Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0D032508.838ON68368331160.0
TDEL0B005908.838ON5413575231e-57
Kpol_1068.108.838ON6173545182e-56
ZYRO0G14146g8.838ON5073384832e-52
TPHA0I002308.838ON6143614831e-51
NCAS0B003108.838ON5643414546e-48
NDAI0E003008.838ON6643584437e-46
Kwal_27.102728.838ON5513593771e-37
KAFR0A028208.838ON4533313641e-36
Ecym_46098.838ON5203363627e-36
CAGL0B02299g8.838ON6434223604e-35
KLTH0C03916g8.838ON5703643541e-34
Skud_13.278.838ON5143593475e-34
SAKL0D01518g8.838ON5743773496e-34
YML114C (TAF8)8.838ON5103663451e-33
ABL128W8.838ON4743553314e-32
Smik_13.208.838ON5103563324e-32
Suva_13.298.838ON5093593174e-30
KLLA0D01617g8.838ON5622223062e-28
KNAG0G034108.838ON5263561796e-13
KNAG0I029304.50ON190875742.8
TBLA0G031903.292ON100199733.5
TPHA0C031602.248ON75582717.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0D03250
         (683 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0D03250 Chr4 (807946..809997) [2052 bp, 683 aa] {ON} Anc_8.8...  1204   0.0  
TDEL0B00590 Chr2 complement(113785..115410) [1626 bp, 541 aa] {O...   206   1e-57
Kpol_1068.10 s1068 complement(18964..20817) [1854 bp, 617 aa] {O...   204   2e-56
ZYRO0G14146g Chr7 (1126767..1128290) [1524 bp, 507 aa] {ON} weak...   190   2e-52
TPHA0I00230 Chr9 (41435..43279) [1845 bp, 614 aa] {ON} Anc_8.838...   190   1e-51
NCAS0B00310 Chr2 complement(37876..39570) [1695 bp, 564 aa] {ON}...   179   6e-48
NDAI0E00300 Chr5 complement(41787..43781) [1995 bp, 664 aa] {ON}...   175   7e-46
Kwal_27.10272 s27 complement(271405..273060) [1656 bp, 551 aa] {...   149   1e-37
KAFR0A02820 Chr1 (584984..586345) [1362 bp, 453 aa] {ON} Anc_8.8...   144   1e-36
Ecym_4609 Chr4 (1186861..1188423) [1563 bp, 520 aa] {ON} similar...   144   7e-36
CAGL0B02299g Chr2 (217341..219272) [1932 bp, 643 aa] {ON} some s...   143   4e-35
KLTH0C03916g Chr3 complement(342430..344142) [1713 bp, 570 aa] {...   140   1e-34
Skud_13.27 Chr13 complement(41670..43214) [1545 bp, 514 aa] {ON}...   138   5e-34
SAKL0D01518g Chr4 complement(122448..124172) [1725 bp, 574 aa] {...   139   6e-34
YML114C Chr13 complement(42043..43575) [1533 bp, 510 aa] {ON}  T...   137   1e-33
ABL128W Chr2 (155096..156520) [1425 bp, 474 aa] {ON} Syntenic ho...   132   4e-32
Smik_13.20 Chr13 complement(38299..39831) [1533 bp, 510 aa] {ON}...   132   4e-32
Suva_13.29 Chr13 complement(41778..43307) [1530 bp, 509 aa] {ON}...   126   4e-30
KLLA0D01617g Chr4 complement(143940..145628) [1689 bp, 562 aa] {...   122   2e-28
KNAG0G03410 Chr7 (731420..733000) [1581 bp, 526 aa] {ON} Anc_8.8...    74   6e-13
KNAG0I02930 Chr9 complement(576072..581798) [5727 bp, 1908 aa] {...    33   2.8  
TBLA0G03190 Chr7 (845472..848477) [3006 bp, 1001 aa] {ON} Anc_3....    33   3.5  
TPHA0C03160 Chr3 complement(699424..701691) [2268 bp, 755 aa] {O...    32   7.3  

>TBLA0D03250 Chr4 (807946..809997) [2052 bp, 683 aa] {ON} Anc_8.838
           YML114C
          Length = 683

 Score = 1204 bits (3116), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 607/683 (88%), Positives = 607/683 (88%)

Query: 1   MHSSSASIKKESNTSKLPIPDHKINQNVLKNSHPTSSNTQLLKNLPDLIQSPNRLESSCI 60
           MHSSSASIKKESNTSKLPIPDHKINQNVLKNSHPTSSNTQLLKNLPDLIQSPNRLESSCI
Sbjct: 1   MHSSSASIKKESNTSKLPIPDHKINQNVLKNSHPTSSNTQLLKNLPDLIQSPNRLESSCI 60

Query: 61  GQLLAKSIALQLKPMNDNTSISTVAFNRLLTLVDLQLNDMIYQLARLSITQRRLTIASND 120
           GQLLAKSIALQLKPMNDNTSISTVAFNRLLTLVDLQLNDMIYQLARLSITQRRLTIASND
Sbjct: 61  GQLLAKSIALQLKPMNDNTSISTVAFNRLLTLVDLQLNDMIYQLARLSITQRRLTIASND 120

Query: 121 LSLWLRSFNLNPSDLTLYLEESNFIKSKFNKDYNLLYELLRDYNTETNHNFKNPNYSTSD 180
           LSLWLRSFNLNPSDLTLYLEESNFIKSKFNKDYNLLYELLRDYNTETNHNFKNPNYSTSD
Sbjct: 121 LSLWLRSFNLNPSDLTLYLEESNFIKSKFNKDYNLLYELLRDYNTETNHNFKNPNYSTSD 180

Query: 181 LLNNKXXXXXXXRIVPPSNTILRSMPEWLPSLPPDHTYKFTPLYNEPITDETVMKKILVN 240
           LLNNK       RIVPPSNTILRSMPEWLPSLPPDHTYKFTPLYNEPITDETVMKKILVN
Sbjct: 181 LLNNKSSESSSSRIVPPSNTILRSMPEWLPSLPPDHTYKFTPLYNEPITDETVMKKILVN 240

Query: 241 EGKLAESALIKLLEASTTSEINSLPTPETDRENDLEQNINIDTNTNGNSMTLKSVSENEK 300
           EGKLAESALIKLLEASTTSEINSLPTPETDRENDLEQNINIDTNTNGNSMTLKSVSENEK
Sbjct: 241 EGKLAESALIKLLEASTTSEINSLPTPETDRENDLEQNINIDTNTNGNSMTLKSVSENEK 300

Query: 301 TNTNERLNDELLAQDETKAIYGSALQVRKIKKRFELMIDPKAETQLSEEFVYPSTFNVEE 360
           TNTNERLNDELLAQDETKAIYGSALQVRKIKKRFELMIDPKAETQLSEEFVYPSTFNVEE
Sbjct: 301 TNTNERLNDELLAQDETKAIYGSALQVRKIKKRFELMIDPKAETQLSEEFVYPSTFNVEE 360

Query: 361 YARKQVQKIREQVLFYEEKQLQAQKNPFWKYSKMIVGXXXXXXXXXXXXXXXXXXXXXXX 420
           YARKQVQKIREQVLFYEEKQLQAQKNPFWKYSKMIVG                       
Sbjct: 361 YARKQVQKIREQVLFYEEKQLQAQKNPFWKYSKMIVGPSQFHHGPHHHHHHHHHHHRRYS 420

Query: 421 XXXXXXXXXXXXXGLFGGVSKKQINHDIQQMFXXXXXXXXXXXXXXAKEKASAREIAENE 480
                        GLFGGVSKKQINHDIQQMF              AKEKASAREIAENE
Sbjct: 421 NSSTSSVSSSPSPGLFGGVSKKQINHDIQQMFNRSLNNLINSLPNLAKEKASAREIAENE 480

