS 165

Query: 181 XXXXXXXXXXQTVIHCGVDPTIGEWKNDPKNPNYETLKDVRSFSLDEEPILPPSYMGPRP 240
                     QTVIHCGVDPTI EWKNDP NPNYETL++V+SF L+EE ILPP YMGP+P
Sbjct: 166 KKLILVVDLDQTVIHCGVDPTISEWKNDPSNPNYETLRNVKSFVLEEEAILPPMYMGPKP 225

Query: 241 PVRKCWYYVKVRPGLKEFFAKIAPLYEMHIYTMATRAYALEIAKIIDPDGSLFGSRILSR 300
           PV KC YYVKVRPGLKEFF K+AP+YEMHIYTMATRAYA EIAKIIDPDGSLFG+RILSR
Sbjct: 226 PVHKCSYYVKVRPGLKEFFEKVAPIYEMHIYTMATRAYAEEIAKIIDPDGSLFGNRILSR 285

Query: 301 DENGSLTQKSLERLFPTDQSMVIIIDDRGDVWNWCNNLIKVIPYNFFVGIGDINSNFLPR 360
           DENGSLT KSLERLFPTDQSMV+IIDDRGDVWNW  NLIKV PYNFFVGIGDINSNFLPR
Sbjct: 286 DENGSLTHKSLERLFPTDQSMVVIIDDRGDVWNWSPNLIKVTPYNFFVGIGDINSNFLPR 345

Query: 361 QQSTMLQLGIRSHKKKNTNETLNSEDDKSDSTLSVHEKDKTEELLTDIMDTEKKLQKKID 420
           QQ+TMLQ+G R+H                    +  ++ ++EELLTDI+DTEKKLQ+KID
Sbjct: 346 QQATMLQMGRRNH--------------------NAEKEKESEELLTDIIDTEKKLQEKID 385

Query: 421 EEVRRQEKKLIKDEMPKRKSISDESSNNELSKKIEFSASLEVQQQNRPLATLQRHRQNQR 480
           +EV+RQE  L        +    +  N +++KKIEFSASLEVQQQNRPLA LQ+H  NQ+
Sbjct: 386 KEVKRQEADLTHKSAALGEEAVAQVRNGDITKKIEFSASLEVQQQNRPLAELQKHMHNQQ 445

Query: 481 LLIDDDDELFYLKDILTEVHDTFYEQLDEDKNES--VSIQTLMPRLKFSVFSGYNFVFSG 538
           LL DDDDEL YLK+IL  V   FY+ L+     S   SIQ LMP+LK SVF   NFVFSG
Sbjct: 446 LLRDDDDELSYLKEILATVQSEFYKALELKNGNSDDTSIQELMPKLKRSVFKDCNFVFSG 505

Query: 539 LIPLGTDIRRADIVLWTNMFGANSTADIDENTTHVITKTAGTYKARLAKAFNPEIKVVHP 598
           LIPLGTDI++ADIVLWT MFGA+ST++I ENTTHVITKT GT KAR+AK+FNP IKVVHP
Sbjct: 506 LIPLGTDIQKADIVLWTKMFGASSTSNITENTTHVITKTPGTLKARIAKSFNPSIKVVHP 565

Query: 599 DWIFECLVSWKRMPEKPYELIIEQPASXXXXXXXXXXXXXXXXXXXXXXXXTEAQFE--- 655
           DW+FECL +WK + EK +EL ++Q AS                                 
Sbjct: 566 DWVFECLSTWKHVDEKSFELKVDQVASERELEEFKKNLEKRNKNKLTDAVNFSGDLNNGT 625

Query: 656 -ALNTRDPAIDLFASGTSWL 674
             +++ D  +DLFA G+SWL
Sbjct: 626 ATMSSTDNVVDLFAGGSSWL 645

>NDAI0K00420 Chr11 complement(94101..96437) [2337 bp, 778 aa] {ON}
           Anc_8.839 YMR277W
          Length = 778

 Score =  791 bits (2043), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 404/708 (57%), Positives = 491/708 (69%), Gaps = 51/708 (7%)

Query: 1   MSTPVL--SPADLPFPITIDQLITPIGSHVEKGQRLFAYKFWYMVEIAQSPD-------- 50
           M+TP +  +P  LP+PITID+L+ PIG+ + K  RL AYKFWY+VEIA SPD        
Sbjct: 1   MATPTVIRAPLGLPYPITIDELMKPIGTEMNKDDRLLAYKFWYVVEIATSPDELEDDNDN 60

Query: 51  ----------------NNDPTXXXXXXXXXXXXXXXXXXXXXXHQKKSIRESIEFFESPF 94
                            N+ T                       +KK++RESIEFF+ P+
Sbjct: 61  DNDNDPDGDVDKNTINGNNVTNLTNRPSIEPISRNTITHAHKKKKKKTVRESIEFFDCPY 120

Query: 95  EGDLIGWNVDKGDEIISENQLLCDIKRPCNHDIVYAGICTQCGKEVDDSDIMDAS---LS 151
           +G L  W V+KGD+I+  NQ LC+I+RPCNHD++Y G+CT CGKEVD++DI D S   L+
Sbjct: 121 DGILTSWLVEKGDQIVGPNQPLCEIQRPCNHDVIYGGLCTLCGKEVDENDIDDLSGPNLT 180

Query: 152 ISHTDTNLKISRKEARDIDQSSMSRXXXXXXXXXXXXXXQTVIHCGVDPTIGEWKNDPKN 211
           ISHTDTNLKIS +EA DI QS   R              QTVIHCGVDPTIGEWK DP N
Sbjct: 181 ISHTDTNLKISTREAVDIGQSVKKRLRDDKKLILVVDLDQTVIHCGVDPTIGEWKRDPTN 240

Query: 212 PNYETLKDVRSFSLDEEPILPPSYMGPRPPVRKCWYYVKVRPGLKEFFAKIAPLYEMHIY 271
           PN+ETLKDV+ F+L+EEPILP  YMGP+PP RKCWYYVKVRPGLK+FF K+APL+EMHIY
Sbjct: 241 PNFETLKDVKEFALEEEPILPLMYMGPKPPARKCWYYVKVRPGLKDFFQKVAPLFEMHIY 300

Query: 272 TMATRAYALEIAKIIDPDGSLFGSRILSRDENGSLTQKSLERLFPTDQSMVIIIDDRGDV 331
           TMATRAYA EIAKIIDP G LFG+RILSRDENGSLT KSLERLFPTDQSMVIIIDDRGDV
Sbjct: 301 TMATRAYASEIAKIIDPTGDLFGNRILSRDENGSLTTKSLERLFPTDQSMVIIIDDRGDV 360

Query: 332 WNWCNNLIKVIPYNFFVGIGDINSNFLPRQQSTMLQLGIRSHKKKNTNETLNSEDDKSDS 391
           WNW  NLIKVIPYNFFVG+GDINSNFLP+QQ+TMLQLG RS               + +S
Sbjct: 361 WNWSPNLIKVIPYNFFVGVGDINSNFLPKQQATMLQLGRRS--------------SRGES 406

Query: 392 TLSVHEKDKTEELLTDIMDTEKKLQKKIDEEVRRQEKKLIKDEMPKRKSISDESSNN-EL 450
            +S  E D   +LLTDIMDTEK LQ+KI+EEV+RQE+KL        +  +    N  E+
Sbjct: 407 KVSTKEND---DLLTDIMDTEKVLQRKINEEVKRQEEKLNHQLATIEEPPTTAGENKEEI 463

Query: 451 SKKIEFSASLEVQQQNRPLATLQRHRQNQRLLIDDDDELFYLKDILTEVHDTFYEQLDED 510
           SKKIE+SASLEVQQ+NRPLATLQ+H  +QRLLIDDD+EL++LKD L+++H  +YE L + 
Sbjct: 464 SKKIEYSASLEVQQKNRPLATLQKHFHDQRLLIDDDEELYHLKDTLSKIHSKYYEMLQKA 523

Query: 511 KNESVSIQT----LMPRLKFSVFSGYNFVFSGLIPLGTDIRRADIVLWTNMFGANSTADI 566
                SI+     +MP++K +V    +FVFSGLIPLGT+I+++DIV+WTNMFGA STADI
Sbjct: 524 NENKDSIEPDIKYIMPQMKQTVLQDCHFVFSGLIPLGTNIQKSDIVIWTNMFGARSTADI 583

Query: 567 DENTTHVITKTAGTYKARLAKAFNPEIKVVHPDWIFECLVSWKRMPEKPYELIIEQPASX 626
           DENTTHVITKT GTYKARLAK+++P+IK+VHPDW+FECL+ WK + EKPYEL++EQ  S 
Sbjct: 584 DENTTHVITKTPGTYKARLAKSYDPDIKIVHPDWVFECLMRWKHVEEKPYELLVEQLVSD 643

Query: 627 XXXXXXXXXXXXXXXXXXXXXXXTEAQFEALNTRDPAIDLFASGTSWL 674
                                     +    N     ++LFA GTSWL
Sbjct: 644 KELADFNRKLERRIQLSELKDEGLYNKLPDGNIDINEVNLFAGGTSWL 691

>KNAG0J00280 Chr10 complement(41831..44059) [2229 bp, 742 aa] {ON}
           Anc_8.839 YMR277W
          Length = 742

 Score =  771 bits (1990), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 388/687 (56%), Positives = 479/687 (69%), Gaps = 47/687 (6%)

Query: 3   TPVLSPADLPFPITIDQLITPIGSHVEKGQRLFAYKFWYMVEIA----QSPDNNDPTXXX 58
           TPV+S A LP+P+T+D+LI  +G  V +G RLFAYKFWY+VE+A     +  ++D T   
Sbjct: 7   TPVVSGAGLPYPVTVDELIPQVGDRVSRGDRLFAYKFWYVVELAGVDAAAEGDSDGTGTT 66

Query: 59  XXXXXXXXXXXXXXXXXXXHQKKSIRESIEFFESPFEGDLIGWNVDKGDEIISENQLLCD 118
                                KKS+RES+EFFESPFEG ++ W+VD GDEI      LC 
Sbjct: 67  A--------------------KKSVRESVEFFESPFEGTVVSWDVDAGDEIPGPGAPLCL 106

Query: 119 IKRPCNHDIVYAGICTQCGKEVDDSDI---------MDASLSISHTDTNLKISRKEARDI 169
           ++RPCNHD+VY G+CT CG+EVD+ +I         +  +L++SH DTNL+ISR EA+ +
Sbjct: 107 LRRPCNHDVVYNGLCTLCGREVDEYEIQAAAAASGGVGPNLTVSHRDTNLQISRVEAQQL 166

Query: 170 DQSSMSRXXXXXXXXXXXXXXQTVIHCGVDPTIGEWKNDPKNPNYETLKDVRSFSLDEEP 229
           D     R              QTV+HCGVDPTIGEWK DP+NPNYE L+DV+SF+L+EEP
Sbjct: 167 DLQLQQRLRAAQKLVLVVDLDQTVVHCGVDPTIGEWKRDPRNPNYEALRDVQSFALEEEP 226

Query: 230 ILPPSYMG-PRPPVRKCWYYVKVRPGLKEFFAKIAPLYEMHIYTMATRAYALEIAKIIDP 288
           ILP  Y+G  RP  RKCWYYVKVRPGLK+FF ++APL+EMHIYTMATRAYALEIAKIIDP
Sbjct: 227 ILPFLYVGGKRPAPRKCWYYVKVRPGLKQFFKRLAPLFEMHIYTMATRAYALEIAKIIDP 286

