Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0D03240singletonON1591598491e-118
TBLA0A038408.309ON48389710.59
NDAI0F00640singletonON261116690.98
ZYRO0G22132gsingletonON177161681.0
ZYRO0F16588g1.86ON394108681.3
KLLA0F11022g8.73ON88869681.7
NDAI0G06040singletonON243120662.3
NCAS0H03500singletonON315172652.9
Kwal_55.19865singletonON174112643.6
NDAI0F030002.128ON56033644.6
Suva_13.2702.469ON51336645.0
Kwal_47.19340singletonOFF35623645.1
Kwal_27.12435singletonOFF35723635.1
Kwal_14.761singletonON31123635.3
Kwal_23.3709singletonON35623635.4
Kwal_1.402singletonON34123635.4
NDAI0D01170singletonON34218635.4
Kwal_9.613singletonOFF35623635.5
Kwal_34.16301singletonOFF35623635.5
TPHA0A025101.369ON50539635.5
Kwal_47.17671singletonON33423635.5
Kwal_55.22270singletonON26023635.9
Kwal_2.420singletonOFF9023605.9
Kwal_33.15093singletonON20423626.6
Kwal_27.11223singletonON17423626.7
NCAS0C033508.309ON52330636.9
Kwal_39.16406singletonOFF22323627.4
Kwal_60.24910singletonON52423627.7
KAFR0H003805.671ON81634627.8
Kwal_56.22677singletonOFF25227628.1
NCAS0A150607.519ON138677628.5
TPHA0A057003.499ON25638619.0
Kwal_39.16389singletonOFF14023609.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0D03240
         (159 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0D03240 Chr4 complement(804560..805039) [480 bp, 159 aa] {ON}     331   e-118
TBLA0A03840 Chr1 (961798..963249) [1452 bp, 483 aa] {ON} Anc_8.3...    32   0.59 
NDAI0F00640 Chr6 complement(154463..155248) [786 bp, 261 aa] {ON}      31   0.98 
ZYRO0G22132g Chr7 (1817612..1818145) [534 bp, 177 aa] {ON} no si...    31   1.0  
ZYRO0F16588g Chr6 complement(1365363..1366547) [1185 bp, 394 aa]...    31   1.3  
KLLA0F11022g Chr6 complement(1016214..1018880) [2667 bp, 888 aa]...    31   1.7  
NDAI0G06040 Chr7 (1492257..1492988) [732 bp, 243 aa] {ON}              30   2.3  
NCAS0H03500 Chr8 (661479..662426) [948 bp, 315 aa] {ON}                30   2.9  
Kwal_55.19865 s55 (157671..158195) [525 bp, 174 aa] {ON} [contig...    29   3.6  
NDAI0F03000 Chr6 complement(729817..731499) [1683 bp, 560 aa] {O...    29   4.6  
Suva_13.270 Chr13 (435573..437114) [1542 bp, 513 aa] {ON} YMR093...    29   5.0  
Kwal_47.19340 s47 (1198185..1199255) [1071 bp, 356 aa] {OFF} [co...    29   5.1  
Kwal_27.12435 s27 (1218177..1219250) [1074 bp, 357 aa] {OFF} [co...    29   5.1  
Kwal_14.761 s14 (31709..32644) [936 bp, 311 aa] {ON} [contig 245...    29   5.3  
Kwal_23.3709 s23 (399199..400269) [1071 bp, 356 aa] {ON} [contig...    29   5.4  
Kwal_1.402 s1 (628..1653) [1026 bp, 341 aa] {ON} [contig 695] FULL     29   5.4  
NDAI0D01170 Chr4 complement(268420..269448) [1029 bp, 342 aa] {O...    29   5.4  
Kwal_9.613 s9 (50..1120) [1071 bp, 356 aa] {OFF} [contig 351] FULL     29   5.5  
Kwal_34.16301 s34 (279917..280987) [1071 bp, 356 aa] {OFF} [cont...    29   5.5  
TPHA0A02510 Chr1 (536076..536097,536233..537728) [1518 bp, 505 a...    29   5.5  
Kwal_47.17671 s47 complement(508381..509385) [1005 bp, 334 aa] {...    29   5.5  
Kwal_55.22270 s55 (1176867..1177649) [783 bp, 260 aa] {ON} [cont...    29   5.9  
Kwal_2.420 s2 (1297..1569) [273 bp, 90 aa] {OFF} [contig 305] FULL     28   5.9  
Kwal_33.15093 s33 complement(958640..959254) [615 bp, 204 aa] {O...    28   6.6  
Kwal_27.11223 s27 complement(693349..693873) [525 bp, 174 aa] {O...    28   6.7  
NCAS0C03350 Chr3 complement(655819..657390) [1572 bp, 523 aa] {O...    29   6.9  
Kwal_39.16406 s39 (7096..7767) [672 bp, 223 aa] {OFF} [contig 37...    28   7.4  
Kwal_60.24910 s60 (1218..2792) [1575 bp, 524 aa] {ON} YDR261W-B ...    28   7.7  
KAFR0H00380 Chr8 (64770..67220) [2451 bp, 816 aa] {ON} Anc_5.671...    28   7.8  
Kwal_56.22677 s56 complement(231559..232317) [759 bp, 252 aa] {O...    28   8.1  
NCAS0A15060 Chr1 (2966614..2970774) [4161 bp, 1386 aa] {ON} Anc_...    28   8.5  
TPHA0A05700 Chr1 (1291206..1291976) [771 bp, 256 aa] {ON} Anc_3....    28   9.0  
Kwal_39.16389 s39 (1595..2017) [423 bp, 140 aa] {OFF} [contig 34...    28   9.2  