Query: 481 RXXXXXXXXXXXXXXXXXXXSSAGALDLHDLQKENDGLFADLGSSDDDESSTRHQNTSDK 540
           R                   SSAGALDLHDLQKENDGLFADLGSSDDDESSTRHQNTSDK
Sbjct: 481 REKKVQEMLKKKQKELNEKQSSAGALDLHDLQKENDGLFADLGSSDDDESSTRHQNTSDK 540

Query: 541 TQETHSPKLSQNEDQHANNNETQEIVKHVLEHNHNNETQEIVNHEIKENHKNGTQDIAIN 600
           TQETHSPKLSQNEDQHANNNETQEIVKHVLEHNHNNETQEIVNHEIKENHKNGTQDIAIN
Sbjct: 541 TQETHSPKLSQNEDQHANNNETQEIVKHVLEHNHNNETQEIVNHEIKENHKNGTQDIAIN 600

Query: 601 ETEQDHNNSAQEIENSETGINAAITSTSTLPGSIASPPTISEQRAPHTSAVLTTNDDVTE 660
           ETEQDHNNSAQEIENSETGINAAITSTSTLPGSIASPPTISEQRAPHTSAVLTTNDDVTE
Sbjct: 601 ETEQDHNNSAQEIENSETGINAAITSTSTLPGSIASPPTISEQRAPHTSAVLTTNDDVTE 660

Query: 661 GTSKDDSSQVEIKPSEGVASPEN 683
           GTSKDDSSQVEIKPSEGVASPEN
Sbjct: 661 GTSKDDSSQVEIKPSEGVASPEN 683

>TDEL0B00590 Chr2 complement(113785..115410) [1626 bp, 541 aa] {ON}
           Anc_8.838 YML114C
          Length = 541

 Score =  206 bits (523), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 124/357 (34%), Positives = 193/357 (54%), Gaps = 64/357 (17%)

Query: 42  LKNLPDLIQSPNRLESSCIGQLLAKSIALQLKPMNDNTSISTVAFNRLLTLVDLQLNDMI 101
           L +LP L +  +    + + ++L+K++ALQLKPM     IS  AF  L+ L+D QLNDMI
Sbjct: 12  LTHLPTLDEIDHGKTEAAVVKILSKAVALQLKPMK--ADISKFAFEHLMILIDDQLNDMI 69

Query: 102 YQLARLSITQRRLTIASNDLSLWLRSFNLNPSDLTLYLEESNFIKSKFNKDYNLLYELLR 161
            QL R S  QRR +IA  D+ L+L+ +NL P+DL    + S +    + K+++ L+ L  
Sbjct: 70  GQLHRFSNVQRRESIAKGDVHLFLQGYNLTPADLDKQHQASQYYSKTYGKEFDSLHSLKE 129

Query: 162 DYNTETNHNFKNPNYSTSDLLNNKXXXXXXXRIVPPSNTILRSMPEWLPSLPPDHTYKFT 221
            +         + +  + D++N          +V P+N ++R +P+W+P+ PPDHTYKFT
Sbjct: 130 TFTDAV----VDEDNGSEDVINE---------LVRPNNPLIRYIPKWMPAFPPDHTYKFT 176

Query: 222 PLYNEPITDETVMKKILVNEGKLAESALIKLLEASTTSEINSLPTPETDRENDLEQNINI 281
           P YN+PITDET++++ +V+EGK +E AL+ LL+          PTP +D           
Sbjct: 177 PQYNQPITDETIIRRRIVDEGKQSEVALLHLLKNMNP------PTPSSD----------- 219

Query: 282 DTNTNGNSMTLKSVSENEKTNTNERLNDELLAQDETKAIYGSALQVRKIKKRFELMIDPK 341
               +G S                   DE L ++ET AIYG+  + RK            
Sbjct: 220 ---ADGASY------------------DEALVREETAAIYGNEQKKRK----------KN 248

Query: 342 AETQLSEEFVYPST-FNVEEYARKQVQKIREQVLFYEEKQLQAQKNPFWKYSKMIVG 397
           A +        P T F++EEYAR +V+  R++V+ YEE+Q++ Q+NPF KYSK+ + 
Sbjct: 249 ASSSSDLLSKLPQTNFSIEEYARSRVEIARKKVVEYEERQMKLQRNPFIKYSKIALS 305

>Kpol_1068.10 s1068 complement(18964..20817) [1854 bp, 617 aa] {ON}
           complement(18964..20817) [1854 nt, 618 aa]
          Length = 617

 Score =  204 bits (518), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 129/354 (36%), Positives = 188/354 (53%), Gaps = 56/354 (15%)

Query: 42  LKNLPDLIQSPNRLESSCIGQLLAKSIALQLKPMNDNTSISTVAFNRLLTLVDLQLNDMI 101
           L  LP L +         I ++LAK++ALQLK MN +TSI+  AF  L++LV  Q++DM+
Sbjct: 11  LTELPTLTEYKYEETEPAIEKILAKAVALQLKSMNCDTSITKFAFEHLMSLVVGQIDDMV 70

Query: 102 YQLARLSITQRRLTIASNDLSLWLRSFNLNPSDLTLYLEESNFIKSKFNKDYNLLYELLR 161
            +L RLS  QRR T+A  D+S+WLR FNL P DL    ++S ++   ++KDY  L ++  
Sbjct: 71  LELHRLSSLQRRNTVAKADISVWLRGFNLTPEDLEEQNQKSQYLSKLYDKDYESLTKIAT 130

Query: 162 DYNTETNHNFKNPNYSTSDLLNNKXXXXXXXRIVPPSNTILRSMPEWLPSLPPDHTYKFT 221
                 +       Y   DL +         ++VP SN + + +P WLP  PPD+TYKFT
Sbjct: 131 TTTRTLST------YQKLDLTHKDTSTAQTSKLVPISNPLQKLIPSWLPDFPPDYTYKFT 184

Query: 222 PLYNEPITDETVMKKILVNEGKLAESALIKLLEASTTSEINSLPTPETDRENDLEQNINI 281
           P YN PITDET++++ +V EGK +E AL+ LL                 +E+ + +++  
Sbjct: 185 PQYNTPITDETIIRRKVVEEGKQSEKALLNLLRGG--------------QEDRISRDLKF 230

Query: 282 DTNTNGNSMTLKSVSENEKTNTNERLNDELLAQDETKAIYGSALQVRKIKKRFELMIDPK 341
                       S SE E            LA +ET A Y SA+ +R            K
Sbjct: 231 ------------SSSEME------------LATEETLATY-SAITLRN-----------K 254

Query: 342 AETQLSEEFVYPSTFNVEEYARKQVQKIREQVLFYEEKQLQAQKNPFWKYSKMI 395
             T   E+    ++ NVEEYAR +V+  R++VL YEE+QLQ Q+NPF K S++I
Sbjct: 255 HLTSFFEKEPIQNSLNVEEYARTRVEIERKKVLGYEERQLQIQRNPFLKISRLI 308

>ZYRO0G14146g Chr7 (1126767..1128290) [1524 bp, 507 aa] {ON} weakly
           similar to uniprot|Q03750 Saccharomyces cerevisiae
           YML114C TAF8 TFIID subunit (65 kDa) involved in RNA
           polymerase II transcription initiation
          Length = 507

 Score =  190 bits (483), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 130/338 (38%), Positives = 182/338 (53%), Gaps = 62/338 (18%)

Query: 60  IGQLLAKSIALQLKPMNDNTSISTVAFNRLLTLVDLQLNDMIYQLARLSITQRRLTIASN 119
           + ++LAKS+ALQLKPMN    I+  AF+RLL LVD QLNDMI QL R+S  QRR TIA  
Sbjct: 25  VVKVLAKSVALQLKPMN--AQITQFAFDRLLQLVDGQLNDMISQLHRMSNLQRRETIAKG 82

Query: 120 DLSLWLRSFNLNPSDLTLYLEESNFIKSKFNKDYNLLYELLRDYNTETNHNFKNPNYSTS 179
           D+S+ +  FN++PS + L    S F   K+ K++N L+  LRD  +   H    P     
Sbjct: 83  DISMLMEGFNISPSSIELQSRISEFYSQKYFKEFNHLHS-LRDLQSSLAHEMV-PFEDQE 140