Query: 289 DGSLFGSRILSRDENGSLTQKSLERLFPTDQSMVIIIDDRGDVWNWCNNLIKVIPYNFFV 348
           D SLFG RILSRDENGSLT KSLERLFPTDQSMV +IDDRGDVWNWC NLIKV+PYNFFV
Sbjct: 287 DKSLFGDRILSRDENGSLTHKSLERLFPTDQSMVTVIDDRGDVWNWCANLIKVVPYNFFV 346

Query: 349 GIGDINSNFLPRQQSTMLQLGIRSHKKKNTNETLNSEDDKSDSTLSVHEKDKTEELLTDI 408
           G+GDINSNFLP+QQ TMLQ+G RS   +  +E+   +DD  D             LLTDI
Sbjct: 347 GVGDINSNFLPKQQPTMLQMGRRSKLNERGHESKQQQDDVKDDL-----------LLTDI 395

Query: 409 MDTEKKLQKKIDEEVRRQEKKLIKDEMPKRKSISDESSNNELSKKIEFSASLEVQQQNRP 468
           M+TEK+LQ+KID+EV+RQE KL K      +  +   S  E +KK+EFSAS+EVQQ+NRP
Sbjct: 396 MNTEKQLQEKIDQEVKRQEHKLNKGNAAGDEQQTPGQSKEEWTKKLEFSASVEVQQKNRP 455

Query: 469 LATLQRHRQNQRLLIDDDDELFYLKDILTEVHDTFYEQLDEDKNESVSIQTLMPRLKFSV 528
           LATLQ+H  NQ+LL+D+DDELFYLKD L ++H  +Y  L E+  ++ +IQ++M +LK  V
Sbjct: 456 LATLQKHLHNQKLLVDNDDELFYLKDRLADLHKRYYSTLKENPQDT-NIQSIMTQLKTRV 514

Query: 529 FSGYNFVFSGLIPLGTDIRRADIVLWTNMFGANSTADIDENTTHVITKTAGTYKARLAKA 588
           F   +FVFSGLIPL T+++ ADIV+WTN FGA +T D+DE TTH+ITKT GT KARLAKA
Sbjct: 515 FQDCHFVFSGLIPLNTNVQAADIVIWTNKFGATTTNDLDETTTHLITKTPGTNKARLAKA 574

Query: 589 FNPEIKVVHPDWIFECLVSWKRMPEKPYELIIEQPASXXXXXXXXXXXXXXXXXXXXXXX 648
           FNP+IK+VHPDWIFECL+ W+R+  KPY LI+E P S                       
Sbjct: 575 FNPDIKIVHPDWIFECLIKWERVDVKPYLLIVEDPVSEAQVREFKEKLTRQKERAERQTS 634

Query: 649 XTEAQFEALNTRDPAIDLFASGTSWLN 675
            T A   A    +P IDLFA G SWLN
Sbjct: 635 RT-ALLPANKPAEPDIDLFAGGISWLN 660

>SAKL0D01496g Chr4 complement(120202..122268) [2067 bp, 688 aa] {ON}
           similar to uniprot|Q03254 Saccharomyces cerevisiae
           YMR277W FCP1 Carboxy-terminal domain (CTD) phosphatase
          Length = 688

 Score =  753 bits (1943), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/631 (58%), Positives = 454/631 (71%), Gaps = 55/631 (8%)

Query: 1   MSTPVLSPADLPFPITIDQLITPIGSHVEKGQRLFAYKFWYMVEIAQSPDNNDPTXXXXX 60
           M+T +  P +LP+PITI QL    G  ++KGQRLFAYK+W   ++  SP++         
Sbjct: 1   MTTALKLPDNLPYPITIAQLCASTGDPIKKGQRLFAYKYWEFQDVVTSPNDT-------- 52

Query: 61  XXXXXXXXXXXXXXXXXHQKKSIRESIEFFESPFEGDLIGWNVDKGDEIISENQLLCDIK 120
                              KK   + I  F+SP EG L+ +N+  GDE ++ N ++ +IK
Sbjct: 53  ---------------STKPKKQRVDLIGTFDSPVEGALVSFNLSLGDEFVNSNHVVAEIK 97

Query: 121 RPCNHDIVYAGICTQCGKEVDD------SDIMDASLSISHTDTNLKISRKEARDIDQSSM 174
           + C HD+ Y G+C  CGK V++      SD     L++SHT+TN+KIS ++A  I++++ 
Sbjct: 98  QACTHDVTYGGLCVICGKSVEEYSSNSASDPSQNKLTMSHTNTNIKISERQAAAIEETAQ 157

Query: 175 SRXXXXXXXXXXXXXXQTVIHCGVDPTIGEWKNDPKNPNYETLKDVRSFSLDEEPILPPS 234
            +              QTVIHCGVDPTIGEW  DPKNPNYE LKD++SF+L EEPILPP 
Sbjct: 158 KQLRKLKKLVLVVDLDQTVIHCGVDPTIGEWSRDPKNPNYEALKDIKSFALVEEPILPPF 217

Query: 235 YMGPRPPVRKCWYYVKVRPGLKEFFAKIAPLYEMHIYTMATRAYALEIAKIIDPDGSLFG 294
           YMGP+PP RKCWYYVK+RPGLKEFF KIAP +E+HIYTMATRAYALEIAKIIDPDG LFG
Sbjct: 218 YMGPKPPARKCWYYVKLRPGLKEFFEKIAPHFELHIYTMATRAYALEIAKIIDPDGKLFG 277

Query: 295 SRILSRDENGSLTQKSLERLFPTDQSMVIIIDDRGDVWNWCNNLIKVIPYNFFVGIGDIN 354
            RILSRDENGS+T KSLERLFP DQSMV+IIDDRGDVWNWC NLIKV+PY+FFVG+GDIN
Sbjct: 278 DRILSRDENGSITHKSLERLFPMDQSMVVIIDDRGDVWNWCENLIKVVPYSFFVGVGDIN 337

Query: 355 SNFLPRQQSTMLQLGIRSHKKKNTNETLNSEDDKSDSTLSVHEKDKTEELLTDIMDTEKK 414
           SNFLPRQQ++ML LG R H+KK                       + EELLTDI+DTEKK
Sbjct: 338 SNFLPRQQNSMLHLG-RRHRKKA----------------------EEEELLTDILDTEKK 374

Query: 415 LQKKIDEEVRRQEKKLIKDEMPKRKSISDESSNNELSKKIEFSASLEVQQQNRPLATLQR 474
           LQ+KIDEEV+RQE+KL K  M + K   D +S  +L+KK+E SASLEVQQQNRPLA LQ+
Sbjct: 375 LQEKIDEEVKRQEEKLSK--MTEEKQPEDTNSKEDLAKKLEHSASLEVQQQNRPLAELQK 432

Query: 475 HRQNQRLLIDDDDELFYLKDILTEVHDTFYEQLDEDKNESVSIQTLMPRLKFSVFSGYNF 534
           H  NQ+LLIDDDDEL +L  IL +VH  +YE L +  +   +I+ LMP+LK  VF   +F
Sbjct: 433 HLHNQKLLIDDDDELPHLSRILLQVHGKYYEDLSKHSSPP-NIKNLMPQLKKRVFCKCSF 491

Query: 535 VFSGLIPLGTDIRRADIVLWTNMFGANSTADIDENTTHVITKTAGTYKARLAKAFNPEIK 594
           VFSGLIPLGTD+R+ADI LWT+MFGA +TADIDE TTH+ITKT GT+KARLAKAFNPEIK
Sbjct: 492 VFSGLIPLGTDVRKADIALWTSMFGAKTTADIDEATTHIITKTPGTFKARLAKAFNPEIK 551

Query: 595 VVHPDWIFECLVSWKRMPEKPYELIIEQPAS 625
           VVHPDWIFECLV+WKR+ EK YEL+IEQP S
Sbjct: 552 VVHPDWIFECLVNWKRVDEKAYELLIEQPVS 582

>YMR277W Chr13 (820256..822454) [2199 bp, 732 aa] {ON}
           FCP1Carboxy-terminal domain (CTD) phosphatase, essential
           for dephosphorylation of the repeated C-terminal domain
           of the RNA polymerase II large subunit (Rpo21p)
          Length = 732

 Score =  747 bits (1929), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 374/681 (54%), Positives = 464/681 (68%), Gaps = 42/681 (6%)

Query: 1   MSTPVLSPADLPFPITIDQLITPIGSHVEKGQRLFAYKFWYMVEIAQSPDNNDPTXXXXX 60
           M+T + SP  LP+PI ID+LI  +GS++ +G RL  YKFWY+VE A    ++D       
Sbjct: 1   MTTQIRSPQGLPYPIQIDKLIPSVGSYLHEGDRLLVYKFWYLVERASDTGDDD------- 53

Query: 61  XXXXXXXXXXXXXXXXXHQKKSIRESIEFFESPFEGDLIGWNVDKGDEIISENQLLCDIK 120
                               K +RESIEFFESP+EGDLI WNVD GDE+ + NQ++C+IK
Sbjct: 54  NEHDVSPGGSAGSNGVSPPTKQLRESIEFFESPYEGDLISWNVDVGDEVATANQVICEIK 113

Query: 121 RPCNHDIVYAGICTQCGKEVDDSDIMDASLSISHTDTNLKISRKEARDIDQSSMSRXXXX 180
           RPCNHDIVY G+CTQCGKEV  +D  D        D +L+IS  EA    ++        
Sbjct: 114 RPCNHDIVYGGLCTQCGKEVS-ADAFDGVPLDVVGDVDLQISETEAIRTGKALKEHLRRD 172

Query: 181 XXXXXXXXXXQTVIHCGVDPTIGEWKNDPKNPNYETLKDVRSFSLDEEPILPPSYMGPR- 239
                     QT+IHCGVDPTI EWKNDP NPN+ETL+DV+SF+LDEE +LP  YM    
Sbjct: 173 KKLILVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNDDG 232

Query: 240 -----PPVRKCWYYVKVRPGLKEFFAKIAPLYEMHIYTMATRAYALEIAKIIDPDGSLFG 294
                PPVRKCWYYVKVRPGLKEFFAK+APL+EMHIYTMATRAYAL+IAKI+DP G LFG
Sbjct: 233 SMLRPPPVRKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGELFG 292

Query: 295 SRILSRDENGSLTQKSLERLFPTDQSMVIIIDDRGDVWNWCNNLIKVIPYNFFVGIGDIN 354
            RILSRDENGSLT KSL +LFPTDQSMV++IDDRGDVWNWC NLIKV+PYNFFVG+GDIN
Sbjct: 293 DRILSRDENGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDIN 352

Query: 355 SNFLPRQQSTMLQLGIRSHKKKNTNETLNSEDDKSDSTLSVHEKDKTEELLTDIMDTEKK 414
           SNFLP+Q + MLQLG ++ +K                        +++ELLTDIMD EKK
Sbjct: 353 SNFLPKQSTGMLQLGRKTRQKSQ----------------------ESQELLTDIMDNEKK 390

Query: 415 LQKKIDEEVRRQEKKLIKDEMPKRKSISDESSNNELSKKIEFSASLEVQQQNRPLATLQR 474
           LQ+KID+EV+RQE+KL        +  ++ES   EL+KK+E+SASLEVQQQNRPLA LQ+
Sbjct: 391 LQEKIDKEVKRQEEKLNHQLATAEEPPANESK-EELTKKLEYSASLEVQQQNRPLAKLQK 449

Query: 475 HRQNQRLLIDDDDELFYLKDILTEVHDTFYEQLDEDKNESVSIQTLMPRLKFSVFSGYNF 534
           H  +Q+LL+DDDDEL+YL   L+ +H T+Y+ L +      ++  ++P LK  VF    F
Sbjct: 450 HLHDQKLLVDDDDELYYLMGTLSNIHKTYYDMLSQQNEPEPNLMEIIPSLKQKVFQNCYF 509