>TBLA0D03240 Chr4 complement(804560..805039) [480 bp, 159 aa] {ON} 
          Length = 159

 Score =  331 bits (849), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 159/159 (100%), Positives = 159/159 (100%)

Query: 1   MQQLVDGLFNKFAATRPKYDSLVRLVKVRYTGNNPDYVTNFENAAKDVEDLAVTTADFLA 60
           MQQLVDGLFNKFAATRPKYDSLVRLVKVRYTGNNPDYVTNFENAAKDVEDLAVTTADFLA
Sbjct: 1   MQQLVDGLFNKFAATRPKYDSLVRLVKVRYTGNNPDYVTNFENAAKDVEDLAVTTADFLA 60

Query: 61  FHFLQDLPENILVRQLETIDKGYKLYRIQLKDHNRPPIRYRSKCSTVLEIPQYGNHRQKR 120
           FHFLQDLPENILVRQLETIDKGYKLYRIQLKDHNRPPIRYRSKCSTVLEIPQYGNHRQKR
Sbjct: 61  FHFLQDLPENILVRQLETIDKGYKLYRIQLKDHNRPPIRYRSKCSTVLEIPQYGNHRQKR 120

Query: 121 RKYDLSKTVCHKCNKTGHIAKYCRQNNDSSKYYKGSSNK 159
           RKYDLSKTVCHKCNKTGHIAKYCRQNNDSSKYYKGSSNK
Sbjct: 121 RKYDLSKTVCHKCNKTGHIAKYCRQNNDSSKYYKGSSNK 159

>TBLA0A03840 Chr1 (961798..963249) [1452 bp, 483 aa] {ON} Anc_8.309
           YLR116W
          Length = 483

 Score = 32.0 bits (71), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 24/89 (26%), Positives = 41/89 (46%), Gaps = 5/89 (5%)

Query: 69  ENILVRQLETIDKGYKLYRIQLKD--HNRPPIRYRSKCSTVLEIPQYGNHRQKRRKYDLS 126
           ENI+V+ + + D    L R QL++       +R  ++   +  I  +  +    ++    
Sbjct: 220 ENIVVKAVTSPDGQNDLKRGQLRELAELNGTLREDNRPCPICGIEGHKRYDCPNKEAFAQ 279

Query: 127 KTVCHKCNKTGHIAKYC---RQNNDSSKY 152
           K  C  CN+ GH  + C   R NND S+Y
Sbjct: 280 KVKCRNCNQPGHTTRDCNQPRSNNDISRY 308

>NDAI0F00640 Chr6 complement(154463..155248) [786 bp, 261 aa] {ON} 
          Length = 261