Query: 180 DLLNNKXXXXXXXRIVPPSNTILRSMPEWLPSLPPDHTYKFTPLYNEPITDETVMKKILV 239
            +  N         +VPP+N +   +P+WLP  PPDHTYKFTP Y+ PITDET +++ +V
Sbjct: 141 AVRQNVSTV-----LVPPTNPLQDFLPKWLPDFPPDHTYKFTPQYSHPITDETTIRRQIV 195

Query: 240 NEGKLAESALIKLLEASTTSEINSLPTPETDRENDLEQNINIDTNTNGNSMTLKSVSENE 299
            E K +E AL  L +          PT      +D+                        
Sbjct: 196 EEAKQSELALSHLSQKKN-------PT------DDI------------------------ 218

Query: 300 KTNTNERLNDELLAQDETKAIYGSALQVRKIKKRFELMIDPKAETQ--LSEEFVYPST-F 356
               N    D  LA+ ET AIYGS L+ RK +        P+A +   LS+    P T F
Sbjct: 219 ---VNRSQYDSELAEQETLAIYGSQLKKRKTQH-------PQANSADLLSK---LPQTNF 265

Query: 357 NVEEYARKQVQKIREQVLFYEEKQLQAQKNPFWKYSKM 394
           +VEEYA  +++  R++VL +EE+QLQ+Q++PF K S++
Sbjct: 266 SVEEYAHNRIEVARKKVLEFEERQLQSQQDPFLKLSRI 303

>TPHA0I00230 Chr9 (41435..43279) [1845 bp, 614 aa] {ON} Anc_8.838
           YML114C
          Length = 614

 Score =  190 bits (483), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 124/361 (34%), Positives = 189/361 (52%), Gaps = 58/361 (16%)

Query: 42  LKNLPDLIQSPNRLESSCIGQLLAKSIALQLKPMNDNTSISTVAFNRLLTLVDLQLNDMI 101
           L  LP L +         +  +LAK+IALQLK MN +T+I+  AF  L +LVD QL+DM+
Sbjct: 48  LTKLPTLTEFKYEDTKGPMEVILAKAIALQLKLMNRDTTITKFAFTHLTSLVDEQLSDMV 107

Query: 102 YQLARLSITQRRLTIASNDLSLWLRSFNLNPSDLTLYLEESNFIKSKFNKDYNLLYELLR 161
            Q+ +L+  QRR  +A  D+ LWLR FNL PSDLT+  ++S +IK K+  +  LL  L  
Sbjct: 108 NQMEKLAALQRRKEVAKKDIDLWLRGFNLQPSDLTITHQQSEYIKEKYGGEVTLLNRLAT 167

Query: 162 DYNTETNHNFKNPNYSTSDLLNNKXXXXXXXRIVPPSNTILRSMPEWLPSLPPDHTYKFT 221
           D N E    FK  + +  D            ++VP +NT+   +P+WLPS PPD+TYKFT
Sbjct: 168 DTN-EVLTVFKKTDKTLKD-----DSTLETLKLVPITNTLENIIPDWLPSFPPDYTYKFT 221

Query: 222 PLYNEPITDETVMKKILVNEGKLAESALIKLLEAS--TTSEINSLPTPETDRENDLEQNI 279
           P +N+ ITD TV++K +  EGK +E AL+ LLE+   TTS++ +L   ++D         
Sbjct: 222 PQFNKHITDATVIRKKVAAEGKKSEKALLHLLESEKITTSKLLNLDKFDSD--------- 272

Query: 280 NIDTNTNGNSMTLKSVSENEKTNTNERLNDELLAQDETKAIYGSALQVRKIKKRF----- 334
           ++DT                             A+ E  A+Y      RK +  F     
Sbjct: 273 DMDT-----------------------------AKLEMDALYSGGSCDRKKRTAFFEDEE 303

Query: 335 ELMIDPKAETQLSEEFVYPSTFNVEEYARKQVQKIREQVLFYEEKQLQAQKNPFWKYSKM 394
           + M+D    +         + F++E+Y  K++  +R +V  YE+KQL+ Q +PF K + +
Sbjct: 304 DRMVDEHGNST-------SNKFDIEKYVHKRINIVRNKVKQYEDKQLRLQNDPFLKMTAL 356

Query: 395 I 395
           +
Sbjct: 357 L 357

>NCAS0B00310 Chr2 complement(37876..39570) [1695 bp, 564 aa] {ON}
           Anc_8.838 YML114C
          Length = 564

 Score =  179 bits (454), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 126/341 (36%), Positives = 186/341 (54%), Gaps = 58/341 (17%)

Query: 60  IGQLLAKSIALQLKPMNDNTSISTVAFNRLLTLVDLQLNDMIYQLARLSITQRRLTIASN 119
           + +LL KSIALQLKP+N    +S +AFN L  LV+ QL+ +I +L R+S+ QRR   A  
Sbjct: 48  VRKLLNKSIALQLKPLN--LELSQLAFNELSLLVNDQLDFLISELHRMSVIQRRNAAAKT 105

Query: 120 DLSLWLRSFNLNPSDLTLYLEESNFIKSKFNKDYNLLYELLRDYNT--ETNHNFKNPNYS 177
           D+ L LR  NLN S+L   L+ SNF+KSK  KDY+ L   ++D +T  +++    NP + 
Sbjct: 106 DIELLLRGLNLNMSELHYQLQVSNFMKSKNGKDYDTL---IKDSSTIFDSSDTMANPGHD 162

Query: 178 TSDLLNNKXXXXXXXRIVPPSNTILRSMPEWLPSLPPDHTYKFTPLYNEPITDETVMKKI 237
           +  ++NN         ++ P+N    S+P WLP+ PPDHTYKFTP +N+PITD+ ++K+ 
Sbjct: 163 S--MVNNPSNI-----LIKPNNPFEISIPNWLPAFPPDHTYKFTPQFNKPITDQVLIKQK 215

Query: 238 LVNEGKLAESALIKLLEASTTSEINSLPTPETDRENDLEQNINIDTNTNGNSMTLKSVSE 297
           L+ EGK +E +L+ LL                                  N +T +S  E
Sbjct: 216 LIEEGKKSEKSLLNLL----------------------------------NDITEQSSIE 241

Query: 298 NEKTNTNERLNDELLAQDETKAIYGSALQVRKIKKRFELMIDPKAETQLSEEFVYPST-- 355
           NE+T+      D  LA++E  AIYG     RK +K   L+     E      F +P    
Sbjct: 242 NEETSNF----DSELAREENIAIYGYDAMSRKKRKPPHLISIHDTEQNF---FNHPQGSK 294

Query: 356 -FNVEEYARKQVQKIREQVLFYEEKQLQAQKNPFWKYSKMI 395
            FNV  YA  +V+  R++V  +E +QL+ +KNPF + S+MI
Sbjct: 295 HFNVGNYAHFRVELTRKRVEEFELEQLKWEKNPFLRLSRMI 335

>NDAI0E00300 Chr5 complement(41787..43781) [1995 bp, 664 aa] {ON}
           Anc_8.838 YML114C
          Length = 664

 Score =  175 bits (443), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 125/358 (34%), Positives = 194/358 (54%), Gaps = 30/358 (8%)

Query: 60  IGQLLAKSIALQLKPMNDNTSISTVAFNRLLTLVDLQLNDMIYQLARLSITQRRLTIASN 119
           I +LL KSIA+QLK        S +AFN+L  LVD QLN +I +L RLS+ QRR ++A  
Sbjct: 30  IEKLLQKSIAIQLKAFK--VDFSKLAFNQLTLLVDDQLNSLITELHRLSLLQRRNSMAKV 87

Query: 120 DLSLWLRSFNLNPSDLTLYLEESNFIKSKF-NKDYNLLYELLRDYNTETNHNFK----NP 174
           DL LW+R FN+NPSDL    E S +I+ K   K+Y +L +L  +   +  H  +    + 
Sbjct: 88  DLELWMRGFNINPSDLNYQYESSKYIQEKLSGKEYRILRDLNEEVVKQRTHIMESSTSDD 147