Query: 535 VFSGLIPLGTDIRRADIVLWTNMFGANSTADIDENTTHVITKTAGTYKARLAKAFNPEIK 594
           VFSGLIPLGTDI+R+DIV+WT+ FGA ST DID  TTH+ITK   TYKARLAK FNP+IK
Sbjct: 510 VFSGLIPLGTDIQRSDIVIWTSTFGATSTPDIDYLTTHLITKNPSTYKARLAKKFNPQIK 569

Query: 595 VVHPDWIFECLVSWKRMPEKPYELIIEQPASXXXXXXXXXXXXXXXXXXXXXXXXTEAQF 654
           +VHPDWIFECLV+WK++ EKPY LI++ P S                        T+ Q 
Sbjct: 570 IVHPDWIFECLVNWKKVDEKPYTLIVDSPIS----DEELQNFQTQLQKRQEYLEETQEQQ 625

Query: 655 EALNTRDPAIDLFASGTSWLN 675
             L +++  ++LFA+GTSWLN
Sbjct: 626 HMLTSQE-NLNLFAAGTSWLN 645

>Skud_13.449 Chr13 (793592..795796) [2205 bp, 734 aa] {ON} YMR277W
           (REAL)
          Length = 734

 Score =  744 bits (1922), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/681 (54%), Positives = 462/681 (67%), Gaps = 41/681 (6%)

Query: 1   MSTPVLSPADLPFPITIDQLITPIGSHVEKGQRLFAYKFWYMVEIAQSPDNNDPTXXXXX 60
           M+T + SP  LP+PI ID+L+  +GS++ +G RL  YKFWY+VE A     +D       
Sbjct: 1   MTTQIRSPEGLPYPIQIDKLVPSVGSYLHEGDRLIVYKFWYLVERASDTTGDDDNEHDAT 60

Query: 61  XXXXXXXXXXXXXXXXXHQKKSIRESIEFFESPFEGDLIGWNVDKGDEIISENQLLCDIK 120
                               K +RESIEFFESP+EGDLI WNVD GDEI + NQ++C+IK
Sbjct: 61  PGGGAGSGSVSPPT------KQLRESIEFFESPYEGDLISWNVDVGDEIATANQVICEIK 114

Query: 121 RPCNHDIVYAGICTQCGKEVDDSDIMDASLSISHTDTNLKISRKEARDIDQSSMSRXXXX 180
           RPCNHDIVY G+CTQCGKEV  +D  D        D +L+IS  EA    ++        
Sbjct: 115 RPCNHDIVYGGLCTQCGKEVS-ADAFDGVPLDVVGDMDLQISETEAIRSGEALKEHLRRD 173

Query: 181 XXXXXXXXXXQTVIHCGVDPTIGEWKNDPKNPNYETLKDVRSFSLDEEPILPPSYMGPR- 239
                     QT+IHCGVDPTI EWKNDP NPN+ETL+DV+SF+LDEE +LP  YM    
Sbjct: 174 KKLILVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNEDG 233

Query: 240 -----PPVRKCWYYVKVRPGLKEFFAKIAPLYEMHIYTMATRAYALEIAKIIDPDGSLFG 294
                PPVRKCWYYVKVRPGLKEFF K+APL+EMHIYTMATRAYA++IAKI+DP G LFG
Sbjct: 234 SVLKPPPVRKCWYYVKVRPGLKEFFDKVAPLFEMHIYTMATRAYAIQIAKIVDPTGELFG 293

Query: 295 SRILSRDENGSLTQKSLERLFPTDQSMVIIIDDRGDVWNWCNNLIKVIPYNFFVGIGDIN 354
            RILSRDENGSLT KSL +LFPTDQSMV++IDDRGDVWNWC NLIKV+PYNFFVG+GDIN
Sbjct: 294 DRILSRDENGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDIN 353

Query: 355 SNFLPRQQSTMLQLGIRSHKKKNTNETLNSEDDKSDSTLSVHEKDKTEELLTDIMDTEKK 414
           SNFLP+Q + MLQLG ++ +K                        +++ELLTDIMD EKK
Sbjct: 354 SNFLPKQSTGMLQLGRKTRQKSQ----------------------ESQELLTDIMDNEKK 391

Query: 415 LQKKIDEEVRRQEKKLIKDEMPKRKSISDESSNNELSKKIEFSASLEVQQQNRPLATLQR 474
           LQ+KID+EV+RQE+KL   ++   +  S   S  EL+KK+E+SASLEVQQQNRPLA LQ+
Sbjct: 392 LQEKIDKEVKRQEEKL-NHQLATAEEPSANESKEELTKKLEYSASLEVQQQNRPLAKLQK 450

Query: 475 HRQNQRLLIDDDDELFYLKDILTEVHDTFYEQLDEDKNESVSIQTLMPRLKFSVFSGYNF 534
           H  +Q+LL+DDDDEL+YL   L+ +H+T+Y+ + +      ++  ++P LK  VF   +F
Sbjct: 451 HLHDQKLLVDDDDELYYLMGTLSNIHNTYYQMISQSNEPEPNLMEIIPSLKQKVFQNCHF 510

Query: 535 VFSGLIPLGTDIRRADIVLWTNMFGANSTADIDENTTHVITKTAGTYKARLAKAFNPEIK 594
           VFSGLIPLGTDI+R+DIV+WT+ FGA ST+DID  TTH+ITK   TYKARLAK FNPEIK
Sbjct: 511 VFSGLIPLGTDIQRSDIVIWTSTFGATSTSDIDYLTTHLITKNPSTYKARLAKKFNPEIK 570

Query: 595 VVHPDWIFECLVSWKRMPEKPYELIIEQPASXXXXXXXXXXXXXXXXXXXXXXXXTEAQF 654
           ++HPDWIFECLV+WK++ EKPY LI++ P S                           Q 
Sbjct: 571 IIHPDWIFECLVNWKKVDEKPYTLIVDSPISDEELQNFQKQLQKRQEYLEE-----NQQQ 625

Query: 655 EALNTRDPAIDLFASGTSWLN 675
           + + T    ++LFA+GTSWLN
Sbjct: 626 QHMLTPQENLNLFAAGTSWLN 646

>Smik_13.490 Chr13 (803288..805486) [2199 bp, 732 aa] {ON} YMR277W
           (REAL)
          Length = 732

 Score =  743 bits (1917), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/680 (54%), Positives = 463/680 (68%), Gaps = 42/680 (6%)

Query: 1   MSTPVLSPADLPFPITIDQLITPIGSHVEKGQRLFAYKFWYMVEIAQSPDNNDPTXXXXX 60
           M+T + SP  LP+PI ID+LI  +GS++ +G RL  YKFWY+VE A     +D       
Sbjct: 1   MTTQIRSPEGLPYPIQIDKLIPSVGSYLHEGDRLLVYKFWYLVERASETGVDD------- 53

Query: 61  XXXXXXXXXXXXXXXXXHQKKSIRESIEFFESPFEGDLIGWNVDKGDEIISENQLLCDIK 120
                               K +RESIEFFESP+EGDLI WNVD GDE+ + NQ++C+IK
Sbjct: 54  NEHDASPGGGAGSNGVSPPTKQLRESIEFFESPYEGDLISWNVDVGDEVATANQVICEIK 113

Query: 121 RPCNHDIVYAGICTQCGKEVDDSDIMDASLSISHTDTNLKISRKEARDIDQSSMSRXXXX 180
           RPCNHDIVY G+CTQCGKEV  +D  D        D +L+IS  EA    ++        
Sbjct: 114 RPCNHDIVYGGLCTQCGKEVS-ADAFDGVPLDVVGDMDLQISETEAIRTGKALKEHLRRD 172

Query: 181 XXXXXXXXXXQTVIHCGVDPTIGEWKNDPKNPNYETLKDVRSFSLDEEPILPPSYMGPR- 239
                     QT+IHCGVDPTI EWKNDP NPN+ETL+DV+SF+LDEE +LP  YM    
Sbjct: 173 KKLILVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNEDG 232

Query: 240 -----PPVRKCWYYVKVRPGLKEFFAKIAPLYEMHIYTMATRAYALEIAKIIDPDGSLFG 294
                PPVRKCWYYVKVRPGLKEFFAK+APL+EMHIYTMATRAYAL+IAKI+DP G LFG
Sbjct: 233 SVLRPPPVRKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGKLFG 292

Query: 295 SRILSRDENGSLTQKSLERLFPTDQSMVIIIDDRGDVWNWCNNLIKVIPYNFFVGIGDIN 354
            RILSRDENGSLT KSL +LFPTDQSMV++IDDRGDVWNWC NLIKV+PYNFFVG+GDIN
Sbjct: 293 DRILSRDENGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDIN 352

Query: 355 SNFLPRQQSTMLQLGIRSHKKKNTNETLNSEDDKSDSTLSVHEKDKTEELLTDIMDTEKK 414
           SNFLP+Q + MLQLG ++ +K                        +++ELLTDIMD EKK
Sbjct: 353 SNFLPKQSTGMLQLGRKTRQKSQ----------------------ESQELLTDIMDNEKK 390

Query: 415 LQKKIDEEVRRQEKKLIKDEMPKRKSISDESSNNELSKKIEFSASLEVQQQNRPLATLQR 474
           LQ+KID+EV+RQE+KL        +  ++ES   EL+KK+E+SASLEVQQQNRPLA LQ+
Sbjct: 391 LQEKIDKEVKRQEEKLNHQLATAEEPPANESK-EELTKKLEYSASLEVQQQNRPLAKLQK 449

Query: 475 HRQNQRLLIDDDDELFYLKDILTEVHDTFYEQLDEDKNESVSIQTLMPRLKFSVFSGYNF 534
           H  +Q+LL+DDDDEL+YL   L+ +H T+Y+ L ++     ++  ++P LK  VF    F
Sbjct: 450 HLHDQKLLVDDDDELYYLMGTLSNIHMTYYQMLSQENEPEPNLMEIIPSLKQKVFQNCFF 509

Query: 535 VFSGLIPLGTDIRRADIVLWTNMFGANSTADIDENTTHVITKTAGTYKARLAKAFNPEIK 594
           VFSGLIPLGTDI+R+DIV+WT+ FGA ST+DID  TTH+ITK   TYKARLAK FNPEIK
Sbjct: 510 VFSGLIPLGTDIQRSDIVIWTSTFGATSTSDIDFLTTHLITKNPSTYKARLAKKFNPEIK 569

Query: 595 VVHPDWIFECLVSWKRMPEKPYELIIEQPASXXXXXXXXXXXXXXXXXXXXXXXXTEAQF 654
           +VHPDWIFECLV+WK++ EKPY LI++ P S                         + Q 
Sbjct: 570 IVHPDWIFECLVNWKKVDEKPYTLIVDSPIS----DEELQNFQSQLQKRQEYLEENQEQQ 625

Query: 655 EALNTRDPAIDLFASGTSWL 674
             L +++  ++LFA+GTSWL
Sbjct: 626 HMLTSQE-NLNLFATGTSWL 644

>Suva_13.465 Chr13 (802947..805145) [2199 bp, 732 aa] {ON} YMR277W
           (REAL)
          Length = 732

 Score =  741 bits (1914), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 374/681 (54%), Positives = 457/681 (67%), Gaps = 43/681 (6%)