 Score = 31.2 bits (69), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 29/116 (25%), Positives = 52/116 (44%), Gaps = 14/116 (12%)

Query: 36  DYVTNFEN----AAKDVEDLAVTTADFLAFHFLQDLPENILVRQLETIDKGYKLYR---I 88
           +YV +FEN       D +D +   A FL F     L + I  +  + + +   +     I
Sbjct: 118 EYVNHFENRLAFLPADFKDSSWKLACFL-FPLQLGLQDAIRSQNPQNVQEAIVIGENRSI 176

Query: 89  QLKDHNRPPIRYRSKCSTVLEIPQYGNHRQKRRKYDLSKTVCHKCNKTGHIAKYCR 144
             KD    P R+   C  V ++  +G++ +   +++ S  VC  C ++GH +  CR
Sbjct: 177 MFKDSILDP-RF---CGLVSDV--HGDNTKGNHQFNQSAIVCFNCGRSGHKSNECR 226

>ZYRO0G22132g Chr7 (1817612..1818145) [534 bp, 177 aa] {ON} no
           similarity
          Length = 177

 Score = 30.8 bits (68), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 36/161 (22%), Positives = 58/161 (36%), Gaps = 26/161 (16%)

Query: 2   QQLVDGLFNKFAATRPKYDSLVRLVKVRYTGNNPDYVTNFENAAKDVEDLAVTTADFLAF 61
           Q++   L   +      + ++ +L+     G+  DY   F+ A ++V+     T     +
Sbjct: 24  QEVEKALKLNYGLPETNFFAVEKLIHSHQEGSVHDYNVAFKEALRNVQLSEQITEKLSLW 83

Query: 62  HFLQDLPENILV--------RQLETIDKGYKLYRIQLKDHNRPPIRYRSKCSTVLEIPQY 113
            +L  L E++ +          LE + +      I L D  R             +  Q 
Sbjct: 84  FYLIGLKEDVKLDVYCKRPKNYLEAMRRAINWDYIFLPDGKRS-----------YDTVQG 132

Query: 114 GNHRQKRRKYDLSKTV-------CHKCNKTGHIAKYCRQNN 147
            N   +R  Y   K         C KCNK GH AK CR  N
Sbjct: 133 NNENCRRSGYKKFKGFTKNKNKQCFKCNKLGHFAKDCRSKN 173

>ZYRO0F16588g Chr6 complement(1365363..1366547) [1185 bp, 394 aa]
           {ON} similar to uniprot|P53230 Saccharomyces cerevisiae
           YGR046W Essential protein of unknown function mRNA is
           targeted to the bud via the mRNA transport system
           involving She2p
          Length = 394

 Score = 30.8 bits (68), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 29/108 (26%), Positives = 46/108 (42%), Gaps = 5/108 (4%)

Query: 28  VRYTGNNPDYVTNFENAAKDVEDLAVTTADFLAFHFLQDLPENILVRQLETIDKGYKLYR 87
           ++ TG   D +   E   +  ++LA +  D+  + F + LP N    QL T+    +   
Sbjct: 67  IKTTGTTEDDLVFLERGIRKTDELASSFTDY-TYKF-ERLPPNYGSNQLLTVGNELQAEL 124

Query: 88  IQLKDHNRPPIRYR-SKCSTVLEIPQYGNHRQKRRKYDLSKTVCHKCN 134
             +  H R PIRY     S V E  Q G    ++ + DL   V H  +
Sbjct: 125 DSIMTHFRAPIRYAFGYGSGVFE--QNGYSGGEKPQMDLIFGVSHPAH 170

>KLLA0F11022g Chr6 complement(1016214..1018880) [2667 bp, 888 aa]
           {ON} similar to uniprot|P40965 Saccharomyces cerevisiae
           YFL003C MSH4 Protein involved in meiotic recombination
           required for normal levels of crossing over colocalizes
           with Zip2p to discrete foci on meiotic chromosomes has
           homology to bacterial MutS protein
          Length = 888

 Score = 30.8 bits (68), Expect = 1.7,   Method: Composition-based stats.
 Identities = 19/69 (27%), Positives = 35/69 (50%), Gaps = 3/69 (4%)