Query: 175 NYSTSDLLNNKXXXXXXXRI-VPPSNTILR-SMPEWLPSLPPDHTYKFTPLYNEPITDET 232
           NY  +    N         I + P+N     ++  WLPS PPDHTYKFTP +N PITDE 
Sbjct: 148 NYDLTKQFRNISDATDSSNILIKPTNPFKGINISSWLPSFPPDHTYKFTPQFNNPITDEK 207

Query: 233 VMKKILVNEGKLAESALIKLL-------EASTTSEINSLPTPETDRENDLEQNINIDTNT 285
           ++K+ LV EG  +E AL+  L       + ++ + +   P+P    E  +       T+T
Sbjct: 208 LIKQKLVEEGTKSEKALLNFLKNISNAKKGTSIAPMTIPPSPSLSNEGPI-------TDT 260

Query: 286 NGNSMTLKSVSENEKTNTN--ERLNDELLAQDETKAIYGSALQVRKIKK--RFELMIDPK 341
           +      K+  E E+ +T    +  D  LA +ET AIYG+  Q  +I++    +  I   
Sbjct: 261 DEEEKQAKNEKEKEQEDTVIIPKDIDMNLANEETLAIYGTKSQSYEIERDSSSKPNIISI 320

Query: 342 AETQLSEEFVYPST---FNVEEYARKQVQKIREQVLFYEEKQLQAQKNPFWKYSKMIV 396
            + ++   F + S+   F+V +Y+  +V+ +R++V  +E K+L+ +KNPF K SK++ 
Sbjct: 321 HDEKIVNFFGHSSSDKKFDVNKYSHHRVELVRKKVEAFENKKLRLEKNPFLKLSKLVC 378

>Kwal_27.10272 s27 complement(271405..273060) [1656 bp, 551 aa] {ON}
           YML114C (TAF8) - TAF65, subunit of transcription factor
           TFIID [contig 37] FULL
          Length = 551

 Score =  149 bits (377), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 116/359 (32%), Positives = 176/359 (49%), Gaps = 58/359 (16%)

Query: 42  LKNLPDLIQSPNRLESSCIGQLLAKSIALQLKPMNDNTSISTVAFNRLLTLVDLQLNDMI 101
           LKNLP L + P       + +LL K+IA+QLK +N + SIS +AF  L+ LV+  L++M+
Sbjct: 21  LKNLPTLHEIPKADMDDPLKKLLEKAIAIQLKSINADASISQLAFENLIILVEEMLSNML 80

Query: 102 YQLARLSITQRRLTIASNDLSLWLRSFNLNPSDLTLYLEESNFIKSKFNKDYNLL----- 156
             L +++  QRR  I+  DL L +  +NL+ SDL L LE S +++S+  +    +     
Sbjct: 81  MDLHKMANIQRRHCISKKDLLLIIEGYNLSSSDLMLELERSRYVRSRHLEQIKKVEEDSK 140

Query: 157 YELLRDYNTETNHNFKNPNYSTSDLLNNKXXXXXXXRIVPPSNTILRSMPEWLPSLPPDH 216
           Y   +++   T +   +  +    +L+          +VPPS    + +P WLP  PPDH
Sbjct: 141 YVEKQEHTPLTQNELLSSTHPEFFVLDKDVLT-----LVPPSVKDTKHVPRWLPDFPPDH 195

Query: 217 TYKFTPLYNEPITDETVMKKILVNEGKLAESALIKLLEASTTSEINSLPTPETDRENDLE 276
           TY+FT  YN+PITDE +MK+ L  E  L+E ALI L   S   E +S P           
Sbjct: 196 TYRFTAQYNKPITDERLMKRKLAEEANLSEKALIHLSMLS-HEEASSGP----------- 243

Query: 277 QNINIDTNTNGNSMTLKSVSENEKTNTNERLNDELLAQDETKAIYGSALQVRKIKKRFEL 336
               ID++T         + E               AQ ET+ ++G       +KK+   
Sbjct: 244 ----IDSDT---------IYEE--------------AQQETQLLFGP------VKKKKTA 270

Query: 337 MIDPKAETQLSEEFVYPSTFNVEEYARKQVQKIREQVLFYEEKQLQAQKNPFWKYSKMI 395
            I+   E       +    F+VEEYAR +V+  R +V  YE  QLQ QK  F K + ++
Sbjct: 271 AIN---EVNDLLRTLPQQNFSVEEYARNRVEIARRRVNEYERHQLQLQKGAFIKAAHLL 326

>KAFR0A02820 Chr1 (584984..586345) [1362 bp, 453 aa] {ON} Anc_8.838
           YML114C
          Length = 453

 Score =  144 bits (364), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 111/331 (33%), Positives = 166/331 (50%), Gaps = 66/331 (19%)

Query: 60  IGQLLAKSIALQLKPMNDNTSISTVAFNRLLTLVDLQLNDMIYQLARLSITQRRLTIAS- 118
           +  LL KS+A++LKP+N +T +   AF+ L+ L+D+QLND+I QL RLS+ QRR + A+ 
Sbjct: 26  LDNLLVKSVAMRLKPVNLHTQLPNSAFDYLIYLMDVQLNDLIKQLGRLSLLQRRNSNATK 85

Query: 119 NDLSLWLRSFNLNPSDLTLYLEESNFIKSKFNKDYNLLYELLRDYNTETNHNFKNPNYST 178
           +D+ L L+ FNL+ S+L   LE SN IK  +++D   L E    YN  T+  F  P  ++
Sbjct: 86  SDILLLLKGFNLSESELNTELEISNHIKRLYSEDEKKLSEDSIHYNQHTD--FVGPVETS 143

Query: 179 S-DLLNNKXXXXXXXRIVPPSNTILRSMPEWLPSLPPDHTYKFTPLYNEPITDETVMKKI 237
           S  LLN             P+N +  ++P W PSLPPDHTYKFTP YN  I D  ++K+ 
Sbjct: 144 SFQLLN-------------PTNPLKDAIPSWFPSLPPDHTYKFTPKYNNFINDPKIIKQK 190

Query: 238 LVNEGKLAESALIKLLEASTTSEINSLPTPETDRENDLEQNINIDTNTNGNSMTLKSVSE 297
             +E K  ++AL  L+    ++E            NDL                      
Sbjct: 191 RFDESKTVKTALFNLINKIESNE----------ERNDLHY-------------------- 220

Query: 298 NEKTNTNERLNDELLAQDETKAIYGSALQVRKIKKRFELMIDPKAETQLSEEFVYPSTFN 357
                      DE LA+ E++A++G+  +     K        K    L+   V  + F+
Sbjct: 221 -----------DETLAKLESQALFGTVEEKMNTNK--------KVYKSLNSIIVPITKFD 261

Query: 358 VEEYARKQVQKIREQVLFYEEKQLQAQKNPF 388
           +EEY+ K+V   R +V  +E K L  + NPF
Sbjct: 262 IEEYSHKRVNIARNKVSKFENKMLALKYNPF 292

>Ecym_4609 Chr4 (1186861..1188423) [1563 bp, 520 aa] {ON} similar to
           Ashbya gossypii ABL128W
          Length = 520

 Score =  144 bits (362), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 102/336 (30%), Positives = 158/336 (47%), Gaps = 44/336 (13%)

Query: 63  LLAKSIALQLKPMNDNTSISTVAFNRLLTLVDLQLNDMIYQLARLSITQRRLTIASNDLS 122
           LL++S+ALQLK M  + SI+ + FN ++  +++Q+NDM   L R +  QRR  I+  DL 
Sbjct: 39  LLSQSVALQLKTMKSDFSITELGFNNMMQFIEMQMNDMFQILHRFANIQRRNEISIKDLK 98