Query: 1   MSTPVLSPADLPFPITIDQLITPIGSHVEKGQRLFAYKFWYMVEIAQSPDNNDPTXXXXX 60
           M+T + SP  LP+PI ID+LI  +GS +++G RL  YKFWY+VE         P+     
Sbjct: 1   MTTQIRSPEGLPYPIQIDKLIPSVGSFLQEGDRLLVYKFWYLVE--------RPSDAGDD 52

Query: 61  XXXXXXXXXXXXXXXXXHQKKSIRESIEFFESPFEGDLIGWNVDKGDEIISENQLLCDIK 120
                               K +RESIEFFESP+EGDLI WNVD GDEI + NQ++C+IK
Sbjct: 53  DNDHDSSPGGGGGGSVSPPTKQLRESIEFFESPYEGDLISWNVDVGDEIATANQVICEIK 112

Query: 121 RPCNHDIVYAGICTQCGKEVDDSDIMDASLSISHTDTNLKISRKEARDIDQSSMSRXXXX 180
           RPCNHDIVY G+CTQCGKEV  +D  D        D +L+IS  EA    ++        
Sbjct: 113 RPCNHDIVYGGLCTQCGKEVS-ADAFDGVPLDVVGDMDLQISETEAIRTGRALKEHLRRD 171

Query: 181 XXXXXXXXXXQTVIHCGVDPTIGEWKNDPKNPNYETLKDVRSFSLDEEPILPPSYMG--- 237
                     QT+IHCGVDPTI EWKNDP NPN+ETL+DV+SF+LDEE +LP  YM    
Sbjct: 172 KKLILVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMAEDG 231

Query: 238 --PRPP-VRKCWYYVKVRPGLKEFFAKIAPLYEMHIYTMATRAYALEIAKIIDPDGSLFG 294
             P+PP VRKCWYYVKVRPGLKEFFAK+APL+EMHIYTMATRAYAL+IAKI+DP G LFG
Sbjct: 232 SVPKPPPVRKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGELFG 291

Query: 295 SRILSRDENGSLTQKSLERLFPTDQSMVIIIDDRGDVWNWCNNLIKVIPYNFFVGIGDIN 354
            RILSRDENGSLT KSL +LFPTDQSMV++IDDRGDVWNWC NLIKV+PYNFFVG+GDIN
Sbjct: 292 DRILSRDENGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDIN 351

Query: 355 SNFLPRQQSTMLQLGIRSHKKKNTNETLNSEDDKSDSTLSVHEKDKTEELLTDIMDTEKK 414
           SNFLP+Q + MLQLG ++ +K                        +++EL+TDIMD EKK
Sbjct: 352 SNFLPKQSTGMLQLGRKTRQKSQ----------------------ESQELITDIMDNEKK 389

Query: 415 LQKKIDEEVRRQEKKLIKDEMPKRKSISDESSNNELSKKIEFSASLEVQQQNRPLATLQR 474
           LQ+KID EV+RQE++L   ++   +  S   S  EL+KK+E+SASLEVQQQNRPLA LQ+
Sbjct: 390 LQEKIDIEVKRQEEQL-NHQLATAEEPSANESKEELTKKLEYSASLEVQQQNRPLAKLQK 448

Query: 475 HRQNQRLLIDDDDELFYLKDILTEVHDTFYEQLDEDKNESVSIQTLMPRLKFSVFSGYNF 534
           H  +Q+LL+DDDDEL YL   L  +H T+Y+ L +      ++  ++P LK  VF    F
Sbjct: 449 HLHDQKLLVDDDDELHYLMSTLLNIHKTYYQMLSQPGEIEPNLMEIIPSLKQKVFQNCYF 508

Query: 535 VFSGLIPLGTDIRRADIVLWTNMFGANSTADIDENTTHVITKTAGTYKARLAKAFNPEIK 594
           VFSGLIPLGTDI+R+DIV+WT+ FGA ST+DI+  TTH+ITK  GTYKARLAK FNPEIK
Sbjct: 509 VFSGLIPLGTDIQRSDIVIWTSTFGATSTSDINYLTTHLITKNPGTYKARLAKKFNPEIK 568

Query: 595 VVHPDWIFECLVSWKRMPEKPYELIIEQPASXXXXXXXXXXXXXXXXXXXXXXXXTEAQF 654
           VVHPDWIFECLV+WK++ EKPY LI++ P S                             
Sbjct: 569 VVHPDWIFECLVNWKKVDEKPYTLIVDSPISDDELQSFQKQLQKKQEYLDEHHEQQHMLM 628

Query: 655 EALNTRDPAIDLFASGTSWLN 675
              N     I+LFA+GTSWLN
Sbjct: 629 PQEN-----INLFAAGTSWLN 644

>Ecym_4610 Chr4 (1188871..1191126) [2256 bp, 751 aa] {ON} similar to
           Ashbya gossypii ABL127W
          Length = 751

 Score =  730 bits (1885), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 360/638 (56%), Positives = 451/638 (70%), Gaps = 61/638 (9%)

Query: 1   MSTPVLSPADLPFPITIDQLITPIGSHVEKGQRLFAYKFWYMVEIAQSPDNNDPTXXXXX 60
           MSTP+  P +LP+PIT+ QL    G  VE+GQRLFAYK+W   +I  SP +         
Sbjct: 1   MSTPIRLPDNLPYPITVAQLAVSAGDMVERGQRLFAYKYWDFEQIVTSPGDESAG----- 55

Query: 61  XXXXXXXXXXXXXXXXXHQKKSIRESIEF---FESPFEGDLIGWNVDKGDEIISENQLLC 117
                               KS R+ I+    F+SP  G ++  N+  GDE ++    + 
Sbjct: 56  -------------------GKSKRQRIDLVGTFDSPVSGQVVSLNITLGDEFVNSQCTVA 96

Query: 118 DIKRPCNHDIVYAGICTQCGKEVDD----SDIMD--ASLSISHTDTNLKISRKEARDIDQ 171
           +IK+PC HD+ Y G+C QCG+ V+D      ++D  A L++SHT+ N++IS K+A  +++
Sbjct: 97  EIKQPCTHDVTYGGLCVQCGQTVEDEQTSGSLLDNQAKLTMSHTNMNIRISEKQAYTLEK 156

Query: 172 SSMSRXXXXXXXXXXXXXXQTVIHCGVDPTIGEWKNDPKNPNYETLKDVRSFSLDEEPIL 231
           S+  +              QTVIHCGVDPTIGEW  DP NPNYE+LKDVRSFSL EEP+L
Sbjct: 157 SAQKQLREARKLVLVVDLDQTVIHCGVDPTIGEWSKDPDNPNYESLKDVRSFSLHEEPVL 216

Query: 232 PPSYMGPRPPVRKCWYYVKVRPGLKEFFAKIAPLYEMHIYTMATRAYALEIAKIIDPDGS 291
           PP YMGP+PP RKCWYYVK+RPGL++FF+ IAP +E+HIYTMATR YALEIAKIIDPDG+
Sbjct: 217 PPFYMGPKPPTRKCWYYVKLRPGLQDFFSNIAPHFELHIYTMATRTYALEIAKIIDPDGT 276

Query: 292 LFGSRILSRDENGSLTQKSLERLFPTDQSMVIIIDDRGDVWNWCNNLIKVIPYNFFVGIG 351
           LFG RILSRDENGSLTQKSLERLFP DQSMV+IIDDRGDVWNWC NLIKV+PY+FFVGIG
Sbjct: 277 LFGDRILSRDENGSLTQKSLERLFPMDQSMVVIIDDRGDVWNWCENLIKVVPYDFFVGIG 336

Query: 352 DINSNFLPRQQSTMLQLGIRSHKKKNTNETLNSEDDKSDSTLSVHEKDKTEELLTDIMDT 411
           DINSNFLPRQQ++ML LG R+ KK   +                      EELLTDI+DT
Sbjct: 337 DINSNFLPRQQNSMLHLGRRNRKKLKQD----------------------EELLTDILDT 374

Query: 412 EKKLQKKIDEEVRRQEKKLIKDEMPKRKSISDESSNNELSKKIEFSASLEVQQQNRPLAT 471
           EKKL+ KI EEV+RQE+++ K  + + K     +S  +++KK+E +ASLEVQQQNRPLA 
Sbjct: 375 EKKLKVKISEEVKRQEEEMQK--LSEEKIPDHTTSKEDIAKKLEHNASLEVQQQNRPLAE 432

Query: 472 LQRHRQNQRLLIDDDDELFYLKDILTEVHDTFYEQLDEDKNESVS----IQTLMPRLKFS 527
           LQ+H  N+RLLIDDDDEL +L DIL  VH  +Y+QL+++K+ +      I+ L+P LK  
Sbjct: 433 LQKHLHNERLLIDDDDELPHLTDILLRVHSAYYDQLEKNKHGATELSPDIKHLIPSLKEI 492

Query: 528 VFSGYNFVFSGLIPLGTDIRRADIVLWTNMFGANSTADIDENTTHVITKTAGTYKARLAK 587
           VF G NFVFSGLIPL T+I RADIVLWTN FGA +T +ID NTTH+ITKT GT KARLA 
Sbjct: 493 VFKGCNFVFSGLIPLHTNIDRADIVLWTNTFGAKTTINIDYNTTHLITKTPGTMKARLAS 552

Query: 588 AFNPEIKVVHPDWIFECLVSWKRMPEKPYELIIEQPAS 625
           +FN +IK+VHPDWIFEC+V+WKR+ EKPYELI+E+P S
Sbjct: 553 SFNRDIKIVHPDWIFECIVNWKRVDEKPYELIVEEPVS 590

>ABL127W Chr2 (156798..158984) [2187 bp, 728 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR277W (FCP1)
          Length = 728

 Score =  721 bits (1861), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/636 (55%), Positives = 446/636 (70%), Gaps = 64/636 (10%)

Query: 1   MSTPVLSPADLPFPITIDQLITPIGSHVEKGQRLFAYKFWYMVEIAQSPDNNDPTXXXXX 60
           MSTP+  P  LP+PITI QL    G  VEKGQRL AYK+W +V++  +P   +       
Sbjct: 1   MSTPIRLPDSLPYPITIAQLGVSTGDTVEKGQRLLAYKYWDLVDVITAPGEEE------- 53

Query: 61  XXXXXXXXXXXXXXXXXHQKKSIRESIEFFESPFEGDLIGWNVDKGDEIISENQLLCDIK 120
                              +K   + +  F+SP  G ++  +V  GDE ++  + + +I+
Sbjct: 54  ---------------AGKARKQRVDLVGTFDSPVAGTVVSLDVRVGDEFVNSQRPVVEIR 98

Query: 121 RPCNHDIVYAGICTQCGKEVDDS-----DIMDASLSISHTDTNLKISRKEARDIDQSSMS 175
           + C HD+ Y G+C QCG+ V+D       +  A L++SHT+T++++S ++A  + QS+  
Sbjct: 99  QACPHDVTYGGLCVQCGQAVEDEAGAADGVEQAKLTVSHTNTHIRVSERQAASLGQSAQL 158

Query: 176 RXXXXXXXXXXXXXXQTVIHCGVDPTIGEWKNDPKNPNYETLKDVRSFSLDEEPILPPSY 235
           +              QTVIHCGVDPTIGEW  DP NPNYE LKDV+SFSLDEEP+LPP Y
Sbjct: 159 KLREARKLVLVVDLDQTVIHCGVDPTIGEWSKDPNNPNYEALKDVQSFSLDEEPVLPPFY 218

Query: 236 MGPRPPVRKCWYYVKVRPGLKEFFAKIAPLYEMHIYTMATRAYALEIAKIIDPDGSLFGS 295
           MGP+PP RKCWYYVK+RPGLKEFFAKIAP +E+HIYTMATRAYALEIAKIIDPDG LFG 
Sbjct: 219 MGPKPPTRKCWYYVKLRPGLKEFFAKIAPHFELHIYTMATRAYALEIAKIIDPDGKLFGD 278