Query: 23  VRLVKVRYTGNNPDYVTNFENAAKDVEDLAVTTADFLAFHFLQDLPE---NILVRQLETI 79
           +R+  V+   NNPD++ +F    K + DL    +  L+F+    LP+   N ++   E+I
Sbjct: 330 LRVSAVQELQNNPDFLNSFRMELKVLHDLDALFSKLLSFNHTVILPDQKLNYVILLKESI 389

Query: 80  DKGYKLYRI 88
           +    L R+
Sbjct: 390 ESATTLKRL 398

>NDAI0G06040 Chr7 (1492257..1492988) [732 bp, 243 aa] {ON} 
          Length = 243

 Score = 30.0 bits (66), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 33/120 (27%), Positives = 54/120 (45%), Gaps = 22/120 (18%)

Query: 36  DYVTNFEN-AAKDVEDLAVTTADFLAFHF-----LQDL-----PENILVRQLETIDKGYK 84
           +YV +FEN +A    D   ++     F F     LQD      P+N+     E I  G +
Sbjct: 101 EYVNHFENRSAFLPADFKGSSWKLACFLFPLQLGLQDAIRSQDPQNVQ----EAIVIG-E 155

Query: 85  LYRIQLKDHNRPPIRYRSKCSTVLEIPQYGNHRQKRRKYDLSKTVCHKCNKTGHIAKYCR 144
              I  KD    P R+   C  V ++  +G++ +   +++ S  VC  C ++GH +  CR
Sbjct: 156 NRSIMFKDSILDP-RF---CGLVSDV--HGDNTKGNHQFNQSAIVCFNCGRSGHKSNECR 209

>NCAS0H03500 Chr8 (661479..662426) [948 bp, 315 aa] {ON}
          Length = 315

 Score = 29.6 bits (65), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 39/172 (22%), Positives = 66/172 (38%), Gaps = 28/172 (16%)

Query: 10  NKFAATRPKYDSLVRLVKVRYTGNNP------DYVTNFENAAKDVEDLAVTTADFLAFHF 63
           +K   ++   D  ++L+  +YT  N       D++     ++K VE L     + +    
Sbjct: 149 DKVDMSKQTLDDFIKLMADKYTNANAIDVQVQDFLFLRPKSSKAVETLEAHLRNLIPSLL 208

Query: 64  LQDLPENILVRQLETIDKGYK-------------LYRIQLKDHNRPPIRYRSKCSTVLEI 110
            +D+   +++ +L   D+                + RIQ    +R     RS  S     
Sbjct: 209 SEDIARTLMLGKLGREDQAMADQIRALNLNYTQTMARIQETWRSREAASKRSANSD--SY 266

Query: 111 PQYGNHRQKRRKYDLSKTV---CHKCNKTGHIAKYCRQNNDSSKYYKGSSNK 159
           P+  NH  K+ K   +K V   C  C +TGH    C   N   K  K  +NK
Sbjct: 267 PK--NH--KKMKLGGAKNVKITCFGCGETGHKKNECPNKNQDKKKVKADTNK 314

>Kwal_55.19865 s55 (157671..158195) [525 bp, 174 aa] {ON} [contig
           159] FULL
          Length = 174

 Score = 29.3 bits (64), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 28/112 (25%), Positives = 47/112 (41%), Gaps = 24/112 (21%)

Query: 46  KDVEDLAVTTADFLAFHFLQDLPENILVRQLETIDKGYKLYRIQLKDHNRPPIRYRSKCS 105
           +DV+DL   + +   F    D  E I+V+ + +I   + + R            +R+   
Sbjct: 32  EDVQDLLAESKEHRVF----DKEEEIMVKIVASIQPDFVVPREYF--------MFRNVEQ 79

Query: 106 TVLEIPQYGNHRQKR-----------RKYDLSKTVCHKCNKTGHIAKYCRQN 146
           ++ +I QY   R               KY   K  C+KC++ GH +K C QN
Sbjct: 80  SLKDIKQYAKFRCAEGQVPWNPNNWPPKYTQQKR-CYKCDQLGHFSKSCPQN 130