Query: 123 LWLRSFNLNPSDLTLYLEESNFIKSKFNKDYNLLYELLRDYNTETNHNFKNPNYSTSDLL 182
           L+L+   +    L    E+S +IK  +  ++  +     D   +     ++    +S+  
Sbjct: 99  LFLKGTGIEVQSLYDEFEKSRYIKKTYEAEFKNIERQSLDLVEKWQKPLRDEELLSSNHA 158

Query: 183 NNKXXXXXXXRIVPPSNTILRSMPEWLPSLPPDHTYKFTPLYNEPITDETVMKKILVNEG 242
                      +VPP+N     +P WLP  PPDHTYKFT +YN+PI+DE  MK++L  EG
Sbjct: 159 EFFFKDVDILNLVPPTNINNSYVPTWLPEFPPDHTYKFTAIYNKPISDERQMKRMLFEEG 218

Query: 243 KLAESALIKLLEASTTSEINSLPTPETDRENDLEQNINIDTNTNGNSMTLKSVSENEKTN 302
           KL+E AL+ +L                                +  +  LK   E     
Sbjct: 219 KLSEKALLNML-------------------------------GSAQAKMLKVEDEETIAQ 247

Query: 303 TNERLNDELLAQDETKAIYGSALQVRKIKKRFELMIDPKAET---QLSEEFVYPSTFNVE 359
           T +       +Q+ET+ IYG    V K + R E        T    L     +   FN++
Sbjct: 248 TYKE------SQEETQLIYG----VEKQRPRRENAYVGGNSTNNDDLPLNSSHSKGFNIQ 297

Query: 360 EYARKQVQKIREQVLFYEEKQLQAQKNPFWKYSKMI 395
           EYAR ++   R +V  +E  +LQAQKNPF + S + 
Sbjct: 298 EYARSRIGLARRKVEEFENHKLQAQKNPFIRASSIC 333

>CAGL0B02299g Chr2 (217341..219272) [1932 bp, 643 aa] {ON} some
           similarities with uniprot|Q03750 Saccharomyces
           cerevisiae YML114c TAF65 TBP Associated Factor
          Length = 643

 Score =  143 bits (360), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 116/422 (27%), Positives = 204/422 (48%), Gaps = 85/422 (20%)

Query: 49  IQSPNRLESSCIGQLLAKSIALQLKPMNDNTSISTVAFNRLLTLVDLQLNDMIYQLARLS 108
           I S NR++   +G+LL +++ +QL+ ++ + +++ +A ++L+   + QLN ++  L R+S
Sbjct: 24  INSSNRMDYQ-MGELLKRAVGVQLQTIDKDVTVTRMAMDQLVLFAEDQLNALVDGLHRIS 82

Query: 109 ITQRRLTIASNDLSLWLRSFNLNPSDLTLYLEESNFIKSKFNKDYNLLYE---------- 158
           + QRR +IA +DL +W+R +NL PSDL +  EES FI+  +  D +++++          
Sbjct: 83  LLQRRQSIAVSDLEIWMRGYNLLPSDLYMTAEESKFIRENYRNDTSVVFKDINIDNPMES 142

Query: 159 LLRDYNTETNHNFK----------NPNYSTSDLLNNKXXXXXXXRIVPPSNTILRSMPEW 208
            L   N +   N +          + +Y   +L  +              N  LR  P W
Sbjct: 143 ALGRINIQNKENIEPTDNDVDIDEDDDYELIELQQHAMEQLFKTDTGRGRN--LRYKPGW 200

Query: 209 LPSLPPDHTYKFTPLYNEPITDETVMKKILVNEGKLAESALIKLL--------------- 253
           LP  PPDHTYK+TP Y   +  ET +++ LV EG+L+E AL+KL+               
Sbjct: 201 LPDFPPDHTYKYTPSYVNVVKPETEIRQKLVEEGRLSEKALVKLMSNLDSISTTKDNQKG 260

Query: 254 ------------EASTTSEINSLPTPETDRENDLEQ-NINIDTNTNGNSMTLKS------ 294
                       E S   E+ S+ T + D    LE  N   D  T GN + + +      
Sbjct: 261 THLKQENNLILSEESNNLEVQSISTDKPDDVGSLEDINKQDDDKTQGNKIEVDAENKDQV 320

Query: 295 --VSENEKTN------------TNERLNDELLAQDETKAIYGSALQVRKIKKRFELMIDP 340
             + EN++++            T ++L++E LA  E KA+      + +I+   E +I+P
Sbjct: 321 VKIEENKESSTEKATETATETATEKQLSEEELADLEIKAL------LYRIENNKEYLIEP 374

Query: 341 KAETQLSEEF----VYPST----FNVEEYARKQVQKIREQVLFYEEKQLQAQKNPFWKYS 392
              + L          P++    F+VE YAR++++  R +V+ +E +QL  + NP  + +
Sbjct: 375 MRVSLLKGVLKDLDSNPTSKLKDFDVEAYARQRIEIARRKVVDFEYEQLYLKYNPLLRLA 434

Query: 393 KM 394
           KM
Sbjct: 435 KM 436

>KLTH0C03916g Chr3 complement(342430..344142) [1713 bp, 570 aa] {ON}
           weakly similar to uniprot|Q03750 Saccharomyces
           cerevisiae YML114C TAF8 TFIID subunit (65 kDa) involved
           in RNA polymerase II transcription initiation
          Length = 570

 Score =  140 bits (354), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 111/364 (30%), Positives = 172/364 (47%), Gaps = 68/364 (18%)

Query: 42  LKNLPDLIQSPNRLESSCIGQLLAKSIALQLKPMNDNTSISTVAFNRLLTLVDLQLNDMI 101
           L++LP+L + P       + +LL K++A+QLK +N N SIS  AF  L+ LV+  L++M+
Sbjct: 21  LRHLPNLEEIPRTALDDPLRKLLEKAVAIQLKAVNSNVSISQFAFENLIILVEQMLSNML 80

Query: 102 YQLARLSITQRRLTIASNDLSLWLRSFNLNPSDLTLYLEESNFIKSKFNKDYNLLYELLR 161
             L ++   QRR  I+  DL L +  +NL  +DL + LE S +++S     +NL  E +R
Sbjct: 81  VDLHKMVNIQRRHCISKKDLLLIIDGYNLTCADLMVELERSQYVRS-----HNL--ERVR 133

Query: 162 DYNTET---NHNFKNPNYSTSDLLNNKX-----XXXXXXRIVPPSNTILRSMPEWLPSLP 213
               E+       K P  S  +LL +K             +VPP+    + +P WLP  P
Sbjct: 134 KVREESEVVEAKEKTP-LSEKELLESKHLEFFIQDKEILTLVPPTPKNTKYVPRWLPEFP 192

Query: 214 PDHTYKFTPLYNEPITDETVMKKILVNEGKLAESALIKLLEASTTSEINSLPTPETDREN 273
           PDHTY+FT  +N PITDE +MK+ L  E  L+E ALI L + S                 
Sbjct: 193 PDHTYRFTSQFNRPITDERLMKRKLAEEADLSEKALIHLSKLSHEE-------------- 238

Query: 274 DLEQNINIDTNTNGNSMTLKSVSENEKTNTNERLNDELLAQDETKAIYGSA--LQVRKIK 331
                                 S +E  +++E   +   +Q +T+ I+G A   ++  I 
Sbjct: 239 ----------------------SPSEGADSDEIFKE---SQQDTQLIFGPAKKTKIAAIN 273

Query: 332 KRFELMIDPKAETQLSEEFVYPSTFNVEEYARKQVQKIREQVLFYEEKQLQAQKNPFWKY 391
              +L+             +    +NVEEYAR +V+  R +V  YE  QL  QK  F K 
Sbjct: 274 GASDLL-----------RTLPQQNYNVEEYARNRVEIARRKVEEYERHQLLLQKGAFIKA 322

Query: 392 SKMI 395
           + ++
Sbjct: 323 AHLL 326

>Skud_13.27 Chr13 complement(41670..43214) [1545 bp, 514 aa] {ON}
           YML114C (REAL)
          Length = 514