Query: 296 RILSRDENGSLTQKSLERLFPTDQSMVIIIDDRGDVWNWCNNLIKVIPYNFFVGIGDINS 355
           RILSRDENGSLTQKSLERLFP DQSMV++IDDRGDVWNWC NLIKV+PY+FFVGIGDINS
Sbjct: 279 RILSRDENGSLTQKSLERLFPMDQSMVVVIDDRGDVWNWCENLIKVVPYDFFVGIGDINS 338

Query: 356 NFLPRQQSTMLQLGIRSHKKKNTNETLNSEDDKSDSTLSVHEKDKTEELLTDIMDTEKKL 415
           NFLP QQ++ML LG R+ KK                        + EELLTDI+DTEKKL
Sbjct: 339 NFLPIQQNSMLHLGRRNRKKPK----------------------QEEELLTDILDTEKKL 376

Query: 416 QKKIDEEVRRQE---KKLIKDEMPKRKSISDESSNNELSKKIEFSASLEVQQQNRPLATL 472
           ++KI+EEV+RQE    +L  +++P  + I         +KK+E +ASLEVQQQNRPLA L
Sbjct: 377 KEKINEEVKRQEDQMHRLTDEKLPDTRDI---------AKKLEHNASLEVQQQNRPLAEL 427

Query: 473 QRHRQNQRLLIDDDDELFYLKDILTEVHDTFYEQL---DEDKNESVSIQTLMPRLKFSVF 529
           Q+H +N+RLL DDDDEL +L +IL +VH  +Y+QL   +  ++    I+ LMP+LK +VF
Sbjct: 428 QKHMRNERLLFDDDDELPHLGNILLKVHSAYYDQLQRYNSGEDPIPDIKILMPKLKETVF 487

Query: 530 SGYNFVFSGLIPLGTDIRRADIVLWTNMFGANSTADIDENTTHVITKTAGTYKARLAKAF 589
            G  FVFSGLIPL T+I RADIVLWTNMFGA++TA++D NTTH+IT+T GT KARLAK+F
Sbjct: 488 EGCRFVFSGLIPLHTNIERADIVLWTNMFGASTTANLDYNTTHLITRTPGTMKARLAKSF 547

Query: 590 NPEIKVVHPDWIFECLVSWKRMPEKPYELIIEQPAS 625
           NP IK+VHPDWIFECLV W+R+ E PYELI+E+P  
Sbjct: 548 NPAIKIVHPDWIFECLVGWERVEESPYELIVEEPVG 583

>Kwal_27.10263 s27 complement(268744..270975) [2232 bp, 743 aa] {ON}
           YMR277W (FCP1) - TFIIF interacting component of CTD
           phosphatase [contig 37] FULL
          Length = 743

 Score =  721 bits (1860), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/635 (55%), Positives = 451/635 (71%), Gaps = 63/635 (9%)

Query: 1   MSTPVLSPADLPFPITIDQLITPIGSHVEKGQRLFAYKFWYMVEIAQSPDNNDPTXXXXX 60
           M+TP+  P +LPFPITI +L    G  V KGQRLF YK+W + ++  +P+          
Sbjct: 1   MTTPIRLPPNLPFPITIAKLYVSKGESVTKGQRLFVYKYWELQDVITAPNEE-------- 52

Query: 61  XXXXXXXXXXXXXXXXXHQKKSIRESIEFFESPFEGDLIGWNVDKGDEIISENQLLCDIK 120
                             +KK   + I  F+SP EG L+   V  GDE ++++ ++ +++
Sbjct: 53  ----------------ASKKKRRVDLIGTFDSPIEGTLVSLKVRVGDEFVNDSNIIAELR 96

Query: 121 RPCNHDIVYAGICTQCGKEVDDSD-------IMDASLSISHTDTNLKISRKEARDIDQSS 173
           +PC+H++ Y  +C  CGK VD+ D       + +  L+++H +TN+K+S ++A  I++++
Sbjct: 97  QPCSHEVTYGALCVVCGKAVDEDDSNMSGSGVSNGKLTVAHNNTNIKVSERQAASIEKTA 156

Query: 174 MSRXXXXXXXXXXXXXXQTVIHCGVDPTIGEWKNDPKNPNYETLKDVRSFSLDEEPILPP 233
                            QTVIHCGVDPTI EW NDP NPNY+ LK+V++FSLDE+PILPP
Sbjct: 157 QKELRERKKLVLVVDLDQTVIHCGVDPTIKEWANDPSNPNYDALKNVKTFSLDEDPILPP 216

Query: 234 SYMGPRPPVRKCWYYVKVRPGLKEFFAKIAPLYEMHIYTMATRAYALEIAKIIDPDGSLF 293
            YMGPRPP R+C YYVK+RPGL+EFF K+AP +E+HIYTMATRAYALEIAKIIDP  +LF
Sbjct: 217 FYMGPRPPPRRCQYYVKLRPGLQEFFDKVAPHFELHIYTMATRAYALEIAKIIDPTSALF 276

Query: 294 GSRILSRDENGSLTQKSLERLFPTDQSMVIIIDDRGDVWNWCNNLIKVIPYNFFVGIGDI 353
           G RILSRDENGSLT KSLERLFP DQSMV+IIDDRGDVW+WC NLIKV+PYNFFVG+GDI
Sbjct: 277 GDRILSRDENGSLTHKSLERLFPMDQSMVVIIDDRGDVWSWCENLIKVVPYNFFVGVGDI 336

Query: 354 NSNFLPRQQSTMLQLGIRSHKKKNTNETLNSEDDKSDSTLSVHEKDKTEELLTDIMDTEK 413
           NSNFLPRQQ++ML +G R H+KK                       + EELLTDIMDTEK
Sbjct: 337 NSNFLPRQQNSMLHMG-RRHRKKA----------------------EEEELLTDIMDTEK 373

Query: 414 KLQKKIDEEVRRQEKKL--IKDEMPKRKSISDESSNNELSKKIEFSASLEVQQQNRPLAT 471
           KLQ+KID+EV++QE+K   I +E    +S+S E    +L+KK+E +ASLEVQQQNRPLA 
Sbjct: 374 KLQEKIDQEVKKQEEKFNKISEENQPDRSMSKE----DLTKKLEHNASLEVQQQNRPLAE 429

Query: 472 LQRHRQNQRLLIDDDDELFYLKDILTEVHDTFYEQLDEDKNESV-SIQTLMPRLKFSVFS 530
           LQ+H  NQ+LLIDDDDEL +L +IL  VH T+YE+L   K E    I+ LMP++K  VF+
Sbjct: 430 LQKHMNNQKLLIDDDDELPHLSEILLNVHRTYYEEL--AKTEVFPDIKLLMPQMKAKVFA 487

Query: 531 GYNFVFSGLIPLGTDIRRADIVLWTNMFGANSTADIDENTTHVITKTAGTYKARLAKAFN 590
             +FVFSGLIPLGT+IR ADIVLWTNMFGA +++DIDENTTHVITKT GT+KARLAK++N
Sbjct: 488 QCHFVFSGLIPLGTNIRHADIVLWTNMFGAQTSSDIDENTTHVITKTPGTFKARLAKSYN 547

Query: 591 PEIKVVHPDWIFECLVSWKRMPEKPYELIIEQPAS 625
           P+IK+VHPDWIFECLV W R  EKPYELIIEQ  S
Sbjct: 548 PDIKIVHPDWIFECLVKWVRADEKPYELIIEQEVS 582

>KLTH0C03894g Chr3 complement(339897..342134) [2238 bp, 745 aa] {ON}
           similar to uniprot|Q03254 Saccharomyces cerevisiae
           YMR277W FCP1 Carboxy-terminal domain (CTD) phosphatase
          Length = 745

 Score =  719 bits (1857), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/634 (55%), Positives = 448/634 (70%), Gaps = 61/634 (9%)

Query: 1   MSTPVLSPADLPFPITIDQLITPIGSHVEKGQRLFAYKFWYMVEIAQSPDNNDPTXXXXX 60
           M+TP+  P++LPFP+TI +L    G  V+KGQRLF YK+W + +I  +P+   P      
Sbjct: 1   MTTPIRLPSNLPFPVTIAKLCVSTGDSVKKGQRLFVYKYWELQDIITAPNEEAP------ 54

Query: 61  XXXXXXXXXXXXXXXXXHQKKSIRESIEFFESPFEGDLIGWNVDKGDEIISENQLLCDIK 120
                             +KK   + I  F+SP EG L+  N+  GDE +++  ++ ++ 
Sbjct: 55  ------------------KKKRRVDLIGTFDSPVEGTLVSLNIGLGDEFVNDANVIAEVN 96

Query: 121 RPCNHDIVYAGICTQCGKEVDDSD-------IMDASLSISHTDTNLKISRKEARDIDQSS 173
           + C+H++ Y G+C  CGK V++ D       I ++ L+++H +TN+K+S ++A  I++++
Sbjct: 97  QLCSHEVTYGGLCVVCGKTVEEDDQNVSDNGISNSKLTVAHNNTNIKVSERQAATIEKTA 156

Query: 174 MSRXXXXXXXXXXXXXXQTVIHCGVDPTIGEWKNDPKNPNYETLKDVRSFSLDEEPILPP 233
                            QTVIHCGVDPTI EW NDP NPNY+ LK+V++FSLDE+PILPP
Sbjct: 157 QKHLREHKKLVLVVDLDQTVIHCGVDPTIHEWANDPSNPNYDALKNVKTFSLDEDPILPP 216

Query: 234 SYMGPRPPVRKCWYYVKVRPGLKEFFAKIAPLYEMHIYTMATRAYALEIAKIIDPDGSLF 293
            YMGPRPP RKC YYVK+RPGL+EFF KIAP +E+HIYTMATRAYALEIAKIIDP G LF
Sbjct: 217 FYMGPRPPPRKCQYYVKLRPGLQEFFDKIAPHFELHIYTMATRAYALEIAKIIDPKGELF 276

Query: 294 GSRILSRDENGSLTQKSLERLFPTDQSMVIIIDDRGDVWNWCNNLIKVIPYNFFVGIGDI 353
           G RILSRDENGSLT KSLERLFP DQSMV+IIDDRGDVW+WC NLIKV+PYNFFVG+GDI
Sbjct: 277 GDRILSRDENGSLTHKSLERLFPMDQSMVVIIDDRGDVWSWCENLIKVVPYNFFVGVGDI 336

Query: 354 NSNFLPRQQSTMLQLGIRSHKKKNTNETLNSEDDKSDSTLSVHEKDKTEELLTDIMDTEK 413
           NSNFLPRQQ++ML LG R+ KK                        + EELLTDIMDTEK
Sbjct: 337 NSNFLPRQQNSMLHLGRRNRKKA-----------------------EEEELLTDIMDTEK 373

Query: 414 KLQKKIDEEVRRQEKKL--IKDEMPKRKSISDESSNNELSKKIEFSASLEVQQQNRPLAT 471
           KLQ+KID+EV++QE+K   I +E    + IS E    +L+KK+E +ASLEVQQQNRPLA 
Sbjct: 374 KLQEKIDQEVKKQEEKFNKINEENQPERPISKE----DLTKKLEHNASLEVQQQNRPLAE 429

Query: 472 LQRHRQNQRLLIDDDDELFYLKDILTEVHDTFYEQLDEDKNESVSIQTLMPRLKFSVFSG 531
           LQ+H  NQ+LL DDDDEL +L +IL  VH T+Y++L E + +   I+TLMP++K  VF  
Sbjct: 430 LQKHMNNQKLLTDDDDELPHLSNILLNVHKTYYDKLAE-QGQPPDIKTLMPQMKSQVFKR 488