>NDAI0F03000 Chr6 complement(729817..731499) [1683 bp, 560 aa] {ON}
           Anc_2.128 YNL138W
          Length = 560

 Score = 29.3 bits (64), Expect = 4.6,   Method: Composition-based stats.
 Identities = 13/33 (39%), Positives = 19/33 (57%), Gaps = 1/33 (3%)

Query: 19  YDSLVRLVKVRYTGNNPDYV-TNFENAAKDVED 50
           +DS +RL+K+      PDY  T+F N  K + D
Sbjct: 134 FDSQLRLIKISTVSKKPDYTSTDFTNTLKPIND 166

>Suva_13.270 Chr13 (435573..437114) [1542 bp, 513 aa] {ON} YMR093W
           (REAL)
          Length = 513

 Score = 29.3 bits (64), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 12/36 (33%), Positives = 21/36 (58%)

Query: 19  YDSLVRLVKVRYTGNNPDYVTNFENAAKDVEDLAVT 54
           YD L+RL   R +G++P Y  N +   +D+  ++ T
Sbjct: 189 YDGLIRLYDTRSSGSSPIYSLNHDQPIEDITAVSPT 224

>Kwal_47.19340 s47 (1198185..1199255) [1071 bp, 356 aa] {OFF}
           [contig 344] FULL
          Length = 356

 Score = 29.3 bits (64), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 9/23 (39%), Positives = 16/23 (69%)

Query: 124 DLSKTVCHKCNKTGHIAKYCRQN 146
           +L  T C+ CN+ GH++  C++N
Sbjct: 291 NLQNTRCYTCNEVGHLSNNCKKN 313

>Kwal_27.12435 s27 (1218177..1219250) [1074 bp, 357 aa] {OFF}
           [contig 457] FULL
          Length = 357

 Score = 28.9 bits (63), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 9/23 (39%), Positives = 16/23 (69%)

Query: 124 DLSKTVCHKCNKTGHIAKYCRQN 146
           +L  T C+ CN+ GH++  C++N
Sbjct: 292 NLQTTRCYNCNEIGHLSNNCKKN 314

>Kwal_14.761 s14 (31709..32644) [936 bp, 311 aa] {ON} [contig 245]
           FULL
          Length = 311

 Score = 28.9 bits (63), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 9/23 (39%), Positives = 16/23 (69%)

Query: 124 DLSKTVCHKCNKTGHIAKYCRQN 146
           +L  T C+ CN+ GH++  C++N
Sbjct: 268 NLQNTRCYTCNEVGHLSNNCKKN 290

>Kwal_23.3709 s23 (399199..400269) [1071 bp, 356 aa] {ON} [contig
           254] FULL
          Length = 356

 Score = 28.9 bits (63), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 9/23 (39%), Positives = 16/23 (69%)

Query: 124 DLSKTVCHKCNKTGHIAKYCRQN 146
           +L  T C+ CN+ GH++  C++N
Sbjct: 291 NLQNTRCYTCNEVGHLSNNCKKN 313

>Kwal_1.402 s1 (628..1653) [1026 bp, 341 aa] {ON} [contig 695] FULL
          Length = 341

 Score = 28.9 bits (63), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 9/23 (39%), Positives = 16/23 (69%)

Query: 124 DLSKTVCHKCNKTGHIAKYCRQN 146
           +L  T C+ CN+ GH++  C++N
Sbjct: 292 NLQTTRCYNCNEIGHLSNNCKKN 314

>NDAI0D01170 Chr4 complement(268420..269448) [1029 bp, 342 aa] {ON} 
          Length = 342

 Score = 28.9 bits (63), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 9/18 (50%), Positives = 14/18 (77%)

Query: 126 SKTVCHKCNKTGHIAKYC 143
           +K+ C++CN+TGH A  C
Sbjct: 319 AKSRCYRCNETGHFAAKC 336

>Kwal_9.613 s9 (50..1120) [1071 bp, 356 aa] {OFF} [contig 351] FULL
          Length = 356

 Score = 28.9 bits (63), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 9/23 (39%), Positives = 16/23 (69%)