 Score =  138 bits (347), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 111/359 (30%), Positives = 171/359 (47%), Gaps = 70/359 (19%)

Query: 42  LKNLPDLIQSPNRLESSCIGQLLAKSIALQLKPMNDNTSISTVAFNRLLTLVDLQLNDMI 101
           LKNLPDL +  +    + + ++L K++  QL  ++    IS  A + L+ LV +Q++ M 
Sbjct: 19  LKNLPDLTEISHLKIDAPVVEILRKTVLFQLNSLD--ICISNFALDELVNLVAVQMDGMF 76

Query: 102 YQLARLSITQRRLTIASNDLSLWLRSFNLNPSDLTLYLEESNFIKSKFNKDYNLLYELLR 161
             L  L++ QRR      DL L  + FNL+P+ L   L+ S FIKS  + +Y  L  +  
Sbjct: 77  RNLHNLALLQRRSRATQADLKLLFKEFNLDPASLYQQLQISEFIKSNHSVEYEKL--VSS 134

Query: 162 DYNTETNHNFKNPNYSTSDLLNN-KXXXXXXXRIVPPSNTILRSMPEWLPSLPPDHTYKF 220
              + ++HN         D LNN +        ++PPSN + + MP WLP+ PPDHTY+F
Sbjct: 135 SSFSASSHN----EEDEEDELNNIEEQQNEISVLLPPSNPLEKLMPSWLPNFPPDHTYRF 190

Query: 221 TPLYNEPITDETVMKKILVNEGKLAESALI----KLLEASTTSEINSLPTPETDRENDLE 276
           TP +N PITD   +K+ +V E K +E AL+    +LL  S  S     P P         
Sbjct: 191 TPEFNHPITDLKTIKREIVKESKESEKALLNLNKRLLHISLASHA---PPP--------- 238

Query: 277 QNINIDTNTNGNSMTLKSVSENEKTNTNERLNDELLAQDETKAIYGSALQVRKIKKRFEL 336
                                        RL D+  A ++   I+G+ALQ  K       
Sbjct: 239 -----------------------------RLPDDADAGEQQLEIWGNALQEEK------- 262

Query: 337 MIDPKAETQLSEEFVYPSTFNVEEYARKQVQKIREQVLFYEEKQLQAQKNPFWKYSKMI 395
                  T +S+ F   +  N+E+YA+ +V+  RE+V  +E  QL+  KNPF + S+ +
Sbjct: 263 ------RTAISKSF---NENNIEQYAKYRVELARERVSKFEVNQLKRTKNPFLRISETL 312

>SAKL0D01518g Chr4 complement(122448..124172) [1725 bp, 574 aa] {ON}
           weakly similar to uniprot|Q03750 Saccharomyces
           cerevisiae YML114C TAF8 TFIID subunit (65 kDa) involved
           in RNA polymerase II transcription initiation
          Length = 574

 Score =  139 bits (349), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 119/377 (31%), Positives = 179/377 (47%), Gaps = 74/377 (19%)

Query: 34  PTSSNTQL-LKNLPDLIQSPNRLESSCIGQLLAKSIALQLKPMNDNTSISTVAFNRLLTL 92
           P  S  Q+ LK LP L  +P+      + ++L++++A++LKPMN + ++S  AF  L+ L
Sbjct: 12  PAPSRKQIRLKKLPTLHAAPHDSLEQPMHKILSQAVAIRLKPMNKDVAMSQFAFENLVQL 71

Query: 93  VDLQLNDMIYQLARLSITQRRLTIASNDLSLWLRSFNLNPSDLTLYLEESNFIKS----K 148
           V   L+ M+  L R    QRR  I+  DL L L+ ++L+ S+L   LE S +I S    K
Sbjct: 72  VSENLSFMLTTLHRFVDIQRRREISKKDLLLLLKGYDLSNSELMRELESSQYIVSNHPEK 131

Query: 149 FNK----DYNLLYELLRDYNTETNHNFKNPNYSTSDLLNNKXXXXXXXRIVPPSNTILRS 204
            NK       L  +LL+    +   N  +  +   D+            +VPP+N   + 
Sbjct: 132 VNKIAQKSKELKSKLLKPMTEKELLNSAHSEFFFKDM--------DILDLVPPTNKNNQY 183

Query: 205 MPEWLPSLPPDHTYKFTPLYNEPITDETVMKKILVNEGKLAESALIKLLEASTTSEINSL 264
           +P+WLP  PPDHTY+FT  YN+P+ DE  +++ LV EGK +E AL+ LL           
Sbjct: 184 IPKWLPEFPPDHTYRFTSQYNKPVVDERQLRRKLVEEGKQSERALVNLL----------- 232

Query: 265 PTPETDRENDLEQNINIDTNTNGNSMTLKSVSENEKTNTNERLNDELL---AQDETKAIY 321
                 + +D                     S N+    NER+    L    Q+ET  I+
Sbjct: 233 ------KHHD---------------------STNQDLGNNERVEKRSLYEETQEETFLIF 265

Query: 322 GSALQVRKIKKRFELMIDPKAETQLSEEFVYP---STFNVEEYARKQVQKIREQVLFYEE 378
           G     RK              T+ S E +       F+VEEYAR +V+  R +VL YE+
Sbjct: 266 GPE---RK----------KSHTTENSHELLRTLPLKNFSVEEYARNRVEIARRKVLEYEQ 312

Query: 379 KQLQAQKNPFWKYSKMI 395
            QL+ QKNPF K + + 
Sbjct: 313 YQLRLQKNPFIKAANLC 329

>YML114C Chr13 complement(42043..43575) [1533 bp, 510 aa] {ON}
           TAF8TFIID subunit (65 kDa), involved in RNA polymerase
           II transcription initiation
          Length = 510

 Score =  137 bits (345), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 113/366 (30%), Positives = 173/366 (47%), Gaps = 70/366 (19%)

Query: 35  TSSNTQLLKNLPDLIQSPNRLESSCIGQLLAKSIALQLKPMNDNTSISTVAFNRLLTLVD 94
           T S    L+NLPDL +  +    + + ++L K++  QL  +N    IS  A + L+ LV 
Sbjct: 12  TQSTIVQLRNLPDLTEISHLEIDAPVVEILKKTVLFQLNSLN--ICISNFALDELVNLVT 69

Query: 95  LQLNDMIYQLARLSITQRRLTIASNDLSLWLRSFNLNPSDLTLYLEESNFIKSKFNKDYN 154
           +Q++ M   L  L++ QRR   +  DL L LR FNL+   L    + S FIKSK + +Y 
Sbjct: 70  VQMDGMFRNLHNLTLLQRRSQASQADLKLLLREFNLDAPSLYQQFQASEFIKSKHSTEY- 128

Query: 155 LLYELLRDYNT--ETNHNFKNPNYSTSDLLNN-KXXXXXXXRIVPPSNTILRSMPEWLPS 211
              E L  +++     HN         D LNN +        ++PPSN + + +P WLP+
Sbjct: 129 ---EKLMSWSSLAALPHN----EEDEEDELNNIEEQQNEINVLLPPSNPLEKQIPSWLPN 181

Query: 212 LPPDHTYKFTPLYNEPITDETVMKKILVNEGKLAESALIKLLEAST--TSEINSLPTPET 269
            PPDHTYKFTP +N PITD   +KK +V E + +E AL+ L ++ +  +S  N+   P  
Sbjct: 182 FPPDHTYKFTPEFNHPITDLKTIKKEIVKESQESEKALLNLNKSLSHISSASNTPQPPGL 241

Query: 270 DRENDLEQNINIDTNTNGNSMTLKSVSENEKTNTNERLNDELLAQDETKAIYGSALQVRK 329
           D E+ +EQ +                                        I+G+AL+ RK
Sbjct: 242 DDEDAIEQQLE---------------------------------------IWGNALEERK 262