Query: 532 YNFVFSGLIPLGTDIRRADIVLWTNMFGANSTADIDENTTHVITKTAGTYKARLAKAFNP 591
            +FVFSGLIPLGT++R+ADIVLWT+MFGA ++ D+DE TTHVITKT GT+KARLAK +NP
Sbjct: 489 CHFVFSGLIPLGTNVRQADIVLWTSMFGATTSVDVDEATTHVITKTPGTFKARLAKTYNP 548

Query: 592 EIKVVHPDWIFECLVSWKRMPEKPYELIIEQPAS 625
            IKV+HPDWIFECLV W R+ EKPYEL  EQ  S
Sbjct: 549 NIKVIHPDWIFECLVKWVRVNEKPYELTTEQDVS 582

>KLLA0D01595g Chr4 complement(141459..143618) [2160 bp, 719 aa] {ON}
           similar to uniprot|Q03254 Saccharomyces cerevisiae
           YMR277W FCP1 Carboxy-terminal domain (CTD) phosphatase ,
          Length = 719

 Score =  675 bits (1741), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 331/626 (52%), Positives = 429/626 (68%), Gaps = 54/626 (8%)

Query: 1   MSTPVLSPADLPFPITIDQLITPIGSHVEKGQRLFAYKFWYMVEIAQSPDNNDPTXXXXX 60
           + T V   +DLP+PIT+ QL    G HVEKGQRLFAY++W   ++               
Sbjct: 3   LETNVKVTSDLPYPITVAQLYVKPGDHVEKGQRLFAYEYWDFQDVL-------------- 48

Query: 61  XXXXXXXXXXXXXXXXXHQKKSIRESIEFFESPFEGDLIGWNVDKGDEIISENQLLCDIK 120
                              KK   + +  F+SP  G +  W+    DE  S N  +  I+
Sbjct: 49  ------------VKYEEKTKKQRVDRVATFDSPVSGTVKEWHCSVKDEFASANHEVITIR 96

Query: 121 RPCNHDIVYAGICTQCGKEVDDSDIMDASLSISHTDTNLKISRKEARDIDQSSMSRXXXX 180
           + CNHDI Y G+C QCG  VD+ D    +L+ISH +TN+K+S ++A  +++SS++R    
Sbjct: 97  QDCNHDITYGGLCVQCGNTVDEED-NSKNLTISHVNTNIKVSEQQAETLERSSLTRLREE 155

Query: 181 XXXXXXXXXXQTVIHCGVDPTIGEWKNDPKNPNYETLKDVRSFSLDEEPILPPSYMGPRP 240
                     QTVIHCGVDPTIGEW  DPKNPNY+ L+DV+SF+L++EPI+P  Y GP+P
Sbjct: 156 KKLVLVVDLDQTVIHCGVDPTIGEWMRDPKNPNYKALQDVKSFTLEDEPIIPSFYFGPKP 215

Query: 241 PVRKCWYYVKVRPGLKEFFAKIAPLYEMHIYTMATRAYALEIAKIIDPDGSLFGSRILSR 300
           P RK WYYVK+RPGLKEFF  ++P +EMHIYTMATR+YA EIAKIIDP G LFG RILSR
Sbjct: 216 PARKSWYYVKLRPGLKEFFEAVSPHFEMHIYTMATRSYAHEIAKIIDPTGELFGDRILSR 275

Query: 301 DENGSLTQKSLERLFPTDQSMVIIIDDRGDVWNWCNNLIKVIPYNFFVGIGDINSNFLPR 360
           DENGSLT KSLERLFP DQSMV++IDDRGDVWNW  NLIKV+PY+FFVGIGDINSNFLPR
Sbjct: 276 DENGSLTTKSLERLFPMDQSMVVVIDDRGDVWNWFENLIKVVPYSFFVGIGDINSNFLPR 335

Query: 361 QQSTMLQLGIRSHKKKNTNETLNSEDDKSDSTLSVHEKDKTEELLTDIMDTEKKLQKKID 420
           QQ+++L LG R H++K                       + E+L++DI+D EKKL++KID
Sbjct: 336 QQNSVLHLG-RHHRRKQ----------------------EEEKLISDIIDNEKKLKEKID 372

Query: 421 EEVRRQEKKL--IKDEMPKRKSISDESSNNELSKKIEFSASLEVQQQNRPLATLQRHRQN 478
           EEV+RQE+ +  I D+  +++      +  ++SKK+E SASLEVQQQNRPLA LQ+H  N
Sbjct: 373 EEVKRQEEIISHIGDDNTRKE--GGPPNKEDISKKLEHSASLEVQQQNRPLAELQKHLHN 430

Query: 479 QRLLIDDDDELFYLKDILTEVHDTFYEQLDEDKNESVSIQTLMPRLKFSVFSGYNFVFSG 538
           Q LLIDDDDEL +L  IL  VH  ++ Q  E       I+ L+P++K+ VF G +FVFSG
Sbjct: 431 QTLLIDDDDELPHLSQILLRVHKEYFNQYTEAPKNPPDIKYLLPQMKYKVFQGCHFVFSG 490

Query: 539 LIPLGTDIRRADIVLWTNMFGANSTADIDENTTHVITKTAGTYKARLAKAFNPEIKVVHP 598
           LIPL TD+R+ADIVLWT+MFGA +++DI+  TTH+IT T+ T+KARLAK+FNP+IK+VHP
Sbjct: 491 LIPLETDVRKADIVLWTDMFGATTSSDINYKTTHIITTTSRTFKARLAKSFNPDIKIVHP 550

Query: 599 DWIFECLVSWKRMPEKPYELIIEQPA 624
           DW+FECLV W+R+ E PYEL+I+ P 
Sbjct: 551 DWLFECLVQWERVKESPYELLIQDPV 576

>Smik_12.82 Chr12 (167115..168293) [1179 bp, 392 aa] {ON} YLR019W
           (REAL)
          Length = 392

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 29/45 (64%)

Query: 248 YVKVRPGLKEFFAKIAPLYEMHIYTMATRAYALEIAKIIDPDGSL 292
           YV  RPG+ EF +++  LYE+ ++T +   YA  +   +DP+G++
Sbjct: 260 YVIKRPGVDEFLSRVCQLYEVVVFTASVSRYANPLLDTLDPNGTI 304

>TPHA0E03070 Chr5 (644651..646135) [1485 bp, 494 aa] {ON} Anc_5.202
           YLL010C
          Length = 494

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 29/51 (56%)

Query: 248 YVKVRPGLKEFFAKIAPLYEMHIYTMATRAYALEIAKIIDPDGSLFGSRIL 298
           YV  RPG+ EF  +++ LYE+ ++T +   Y   +  I+DP  ++   R+ 
Sbjct: 361 YVIKRPGVDEFLKRVSELYEVVVFTASVSRYGDPLLNILDPANTIIHHRLF 411

>YLR019W Chr12 (180288..181481) [1194 bp, 397 aa] {ON}
           PSR2Functionally redundant Psr1p homolog, a plasma
           membrane phosphatase involved in the general stress
           response; required with Psr1p and Whi2p for full
           activation of STRE-mediated gene expression, possibly
           through dephosphorylation of Msn2p
          Length = 397

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 29/45 (64%)

Query: 248 YVKVRPGLKEFFAKIAPLYEMHIYTMATRAYALEIAKIIDPDGSL 292
           YV  RPG+ EF  +++ LYE+ ++T +   YA  +   +DP+G++
Sbjct: 265 YVIKRPGVDEFLNRVSQLYEVVVFTASVSRYANPLLDTLDPNGTI 309

>Skud_12.87 Chr12 (172096..173274) [1179 bp, 392 aa] {ON} YLR019W
           (REAL)
          Length = 392

 Score = 40.8 bits (94), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 29/45 (64%)

Query: 248 YVKVRPGLKEFFAKIAPLYEMHIYTMATRAYALEIAKIIDPDGSL 292
           YV  RPG+ EF  +++ +YE+ ++T +   YA  +   +DP+G++
Sbjct: 260 YVIKRPGVDEFLHRVSQVYEVVVFTASVSRYANPLLDTLDPNGTI 304

>SAKL0G12870g Chr7 (1100535..1101734) [1200 bp, 399 aa] {ON} similar
           to uniprot|Q07800 Saccharomyces cerevisiae YLL010C
          Length = 399

 Score = 40.8 bits (94), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 27/45 (60%)

Query: 248 YVKVRPGLKEFFAKIAPLYEMHIYTMATRAYALEIAKIIDPDGSL 292
           YV  RPG+ EF  ++  LYE+ ++T +   Y   +  I+DP G++
Sbjct: 267 YVIKRPGVDEFLERVGKLYEVVVFTASVSRYGDPLLDILDPRGAV 311

>NCAS0A06800 Chr1 (1346677..1348098) [1422 bp, 473 aa] {ON}
           Anc_5.202
          Length = 473

 Score = 40.8 bits (94), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 28/51 (54%)

Query: 248 YVKVRPGLKEFFAKIAPLYEMHIYTMATRAYALEIAKIIDPDGSLFGSRIL 298
           YV  RPG++EF  ++  L+E+ ++T +   Y   +  I+DP   L   R+ 
Sbjct: 340 YVIKRPGVEEFLKRVGELFEVVVFTASVARYGDPLLDILDPGRQLIHHRLF 390

>NDAI0D01860 Chr4 (437370..438914) [1545 bp, 514 aa] {ON} Anc_5.202
          Length = 514

 Score = 40.0 bits (92), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 26/51 (50%)

Query: 248 YVKVRPGLKEFFAKIAPLYEMHIYTMATRAYALEIAKIIDPDGSLFGSRIL 298
           YV  RPG+ EF  K+  L+E+ I+T +   Y   +   +DP G     R+ 
Sbjct: 381 YVIKRPGVDEFLEKVGKLFEVVIFTASVSRYGDPLLDRLDPKGKSIHHRLF 431

>Suva_10.99 Chr10 (186341..187498) [1158 bp, 385 aa] {ON} YLR019W
           (REAL)
          Length = 385

 Score = 38.9 bits (89), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 28/45 (62%)

Query: 248 YVKVRPGLKEFFAKIAPLYEMHIYTMATRAYALEIAKIIDPDGSL 292
           YV  RPG+ EF  +++ LYE+ ++T +   YA  +   +DP+ ++
Sbjct: 253 YVIKRPGVDEFLHRVSQLYEVVVFTASVSRYANPLLDTLDPNRTI 297

>KNAG0M01740 Chr13 (321477..322922) [1446 bp, 481 aa] {ON} Anc_5.202
           YLL010C
          Length = 481

 Score = 38.9 bits (89), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 26/45 (57%)

Query: 248 YVKVRPGLKEFFAKIAPLYEMHIYTMATRAYALEIAKIIDPDGSL 292
           YV  RPG+ EF  ++  LYE+ ++T +   Y   +  I+D D S+
Sbjct: 349 YVIKRPGVDEFLRRVGKLYEVVVFTASVSRYGDPLLDILDKDKSI 393

>NDAI0I02170 Chr9 (498399..499574) [1176 bp, 391 aa] {ON} Anc_5.202
          Length = 391

 Score = 38.5 bits (88), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 26/45 (57%)

Query: 248 YVKVRPGLKEFFAKIAPLYEMHIYTMATRAYALEIAKIIDPDGSL 292
           YV  RPG+ EF  ++A LYE+ ++T +   Y   +  I+D   S+
Sbjct: 259 YVIKRPGVDEFLRRVAQLYEVVVFTASVSRYGDPLLDILDSSNSI 303