Query: 124 DLSKTVCHKCNKTGHIAKYCRQN 146
           +L  T C+ CN+ GH++  C++N
Sbjct: 291 NLQTTRCYNCNEIGHLSNNCKKN 313

>Kwal_34.16301 s34 (279917..280987) [1071 bp, 356 aa] {OFF} [contig
           710] FULL
          Length = 356

 Score = 28.9 bits (63), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 9/23 (39%), Positives = 16/23 (69%)

Query: 124 DLSKTVCHKCNKTGHIAKYCRQN 146
           +L  T C+ CN+ GH++  C++N
Sbjct: 291 NLQTTRCYNCNEIGHLSNNCKKN 313

>TPHA0A02510 Chr1 (536076..536097,536233..537728) [1518 bp, 505 aa]
           {ON} Anc_1.369 YFR010W
          Length = 505

 Score = 28.9 bits (63), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 13/39 (33%), Positives = 22/39 (56%), Gaps = 2/39 (5%)

Query: 123 YDLSKTVCHKC--NKTGHIAKYCRQNNDSSKYYKGSSNK 159
           YDL   + H+   +++GH   + R  ND  K+YK + +K
Sbjct: 436 YDLIGIITHQGANSESGHYQSFIRDENDEDKWYKFNDDK 474

>Kwal_47.17671 s47 complement(508381..509385) [1005 bp, 334 aa] {ON}
           [contig 206] FULL
          Length = 334

 Score = 28.9 bits (63), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 9/23 (39%), Positives = 16/23 (69%)

Query: 124 DLSKTVCHKCNKTGHIAKYCRQN 146
           +L  T C+ CN+ GH++  C++N
Sbjct: 291 NLQTTRCYNCNEIGHLSNNCKKN 313

>Kwal_55.22270 s55 (1176867..1177649) [783 bp, 260 aa] {ON} [contig
           327] FULL
          Length = 260

 Score = 28.9 bits (63), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 9/23 (39%), Positives = 16/23 (69%)

Query: 124 DLSKTVCHKCNKTGHIAKYCRQN 146
           +L  T C+ CN+ GH++  C++N
Sbjct: 217 NLQNTRCYTCNEVGHLSNNCKKN 239

>Kwal_2.420 s2 (1297..1569) [273 bp, 90 aa] {OFF} [contig 305] FULL
          Length = 90

 Score = 27.7 bits (60), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 9/23 (39%), Positives = 16/23 (69%)

Query: 124 DLSKTVCHKCNKTGHIAKYCRQN 146
           +L  T C+ CN+ GH++  C++N
Sbjct: 38  NLQTTRCYNCNEIGHLSNNCKKN 60

>Kwal_33.15093 s33 complement(958640..959254) [615 bp, 204 aa] {ON}
           [contig 94] FULL
          Length = 204

 Score = 28.5 bits (62), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 9/23 (39%), Positives = 16/23 (69%)

Query: 124 DLSKTVCHKCNKTGHIAKYCRQN 146
           +L  T C+ CN+ GH++  C++N
Sbjct: 139 NLQTTRCYNCNEIGHLSNNCKKN 161

>Kwal_27.11223 s27 complement(693349..693873) [525 bp, 174 aa] {ON}
           [contig 345] PARTIAL
          Length = 174

 Score = 28.5 bits (62), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 9/23 (39%), Positives = 16/23 (69%)

Query: 124 DLSKTVCHKCNKTGHIAKYCRQN 146
           +L  T C+ CN+ GH++  C++N
Sbjct: 139 NLQTTRCYNCNEIGHLSNNCKKN 161

>NCAS0C03350 Chr3 complement(655819..657390) [1572 bp, 523 aa] {ON}
           Anc_8.309 YLR116W
          Length = 523

 Score = 28.9 bits (63), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 10/30 (33%), Positives = 16/30 (53%)

Query: 129 VCHKCNKTGHIAKYCRQNNDSSKYYKGSSN 158
           VC KC +TGH  + C       +++  S+N
Sbjct: 303 VCRKCGQTGHTTRDCTFTTQPPQHFPPSTN 332

>Kwal_39.16406 s39 (7096..7767) [672 bp, 223 aa] {OFF} [contig 372]
           FULL
          Length = 223