Query: 330 IKKRFELMIDPKAETQLSEEFVYPSTFNVEEYARKQVQKIREQVLFYEEKQLQAQKNPFW 389
                        E   +E        N+E+YA+ +V+  RE+V  +E  QL+  KNPF 
Sbjct: 263 PT---------ITEKSFNEN-------NIEQYAKYRVELARERVTKFEVNQLKRTKNPFL 306

Query: 390 KYSKMI 395
           K S+ +
Sbjct: 307 KISETL 312

>ABL128W Chr2 (155096..156520) [1425 bp, 474 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YML114C (TAF65)
          Length = 474

 Score =  132 bits (331), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 107/355 (30%), Positives = 172/355 (48%), Gaps = 72/355 (20%)

Query: 42  LKNLPDLIQSPNRLESSCIGQLLAKSIALQLKPMNDNTSISTVAFNRLLTLVDLQLNDMI 101
           LK LPDL +     +S+ + +LLA+++ L LK M  +  I+ + F  L+  V+LQL+DM+
Sbjct: 21  LKKLPDLTEV---TKSNPMQKLLAQAVGLHLKTMRSDVGITQLGFENLVQFVELQLDDML 77

Query: 102 YQLARLSITQRRLTIASNDLSLWLRSFNLNPSDLTLYLEESNFIKSKF-NKDYNLLYELL 160
             L R +  QRR  ++  D+ L+L    +   + +LY E   +++S++  + +      +
Sbjct: 78  QILHRFANVQRRNEVSLKDVRLFLHGCGVE--EESLYEE---YVRSQYVRQQHAGAVRSI 132

Query: 161 RDYNTETNHNFKNPNYSTSDLLNNKXXXXXXXRI-----VPPSNTILRSMPEWLPSLPPD 215
            + +     ++  P  S  +LL++         +     VPP+N     +P+WLP  PPD
Sbjct: 133 EEQSASLMGHWHQP-MSEEELLSSSHAEFFFKDVDILNLVPPTNNNNHYVPKWLPEFPPD 191

Query: 216 HTYKFTPLYNEPITDETVMKKILVNEGKLAESALIKLLEASTTSEINSLPTPETDRENDL 275
           HTYKFT +YN+PITDE  MK+ L  E KL+E AL+ +L  +T         P  D +  L
Sbjct: 192 HTYKFTSIYNQPITDERQMKRKLFEESKLSEKALLHMLGTATKK-------PRAD-DAQL 243

Query: 276 EQNINIDTNTNGNSMTLKSVSENEKTNTNERLNDELLAQDETKAIYGSALQVRKIKKRFE 335
            Q I     ++G                          Q E   IYG         +R  
Sbjct: 244 PQII-----SDG--------------------------QQENLLIYGP--------ERRR 264

Query: 336 LMIDPKAETQLSEEFVYPSTFNVEEYARKQVQKIREQVLFYEEKQLQAQKNPFWK 390
           L  +P A T+          FN+E+YAR +V+  R +V  +E+++LQ QKNPF +
Sbjct: 265 LAPEP-APTR---------GFNIEDYARCRVELARRRVEEFEQQKLQVQKNPFIR 309

>Smik_13.20 Chr13 complement(38299..39831) [1533 bp, 510 aa] {ON}
           YML114C (REAL)
          Length = 510

 Score =  132 bits (332), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 106/356 (29%), Positives = 165/356 (46%), Gaps = 64/356 (17%)

Query: 42  LKNLPDLIQSPNRLESSCIGQLLAKSIALQLKPMNDNTSISTVAFNRLLTLVDLQLNDMI 101
           L+ LPDL +  +    + + ++L K++  QL  +N    IS  A + L+ LV +Q++ M 
Sbjct: 19  LRRLPDLTEISHLEIDAPVVEILKKTVLFQLNSLN--ICISNFALDELVNLVAVQMDGMF 76

Query: 102 YQLARLSITQRRLTIASNDLSLWLRSFNLNPSDLTLYLEESNFIKSKFNKDYNLLYELLR 161
             L  L++ QRR   +  DL L  R FN++ + L    + S FIKS    +Y  L  L  
Sbjct: 77  RNLHNLTLLQRRSEASQADLKLLFREFNVDAASLYQQFQVSEFIKSNHAVEYGKLVRL-- 134

Query: 162 DYNTETNHNFKNPNYSTSDLLNNKXXXXXXXRIVPPSNTILRSMPEWLPSLPPDHTYKFT 221
                  HN ++      +L N +        ++PPSN + + +P WLP+ PPDHTYKFT
Sbjct: 135 SSFPALAHNEED---EEDELSNIEEQQSEINVLLPPSNPLEKLIPSWLPNFPPDHTYKFT 191

Query: 222 PLYNEPITDETVMKKILVNEGKLAESALIKLLE--ASTTSEINSLPTPETDRENDLEQNI 279
           P +N PITD   +KK +V E + +E AL+ L +  +  +S  ++ P P  D  +  EQ +
Sbjct: 192 PEFNHPITDLKTIKKEIVKESEESEKALLNLNKRLSHLSSASHTSPPPVLDDADATEQQL 251

Query: 280 NIDTNTNGNSMTLKSVSENEKTNTNERLNDELLAQDETKAIYGSALQVRKIKKRFELMID 339
                                                   I+G+ALQ RK          
Sbjct: 252 E---------------------------------------IWGNALQERK---------P 263

Query: 340 PKAETQLSEEFVYPSTFNVEEYARKQVQKIREQVLFYEEKQLQAQKNPFWKYSKMI 395
               T L+E        N+E+YA+ +V+  RE+V  +E  QL+  KNPF K S+ +
Sbjct: 264 TITATSLNES-------NIEQYAKYRVELARERVAKFELNQLKRTKNPFLKLSETL 312

>Suva_13.29 Chr13 complement(41778..43307) [1530 bp, 509 aa] {ON}
           YML114C (REAL)
          Length = 509

 Score =  126 bits (317), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 105/359 (29%), Positives = 164/359 (45%), Gaps = 75/359 (20%)

Query: 42  LKNLPDLIQSPNRLESSCIGQLLAKSIALQLKPMNDNTSISTVAFNRLLTLVDLQLNDMI 101
           L NLPDL +  +    + + ++L KS+  QL  +N    IS  A + ++ LV +Q++ M 
Sbjct: 19  LTNLPDLTEVSHLEIDAPVLEILKKSVLFQLNSLN--ICISNFALDEMVNLVAVQMDGMF 76

Query: 102 YQLARLSITQRRLTIASNDLSLWLRSFNLNPSDLTLYLEESNFIKSKFNKDYNLLYELLR 161
             L  L++ QRR  ++  DL L  R FNLN + L   L+ S  IKSK + +Y  L +   
Sbjct: 77  RNLHNLALLQRRSQVSQADLKLLFREFNLNSASLFQQLQISEHIKSKHSVEYEKLVK--S 134

Query: 162 DYNTETNHNFKNPNYSTSDLLNNKXXXXXXXRIVPPSNTILRSMPEWLPSLPPDHTYKFT 221
              T  +H   +     +++   +        ++PPSN + + +P WLP+ PPDHTYKFT
Sbjct: 135 SSFTAVSHIEDDEEDEINNIEEQQNEINV---LLPPSNPLEKLIPSWLPNFPPDHTYKFT 191

Query: 222 PLYNEPITDETVMKKILVNEGKLAESALI----KLLEASTTSEINSLPTPETDRENDLEQ 277
           P +N PITD   +K+ +V E   +E AL+    +L   S+ S     P+P     +D   
Sbjct: 192 PEFNHPITDLKTIKREIVKESGESERALLNLNKRLFRISSASHT---PSPRLPDASD--- 245

Query: 278 NINIDTNTNGNSMTLKSVSENEKTNTNERLNDELLAQDETKAIYGSALQVRK---IKKRF 334
                                     +ERL            I+G+ L  RK   I K F
Sbjct: 246 -------------------------ASERLE-----------IWGNTLHERKPAIIAKSF 269