>TPHA0N00670 Chr14 complement(147329..148687) [1359 bp, 452 aa] {ON}
           Anc_5.202 YLL010C
          Length = 452

 Score = 38.5 bits (88), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 23/41 (56%)

Query: 248 YVKVRPGLKEFFAKIAPLYEMHIYTMATRAYALEIAKIIDP 288
           YV  RPG+ EF   +  LYE+ ++T +   Y   +  I+DP
Sbjct: 320 YVSKRPGVDEFLKIVGDLYEVIVFTASVSRYGNPLMDILDP 360

>NCAS0D02740 Chr4 complement(525116..526312) [1197 bp, 398 aa] {ON}
           Anc_5.202
          Length = 398

 Score = 37.4 bits (85), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 25/45 (55%)

Query: 248 YVKVRPGLKEFFAKIAPLYEMHIYTMATRAYALEIAKIIDPDGSL 292
           YV  RPG+ EF  ++  LYE+ ++T +   Y   +  I+D   S+
Sbjct: 266 YVIKRPGVDEFLKRVGELYEVVVFTASVSRYGDPLLNILDQSNSV 310

>ZYRO0B10428g Chr2 (823155..824603) [1449 bp, 482 aa] {ON} similar
           to uniprot|Q07800 Saccharomyces cerevisiae YLL010C
          Length = 482

 Score = 37.4 bits (85), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 23/40 (57%)

Query: 248 YVKVRPGLKEFFAKIAPLYEMHIYTMATRAYALEIAKIID 287
           YV  RPG+ EF  K+  L+E+ I+T +   Y   +  I+D
Sbjct: 350 YVMKRPGVDEFLKKVGSLFEVVIFTASVARYGDPLLDILD 389

>TBLA0C06090 Chr3 complement(1478726..1480180) [1455 bp, 484 aa]
           {ON} Anc_5.202 YLL010C
          Length = 484

 Score = 37.4 bits (85), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 27/51 (52%)

Query: 248 YVKVRPGLKEFFAKIAPLYEMHIYTMATRAYALEIAKIIDPDGSLFGSRIL 298
           YV  RPG+  F  ++   YE+ I+T +   YA  +  ++D D +L   R+ 
Sbjct: 351 YVIKRPGVDRFLREVKKWYEIVIFTASLSRYANPLLDLLDKDHNLINHRLF 401

>KLLA0F15620g Chr6 complement(1441560..1442804) [1245 bp, 414 aa]
           {ON} similar to uniprot|Q07800 Saccharomyces cerevisiae
           YLL010C
          Length = 414

 Score = 37.0 bits (84), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 26/45 (57%)

Query: 248 YVKVRPGLKEFFAKIAPLYEMHIYTMATRAYALEIAKIIDPDGSL 292
           YV  RPG+ EF  +I  LYE+ ++T +   Y   +  I+D D ++
Sbjct: 282 YVIKRPGVDEFLRRITELYEVVVFTASVSRYGDPLLDILDKDKTI 326

>YLL010C Chr12 complement(129330..130613) [1284 bp, 427 aa] {ON}
           PSR1Plasma membrane associated protein phosphatase
           involved in the general stress response; required along
           with binding partner Whi2p for full activation of
           STRE-mediated gene expression, possibly through
           dephosphorylation of Msn2p
          Length = 427

 Score = 36.6 bits (83), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 14/42 (33%), Positives = 25/42 (59%)

Query: 248 YVKVRPGLKEFFAKIAPLYEMHIYTMATRAYALEIAKIIDPD 289
           YV  RPG++EF  ++  L+E+ ++T +   Y   +  I+D D
Sbjct: 295 YVIKRPGVEEFLERVGKLFEVVVFTASVSRYGDPLLDILDTD 336

>Smik_12.53 Chr12 complement(116428..117672) [1245 bp, 414 aa] {ON}
           YLL010C (REAL)
          Length = 414

 Score = 36.6 bits (83), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 14/42 (33%), Positives = 25/42 (59%)

Query: 248 YVKVRPGLKEFFAKIAPLYEMHIYTMATRAYALEIAKIIDPD 289
           YV  RPG++EF  ++  L+E+ ++T +   Y   +  I+D D
Sbjct: 282 YVIKRPGVEEFLERVGKLFEVVVFTASVSRYGDPLLDILDAD 323

>CAGL0D03234g Chr4 (334913..336145) [1233 bp, 410 aa] {ON} similar
           to uniprot|Q07949 Saccharomyces cerevisiae YLR019w PSR2
           oruniprot|Q07800 Saccharomyces cerevisiae YLL010c PSR1
          Length = 410

 Score = 36.2 bits (82), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 25/45 (55%)

Query: 248 YVKVRPGLKEFFAKIAPLYEMHIYTMATRAYALEIAKIIDPDGSL 292
           YV  RPG+ EF  ++  LYE+ ++T +   Y   +  I+D   S+
Sbjct: 278 YVIKRPGVDEFLKRVGELYEVVVFTASVARYGDPLLDILDQHKSI 322

>Ecym_7276 Chr7 complement(579526..581307) [1782 bp, 593 aa] {ON}
           similar to Ashbya gossypii AGL051C
          Length = 593

 Score = 36.6 bits (83), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 35/81 (43%), Gaps = 2/81 (2%)

Query: 525 KFSVFSGYNFVFSGLIPLGTDIRRADIVLWTNMFGANSTAD-IDENTTHVITKTAGTYKA 583
           K +  SG       L+  G D+ +  + +     GA      +  +TTH +   A +   
Sbjct: 166 KMTDMSGITVCLGPLVKSG-DVTKEHMEVSLKAIGAKPLQKRVSLDTTHFVCNDAQSDDK 224

Query: 584 RLAKAFNPEIKVVHPDWIFEC 604
            LA+A N  I VV P+WI  C
Sbjct: 225 ELARAKNGNIPVVRPEWIRAC 245

>Suva_10.65 Chr10 complement(134276..135523) [1248 bp, 415 aa] {ON}
           YLL010C (REAL)
          Length = 415

 Score = 36.2 bits (82), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 14/42 (33%), Positives = 25/42 (59%)

Query: 248 YVKVRPGLKEFFAKIAPLYEMHIYTMATRAYALEIAKIIDPD 289
           YV  RPG++EF  ++  L+E+ ++T +   Y   +  I+D D
Sbjct: 283 YVIKRPGVEEFLERVGKLFEVVVFTASVSRYGDPLLDILDTD 324

>ADR369C Chr4 complement(1362309..1364792) [2484 bp, 827 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR346W
           (REV1)
          Length = 827

 Score = 36.6 bits (83), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 25/48 (52%), Gaps = 4/48 (8%)

Query: 569 NTTHVITKTAGTYKARLAKAFNPEIKVVHPDWIFECLVSWKRMPEKPY 616
           + TH++ +     K RL  A     KVV P W+  CL S + +P KPY
Sbjct: 82  DVTHIVAEHVPVAKRRLWHA----CKVVRPAWVSACLCSGELVPWKPY 125

>TDEL0E04270 Chr5 (798352..799713) [1362 bp, 453 aa] {ON} Anc_5.202
           YLL010C
          Length = 453

 Score = 36.2 bits (82), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 23/40 (57%)

Query: 248 YVKVRPGLKEFFAKIAPLYEMHIYTMATRAYALEIAKIID 287
           YV  RPG+ EF  ++  LYE+ ++T +   Y   +  I+D
Sbjct: 321 YVIKRPGVDEFLKRVGALYEVVVFTASVSRYGDPLLDILD 360

>CAGL0D05610g Chr4 complement(534849..536192) [1344 bp, 447 aa] {ON}
           similar to uniprot|Q07800 Saccharomyces cerevisiae
           YLL010c PSR1 or uniprot|Q07949 Saccharomyces cerevisiae
           YLR019w PSR2
          Length = 447

 Score = 35.8 bits (81), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 13/40 (32%), Positives = 23/40 (57%)

Query: 248 YVKVRPGLKEFFAKIAPLYEMHIYTMATRAYALEIAKIID 287
           YV  RPG+ EF  ++  LYE+ ++T +   Y   +  ++D
Sbjct: 315 YVIKRPGVDEFLQRVGELYEVVVFTASVSRYGDPLLDVLD 354

>Ecym_7104 Chr7 (203366..204844) [1479 bp, 492 aa] {ON} similar to
           Ashbya gossypii AAL158W
          Length = 492

 Score = 35.8 bits (81), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 23/40 (57%)

Query: 248 YVKVRPGLKEFFAKIAPLYEMHIYTMATRAYALEIAKIID 287
           YV  RPG+ EF  ++  LYE+ ++T +   Y   +  I+D
Sbjct: 360 YVIKRPGVDEFLRRVGELYEVVVFTASVSRYGDPLLDILD 399

>KAFR0A06560 Chr1 complement(1329583..1331250) [1668 bp, 555 aa]
           {ON} Anc_4.156 YLR330W
          Length = 555

 Score = 35.0 bits (79), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 33/83 (39%), Gaps = 2/83 (2%)

Query: 525 KFSVFSGYNFVFSGLIPLGTDIRRADIVLWTNMFGANS-TADIDENTTHVITKTAGTYKA 583
           K +  SG       L P+  +I    I     + GA      +  +TTH I        A
Sbjct: 167 KMTDMSGITVCLGSLDPM-LNISEEQIEKCLQVIGAKPLQKHVSIDTTHFICNDEEEEDA 225

Query: 584 RLAKAFNPEIKVVHPDWIFECLV 606
            L +A N  I +V P+WI  C V
Sbjct: 226 ELIRAKNSNIPIVRPEWIRACAV 248

>Skud_12.57 Chr12 complement(120706..121953) [1248 bp, 415 aa] {ON}
           YLL010C (REAL)
          Length = 415

 Score = 34.7 bits (78), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 13/40 (32%), Positives = 24/40 (60%)

Query: 248 YVKVRPGLKEFFAKIAPLYEMHIYTMATRAYALEIAKIID 287
           YV  RPG++EF  ++  L+E+ ++T +   Y   +  I+D
Sbjct: 283 YVIKRPGVEEFLERVGKLFEVVVFTASVSRYGDPLLDILD 322

>Kpol_1010.61 s1010 (148944..151325,151327..151743) [2799 bp, 932
           aa] {ON} (148944..151325,151327..151743) [2799 nt, 933
           aa]
          Length = 932

 Score = 34.7 bits (78), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 39/80 (48%), Gaps = 5/80 (6%)

Query: 544 TDIRRADIVLWT---NMFGANSTADIDENTTHVITK--TAGTYKARLAKAFNPEIKVVHP 598
           T   R + +L++   N  G + +  I   TTH+I+   T     A +A   +  IK V+P
Sbjct: 133 TVFNRTENILYSELINALGGSVSDMISNKTTHLISSDPTDPALIAIVASDCHSRIKQVYP 192

Query: 599 DWIFECLVSWKRMPEKPYEL 618
            W+ +C +  K + EK + L
Sbjct: 193 AWLCQCFLEVKYVDEKNFIL 212

>Kpol_2002.100 s2002 complement(238947..240380) [1434 bp, 477 aa]
           {ON} complement(238947..240380) [1434 nt, 478 aa]
          Length = 477

 Score = 34.7 bits (78), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 13/45 (28%), Positives = 25/45 (55%)

Query: 248 YVKVRPGLKEFFAKIAPLYEMHIYTMATRAYALEIAKIIDPDGSL 292
           YV  RPG+ EF  ++  ++E+ ++T +   Y   +  I+D   S+
Sbjct: 345 YVIKRPGVDEFLKRVGKIFEVVVFTASVSRYGDPLLDILDSSKSI 389