 Score = 28.5 bits (62), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 9/23 (39%), Positives = 16/23 (69%)

Query: 124 DLSKTVCHKCNKTGHIAKYCRQN 146
           +L  T C+ CN+ GH++  C++N
Sbjct: 158 NLQTTRCYNCNEIGHLSNNCKKN 180

>Kwal_60.24910 s60 (1218..2792) [1575 bp, 524 aa] {ON} YDR261W-B -
           TyB Gag-Pol protein [contig 691] FULL
          Length = 524

 Score = 28.5 bits (62), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 9/23 (39%), Positives = 16/23 (69%)

Query: 124 DLSKTVCHKCNKTGHIAKYCRQN 146
           +L  T C+ CN+ GH++  C++N
Sbjct: 139 NLQTTRCYNCNEIGHLSNNCKKN 161

>KAFR0H00380 Chr8 (64770..67220) [2451 bp, 816 aa] {ON} Anc_5.671
           YKR079C
          Length = 816

 Score = 28.5 bits (62), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 11/34 (32%), Positives = 21/34 (61%)

Query: 88  IQLKDHNRPPIRYRSKCSTVLEIPQYGNHRQKRR 121
           I L   +  P +YR+  ST++++P + +H  K+R
Sbjct: 470 ITLGTGSALPSKYRNVVSTLIKVPYFSDHEMKQR 503

>Kwal_56.22677 s56 complement(231559..232317) [759 bp, 252 aa] {OFF}
           [contig 184] FULL
          Length = 252

 Score = 28.5 bits (62), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 10/27 (37%), Positives = 15/27 (55%)

Query: 120 RRKYDLSKTVCHKCNKTGHIAKYCRQN 146
           R +     + C KCNK GH ++ C +N
Sbjct: 224 RNQQPFPSSACFKCNKEGHFSRNCPKN 250

>NCAS0A15060 Chr1 (2966614..2970774) [4161 bp, 1386 aa] {ON} Anc_7.519
            YPR164W
          Length = 1386

 Score = 28.5 bits (62), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 20/77 (25%), Positives = 36/77 (46%), Gaps = 10/77 (12%)

Query: 22   LVRLVKVRYTGNNPDYVTNFENAAKDVEDL----AVTTADFLAFHFLQDLPENILVRQLE 77
            LV +V++ + G N   + N+EN  K VE +     + T    ++ F  ++ E + V    
Sbjct: 1015 LVNMVEIPHEGTNVHLLLNYENVLKLVELVPQKGGILTELVCSYTFNSNIKEKVFV---- 1070

Query: 78   TIDKGYKLYRIQLKDHN 94
              DK    + +Q+ D N
Sbjct: 1071 --DKDGSFFVLQIGDKN 1085

>TPHA0A05700 Chr1 (1291206..1291976) [771 bp, 256 aa] {ON} Anc_3.499
           YGR135W
          Length = 256

 Score = 28.1 bits (61), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 23/38 (60%), Gaps = 4/38 (10%)

Query: 50  DLAVTTADFLAFHFLQ----DLPENILVRQLETIDKGY 83
           ++ + TA   A ++LQ    D+P  +LVR+L  I +GY
Sbjct: 85  EILINTARVFAQNYLQTYNEDIPVEVLVRKLSDIKQGY 122

>Kwal_39.16389 s39 (1595..2017) [423 bp, 140 aa] {OFF} [contig 349]
           FULL
          Length = 140

 Score = 27.7 bits (60), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 9/23 (39%), Positives = 16/23 (69%)

Query: 124 DLSKTVCHKCNKTGHIAKYCRQN 146
           +L  T C+ CN+ GH++  C++N
Sbjct: 79  NLQTTRCYNCNEIGHLSNNCKKN 101

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.135    0.402 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 18,834,704
Number of extensions: 788323
Number of successful extensions: 2612
Number of sequences better than 10.0: 69
Number of HSP's gapped: 2612
Number of HSP's successfully gapped: 77
Length of query: 159
Length of database: 53,481,399
Length adjustment: 101
Effective length of query: 58
Effective length of database: 41,900,133
Effective search space: 2430207714
Effective search space used: 2430207714
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 61 (28.1 bits)