Query: 335 ELMIDPKAETQLSEEFVYPSTFNVEEYARKQVQKIREQVLFYEEKQLQAQKNPFWKYSK 393
                              +  N+E+YA+ +++  RE+V  +E  QL+  KNPF K S+
Sbjct: 270 -------------------NEKNIEQYAKYRIELARERVSKFEVNQLKRTKNPFLKISE 309

>KLLA0D01617g Chr4 complement(143940..145628) [1689 bp, 562 aa] {ON}
           weakly similar to uniprot|Q03750 Saccharomyces
           cerevisiae YML114C TAF8 TFIID subunit (65 kDa) involved
           in RNA polymerase II transcription initiation
          Length = 562

 Score =  122 bits (306), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 80/222 (36%), Positives = 124/222 (55%), Gaps = 23/222 (10%)

Query: 42  LKNLPDLIQSPNRLESSCIGQLLAKSIALQLKPMNDNTSISTVAFNRLLTLVDLQLNDMI 101
           L  LP+L + P+   ++ + +L A+++ LQLK +N N  IS +AF+ L  +  LQL+D++
Sbjct: 23  LDKLPNLNEVPH---ANPMERLFAQAVLLQLKTLNKNVVISQLAFDDLCYVSLLQLDDLL 79

Query: 102 YQLARLSITQRRLTIASNDLSLWLRSFNLNPSDLTLYLEESNFIKSKFNKDYNLLYELLR 161
             L +++  QRR  I+  DL+L+ +   ++  DL   +E SNF+  KF  + N L E + 
Sbjct: 80  QSLKKITQVQRRTKISKLDLNLYFKGIGMDLKDLNGQVEISNFVHGKFKDEANALNETVL 139

Query: 162 DYNTETNHNFKNPNYSTS----------DLLNNKXXXXXXXRIVPPSNTILRSMPEWLPS 211
               +     +     +S          D+LN          ++P SN   + +P WLP 
Sbjct: 140 KVKQQFMKELEEKELLSSKHSEFFVQDVDILN----------LLPSSNKSNKYVPSWLPE 189

Query: 212 LPPDHTYKFTPLYNEPITDETVMKKILVNEGKLAESALIKLL 253
           LPPDHTYKFT LY  PITDE +MKK L+ EG+L+E AL+ +L
Sbjct: 190 LPPDHTYKFTSLYKRPITDERLMKKKLLEEGRLSEKALLNML 231

>KNAG0G03410 Chr7 (731420..733000) [1581 bp, 526 aa] {ON} Anc_8.838
           YML114C
          Length = 526

 Score = 73.6 bits (179), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 89/356 (25%), Positives = 159/356 (44%), Gaps = 59/356 (16%)

Query: 41  LLKNLPDLIQSPNRLESSCIGQLLAKSIALQL------KPMNDNTSISTVAFNRLLTLVD 94
           L+ ++   ++ P+    + + Q+LA S+A Q+              ++  AF  LL LV+
Sbjct: 16  LVGDVSAPVELPHEPWDARVDQMLANSVAFQMSAGLARGGGGGGVGMAGQAFQLLLQLVE 75

Query: 95  LQLNDMIYQLARLSITQRRLTIASNDLSLWLRSFNLNPSDLTLYLEESNFIKSKFNKDYN 154
            QL+ M+ +L R++  QRR     +D++L L+ F L P D+    EE  ++  K    YN
Sbjct: 76  EQLSGMVTELHRIATVQRRQHATHDDVALLLQGFQLTPEDI----EEQMYLSKKIG--YN 129

Query: 155 LLYELLRDYNTETNHNFKNPNYSTSDLLNNKXXXXXXXRIVPPSN--TILRSMPEWLPSL 212
            + ++ R+   +        +Y    L+ N+            S    I   +P WLP L
Sbjct: 130 RM-QVPREQTVQLQD--ATGSYDRFKLVENQQLIASGLSGSDMSQELPIAEKIPAWLPKL 186

Query: 213 PPDHTYKFTPLYNEPITDETVMKKILVNEGKLAESALIKLLEASTTSEINSLPTPETDRE 272
           PP+HTYKFT  YN+ + DE V+K+ ++ E    E +L                       
Sbjct: 187 PPNHTYKFTTEYNKLLNDEKVLKEKIIKESMEIEVSL----------------------- 223

Query: 273 NDLEQNINIDTNTNGNSMTLKSVSENEKTNTNERLNDELLAQDETKAIYGSALQVRKIKK 332
           ++L +N + D +T  +    ++  E  K     R++DE++      A+YG    + +I +
Sbjct: 224 SNLVRNCDRDADTKVDERARETPPEELK-----RIDDEIV------ALYGP---LEEIAE 269

Query: 333 RFELMIDPKAETQLSEEFVYPSTFNVEEYARKQVQKIREQVLFYEEKQLQAQKNPF 388
           R E    P+  T+         +F+V+ Y+  +V+  R  V  +E +     +NPF
Sbjct: 270 RHE---GPR--TKRRTPLYLKKSFDVQAYSLGRVKLARNAVQRFEWETKYRPRNPF 320

>KNAG0I02930 Chr9 complement(576072..581798) [5727 bp, 1908 aa] {ON}
           Anc_4.50 YLR305C
          Length = 1908

 Score = 33.1 bits (74), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 40/75 (53%), Gaps = 3/75 (4%)

Query: 19  IPDHKINQNVLKNSHPTSSNTQLLKNLPDLIQSPNRLESSCIGQLLAKSIALQLKPMNDN 78
           +P   +    + N H    + QLL+  P L+ S    ESS +   L+K   + L+ +N++
Sbjct: 395 LPSAVVAAASILNFHTEQLSEQLLRAFPLLVGSEYMTESSVVK--LSKIFTVGLQALNED 452

Query: 79  TSISTV-AFNRLLTL 92
           + +ST+ + N LLTL
Sbjct: 453 SIVSTIYSINNLLTL 467

>TBLA0G03190 Chr7 (845472..848477) [3006 bp, 1001 aa] {ON} Anc_3.292
           YBR073W
          Length = 1001

 Score = 32.7 bits (73), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 24/99 (24%), Positives = 48/99 (48%), Gaps = 8/99 (8%)

Query: 509 HDLQKENDGLFADLGSSDDDES------STRHQNTSDKTQETHSPKLSQNEDQHANNNET 562
           HDL    +GL  ++  SD+D+S      S  +Q++S       + K  +N+D +++ N +
Sbjct: 886 HDLICSCEGLGDEIQYSDEDDSDISRDISLEYQSSSPWITGLQAQKFIENKDYNSSRNTS 945

Query: 563 QEIVKHVLEHNHNN--ETQEIVNHEIKENHKNGTQDIAI 599
             I K +L + H N   T+++ +  + +   N   D+  
Sbjct: 946 TSIKKCLLGYRHINPHNTRDVFDEVLSQTLPNLKADLTF 984

>TPHA0C03160 Chr3 complement(699424..701691) [2268 bp, 755 aa] {ON}
           Anc_2.248 YNL059C
          Length = 755

 Score = 32.0 bits (71), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 42/82 (51%), Gaps = 12/82 (14%)

Query: 305 ERLNDELLAQDETKAIYGSALQVRKIKKRFELMIDPKAE----TQLSEEFVYPSTFNVEE 360
           E+  +EL  Q E +   G  LQ +  +KR E M++ + E    +QL E+FV        +
Sbjct: 287 EKTEEELRIQAEKRKENGRRLQEQAKQKRIEKMVEKQEEWEYYSQLKEQFV--------D 338

Query: 361 YARKQVQKIREQVLFYEEKQLQ 382
            ++KQ+Q I E   F +E+  +
Sbjct: 339 QSKKQIQSILENAGFDDERDFK 360

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.307    0.124    0.336 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 71,088,299
Number of extensions: 3404100
Number of successful extensions: 31630
Number of sequences better than 10.0: 1034
Number of HSP's gapped: 31116
Number of HSP's successfully gapped: 1356
Length of query: 683
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 567
Effective length of database: 40,180,143
Effective search space: 22782141081
Effective search space used: 22782141081
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.6 bits)
S2: 69 (31.2 bits)