>AAL158W Chr1 (67892..69328) [1437 bp, 478 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YLL010C (PSR1) and YLR019W
           (PSR2)
          Length = 478

 Score = 34.3 bits (77), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 13/40 (32%), Positives = 23/40 (57%)

Query: 248 YVKVRPGLKEFFAKIAPLYEMHIYTMATRAYALEIAKIID 287
           YV  RPG+ EF  ++  L+E+ ++T +   Y   +  I+D
Sbjct: 346 YVIKRPGVDEFLKRVGELFEVVVFTASVSRYGDPLLDILD 385

>SAKL0E03014g Chr5 complement(245756..248248) [2493 bp, 830 aa] {ON}
           highly similar to uniprot|P40341 Saccharomyces
           cerevisiae YMR089C YTA12 Component with Afg3p of the
           mitochondrial inner membrane m-AAA protease that
           mediates degradation of misfolded or unassembled
           proteins and is also required for correct assembly of
           mitochondrial enzyme complexes
          Length = 830

 Score = 34.3 bits (77), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 33/124 (26%), Positives = 58/124 (46%), Gaps = 18/124 (14%)

Query: 374 KKKNTNETLNSEDDKSDSTLSVHEK---DKTEELLTDIMDTEKKLQKKIDEEVRRQEKKL 430
           +K N N   N EDD +D  L    K   D   E   D      + +K+ID+ ++R E+ +
Sbjct: 50  RKSNQNGKSNEEDDATDEDLDTIRKEIQDYINEAKNDKTSNWDERKKRIDDGIKRLEETI 109

Query: 431 IKDEMPKRKSISDESSNNELSKKIEFSASLEVQQQN--------RPLATLQRHRQNQRLL 482
           ++ +  ++K + +E  + E       S+S E +Q+N        R  A  Q  + N+R  
Sbjct: 110 LRQQSREKKRVENELGSQE-------SSSQEHEQKNQDDSFESERRQAEEQNKKMNERKK 162

Query: 483 IDDD 486
           I+D+
Sbjct: 163 IEDE 166

>Kwal_33.15140 s33 complement(975769..977001) [1233 bp, 410 aa] {ON}
           YLR019W (PSR2) - Plasma membrane Sodium Response 2
           [contig 94] FULL
          Length = 410

 Score = 33.5 bits (75), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 13/40 (32%), Positives = 22/40 (55%)

Query: 248 YVKVRPGLKEFFAKIAPLYEMHIYTMATRAYALEIAKIID 287
           YV  RPG+ EF   +  LYE+ ++T +   Y   +  ++D
Sbjct: 278 YVIKRPGVDEFLKLVGQLYEVVVFTASVSRYGDPLLDVLD 317

>NCAS0B06220 Chr2 complement(1173970..1175430) [1461 bp, 486 aa]
           {ON} Anc_2.293 YIL090W
          Length = 486

 Score = 33.5 bits (75), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 12/33 (36%), Positives = 19/33 (57%), Gaps = 2/33 (6%)

Query: 312 ERLFPTDQSMVIIIDDRGDVWNWCNNLIKVIPY 344
            ++FP+DQ  +I+  D    WNWCN    ++ Y
Sbjct: 443 SKIFPSDQPKIIV--DSWGFWNWCNIFFTILVY 473

>AGR014W Chr7 (742007..742666) [660 bp, 219 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YMR077C (VPS20)
          Length = 219

 Score = 33.1 bits (74), Expect = 2.0,   Method: Composition-based stats.
 Identities = 24/80 (30%), Positives = 39/80 (48%), Gaps = 2/80 (2%)

Query: 429 KLIKDEMPKRKSISDESSNNELSKKIEFSASL--EVQQQNRPLATLQRHRQNQRLLIDDD 486
           KL KD + +    +D    NE S+  E + SL  E++Q  R    L+R    QRLL    
Sbjct: 21  KLAKDNLHRHAKRTDTLIENERSELRELAKSLKGEIKQSRRARLLLKRIHYQQRLLDQCS 80

Query: 487 DELFYLKDILTEVHDTFYEQ 506
           D+L  L++++  +     E+
Sbjct: 81  DQLINLENMVMTIEFKLVEK 100

>KAFR0J00990 Chr10 complement(178980..180431) [1452 bp, 483 aa] {ON}
           Anc_5.202 YLL010C
          Length = 483

 Score = 33.1 bits (74), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 12/45 (26%), Positives = 25/45 (55%)

Query: 248 YVKVRPGLKEFFAKIAPLYEMHIYTMATRAYALEIAKIIDPDGSL 292
           YV  RPG+ EF  ++  ++E+ ++T +   Y   +  ++D   S+
Sbjct: 351 YVIKRPGVDEFLKRVGEIFEVVVFTASVSRYGDPLLDVLDKGKSI 395

>TPHA0A05110 Chr1 (1149460..1152657) [3198 bp, 1065 aa] {ON}
           Anc_5.94 YHR154W
          Length = 1065

 Score = 33.5 bits (75), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 30/60 (50%)

Query: 558 FGANSTADIDENTTHVITKTAGTYKARLAKAFNPEIKVVHPDWIFECLVSWKRMPEKPYE 617
            G  ST  + +  TH+I       K   A++   +I VV+  W+ +C++   R+PE  +E
Sbjct: 374 LGGKSTPTLSKRNTHLIFGVPYGKKYNYARSKLNKINVVNIKWLEQCVLLKSRVPENLFE 433

>NCAS0B08080 Chr2 complement(1532527..1544853) [12327 bp, 4108 aa]
            {ON} Anc_1.216 YKR054C
          Length = 4108

 Score = 33.5 bits (75), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 41/160 (25%), Positives = 78/160 (48%), Gaps = 23/160 (14%)

Query: 395  VHEKDKTEELLTDIMDTEKKLQKKIDEEVRRQEKKLIKDEMPKRKSISDESSNNELSKKI 454
            V  + K  E+L D++  ++++QK  DE++R + + L  +EM +    S E S NE S  I
Sbjct: 3221 VFAQVKYSEILRDVIPLKEEVQKMEDEQLRGKARLLAAEEMIEELGESIEKSKNEYSSLI 3280

Query: 455  EFSASL--EVQQQNRPL---------ATLQRHRQNQRLL--IDDDDELFYLKDILTEVHD 501
                 +  E++Q +R L          T +R R ++ ++      DEL     +L+ +++
Sbjct: 3281 RDVEVIKTEMEQVHRKLERAISLINKLTSERERWSKNVVEFAQLTDELIG-NCLLSSIYE 3339

Query: 502  TFYEQLDEDKNESVSIQTLMPRLKFS--------VFSGYN 533
             ++  L E +  +V+++ LM  L+ S        V+  YN
Sbjct: 3340 NYFGVLGE-RERTVALRYLMSVLRDSQIGFDNNYVYQNYN 3378

>SAKL0H20592g Chr8 complement(1805321..1806847) [1527 bp, 508 aa]
           {ON} some similarities with uniprot|Q12114 Saccharomyces
           cerevisiae YLR330W CHS5 Protein of unknown function
           involved in chitin biosynthesis by regulating Chs3p
           localization also involved in cell fusion during mating
          Length = 508

 Score = 32.3 bits (72), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 33/81 (40%), Gaps = 2/81 (2%)

Query: 525 KFSVFSGYNFVFSGLIPLGTDIRRADIVLWTNMFGANSTAD-IDENTTHVITKTAGTYKA 583
           K +  SG       L  L   + +  I    +  GA +  D +  +TTH I     +   
Sbjct: 166 KMTDMSGITVCVGPLDSL-QGVTKNQIETSLSNIGAKALQDHVGLDTTHFICNEKDSEDP 224

Query: 584 RLAKAFNPEIKVVHPDWIFEC 604
            L KA N  I VV P+W+  C
Sbjct: 225 ELEKAQNSNIPVVRPEWVRAC 245

>TPHA0H01070 Chr8 (229632..232679) [3048 bp, 1015 aa] {ON} Anc_5.94
           YHR154W
          Length = 1015

 Score = 32.3 bits (72), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 33/139 (23%), Positives = 57/139 (41%), Gaps = 15/139 (10%)

Query: 491 YLKDILTEVHDTFYEQLDEDKNESVSIQTLMPRLKFSVFSGYNFVFSGLIPLGTDIRRAD 550
           YL  ++TE  D  Y+ ++   N+ V   +  P  K  +F  Y    S          + +
Sbjct: 87  YLIPVVTE--DWVYKCIE--VNKLVKTNSFSPDEKL-IFKNYQIFLSL-----NSFNKTE 136

Query: 551 IVLWT---NMFGANSTADIDENTTHVITK--TAGTYKARLAKAFNPEIKVVHPDWIFECL 605
           ++ ++   N  G  +   I   TTH+IT   T     A +A      I  V+P W+ +C 
Sbjct: 137 VLFYSELINALGGTTVDHISTLTTHLITNDPTDQAVIATIASEQKQNISFVYPTWLCQCF 196

Query: 606 VSWKRMPEKPYELIIEQPA 624
            S   + E  + + I+  A
Sbjct: 197 KSMTLVNESDHLINIQSSA 215

>CAGL0L06644g Chr12 (750307..752793) [2487 bp, 828 aa] {ON} some
           similarities with uniprot|P38850 Saccharomyces
           cerevisiae YHR154w
          Length = 828

 Score = 32.0 bits (71), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 28/63 (44%), Gaps = 9/63 (14%)

Query: 555 TNMFGANSTADIDENTTHVITKTAGTYKAR-------LAKAFNPEIKVVHPDWIFECL-- 605
           T   G  +   I + TTH++ KT      +       L +  NP +K+V   W+ +C   
Sbjct: 146 TQTLGGITQNFISDKTTHIVIKTFDDPLVKEMDDNVILKEVLNPTMKIVSYQWLLDCFKT 205

Query: 606 VSW 608
           VSW
Sbjct: 206 VSW 208

>YOL115W Chr15 (101475..103229) [1755 bp, 584 aa] {ON}
           PAP2Non-canonical poly(A) polymerase, involved in
           nuclear RNA degradation as a component of the TRAMP
           complex; catalyzes polyadenylation of hypomodified
           tRNAs, and snoRNA and rRNA precursors; overlapping but
           non-redundant functions with Trf5p
          Length = 584

 Score = 32.0 bits (71), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 30/107 (28%), Positives = 49/107 (45%), Gaps = 11/107 (10%)

Query: 509 EDKNESVS-----IQTLMPRLKFSVFSGYNFVFSGLIPLGTDIRRADIVLWTNMFGANST 563
           E +N+++S     ++ L P     VF  Y+   + L   G+DI   D V+ + + G  S 
Sbjct: 198 EIRNQTISTIREAVKQLWPDADLHVFGSYS---TDLYLPGSDI---DCVVTSELGGKESR 251

Query: 564 ADIDENTTHVITKTAGTYKARLAKAFNPEIKVVHPDWIFECLVSWKR 610
            ++    +H+  K   T    +AKA  P IK V P       VS++R
Sbjct: 252 NNLYSLASHLKKKNLATEVEVVAKARVPIIKFVEPHSGIHIDVSFER 298

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.133    0.389 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 77,108,838
Number of extensions: 3444757
Number of successful extensions: 24122
Number of sequences better than 10.0: 832
Number of HSP's gapped: 24693
Number of HSP's successfully gapped: 949
Length of query: 768
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 651
Effective length of database: 40,065,477
Effective search space: 26082625527
Effective search space used: 26082625527
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 70 (31.6 bits)